data_1Y3K # _entry.id 1Y3K # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1Y3K pdb_00001y3k 10.2210/pdb1y3k/pdb RCSB RCSB031071 ? ? WWPDB D_1000031071 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-03-08 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1Y3K _pdbx_database_status.recvd_initial_deposition_date 2004-11-25 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1Y3J 'The same protein with copper(I)' unspecified TargetDB CIRMMP26 . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Banci, L.' 1 'Chasapis, C.T.' 2 'Ciofi-Baffoni, S.' 3 'Hadjiliadis, N.' 4 'Rosato, A.' 5 'Structural Proteomics in Europe (SPINE)' 6 # _citation.id primary _citation.title ;An NMR study of the interaction between the human copper(I) chaperone and the second and fifth metal-binding domains of the Menkes protein ; _citation.journal_abbrev 'Febs J.' _citation.journal_volume 272 _citation.page_first 865 _citation.page_last 871 _citation.year 2005 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 1742-464X _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15670166 _citation.pdbx_database_id_DOI 10.1111/j.1742-4658.2004.04526.x # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Banci, L.' 1 ? primary 'Bertini, I.' 2 ? primary 'Ciofi-Baffoni, S.' 3 ? primary 'Chasapis, C.T.' 4 ? primary 'Hadjiliadis, N.' 5 ? primary 'Rosato, A.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Copper-transporting ATPase 1' _entity.formula_weight 8485.839 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.6.3.4 _entity.pdbx_mutation ? _entity.pdbx_fragment 'fifth domain of the menkes protein' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Menkes protein, Copper pump 1, Menkes disease-associated protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code NSSKCYIQVTGMTCASCVANIERNLRREEGIYSILVALMAGKAEVRYNPAVIQPPMIAEFIRELGFGATVIENIEGR _entity_poly.pdbx_seq_one_letter_code_can NSSKCYIQVTGMTCASCVANIERNLRREEGIYSILVALMAGKAEVRYNPAVIQPPMIAEFIRELGFGATVIENIEGR _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier CIRMMP26 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASN n 1 2 SER n 1 3 SER n 1 4 LYS n 1 5 CYS n 1 6 TYR n 1 7 ILE n 1 8 GLN n 1 9 VAL n 1 10 THR n 1 11 GLY n 1 12 MET n 1 13 THR n 1 14 CYS n 1 15 ALA n 1 16 SER n 1 17 CYS n 1 18 VAL n 1 19 ALA n 1 20 ASN n 1 21 ILE n 1 22 GLU n 1 23 ARG n 1 24 ASN n 1 25 LEU n 1 26 ARG n 1 27 ARG n 1 28 GLU n 1 29 GLU n 1 30 GLY n 1 31 ILE n 1 32 TYR n 1 33 SER n 1 34 ILE n 1 35 LEU n 1 36 VAL n 1 37 ALA n 1 38 LEU n 1 39 MET n 1 40 ALA n 1 41 GLY n 1 42 LYS n 1 43 ALA n 1 44 GLU n 1 45 VAL n 1 46 ARG n 1 47 TYR n 1 48 ASN n 1 49 PRO n 1 50 ALA n 1 51 VAL n 1 52 ILE n 1 53 GLN n 1 54 PRO n 1 55 PRO n 1 56 MET n 1 57 ILE n 1 58 ALA n 1 59 GLU n 1 60 PHE n 1 61 ILE n 1 62 ARG n 1 63 GLU n 1 64 LEU n 1 65 GLY n 1 66 PHE n 1 67 GLY n 1 68 ALA n 1 69 THR n 1 70 VAL n 1 71 ILE n 1 72 GLU n 1 73 ASN n 1 74 ILE n 1 75 GLU n 1 76 GLY n 1 77 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ATP7A _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pLys' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET20b(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASN 1 1 1 ASN ASN A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 ARG 77 77 77 ARG ARG A . n # _exptl.entry_id 1Y3K _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1Y3K _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1Y3K _struct.title 'Solution structure of the apo form of the fifth domain of Menkes protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1Y3K _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text ;ferrodoxin-like fold, beta-alpha-beta-beta-alpha-beta structure, Structural Proteomics in Europe, SPINE, Structural Genomics, HYDROLASE ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ATP7A_HUMAN _struct_ref.pdbx_db_accession Q04656 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code NSSKCYIQVTGMTCASCVANIERNLRREEGIYSILVALMAGKAEVRYNPAVIQPPMIAEFIRELGFGATVIEN _struct_ref.pdbx_align_begin 486 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1Y3K _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 73 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q04656 _struct_ref_seq.db_align_beg 486 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 558 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 73 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1Y3K ILE A 74 ? UNP Q04656 ? ? 'cloning artifact' 74 1 1 1Y3K GLU A 75 ? UNP Q04656 ? ? 'cloning artifact' 75 2 1 1Y3K GLY A 76 ? UNP Q04656 ? ? 'cloning artifact' 76 3 1 1Y3K ARG A 77 ? UNP Q04656 ? ? 'cloning artifact' 77 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 15 ? ARG A 27 ? ALA A 15 ARG A 27 1 ? 13 HELX_P HELX_P2 2 ALA A 37 ? GLY A 41 ? ALA A 37 GLY A 41 5 ? 5 HELX_P HELX_P3 3 GLN A 53 ? GLU A 63 ? GLN A 53 GLU A 63 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 43 ? TYR A 47 ? ALA A 43 TYR A 47 A 2 SER A 3 ? VAL A 9 ? SER A 3 VAL A 9 A 3 ALA A 68 ? GLU A 72 ? ALA A 68 GLU A 72 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 45 ? O VAL A 45 N CYS A 5 ? N CYS A 5 A 2 3 N TYR A 6 ? N TYR A 6 O ILE A 71 ? O ILE A 71 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? 52.77 83.02 2 1 CYS A 14 ? ? -79.50 47.02 3 1 ALA A 15 ? ? 18.69 -95.03 4 1 VAL A 36 ? ? -160.73 103.74 5 1 ALA A 37 ? ? -151.66 41.44 6 1 MET A 39 ? ? -24.29 -54.38 7 1 ALA A 50 ? ? -136.95 -62.23 8 1 GLN A 53 ? ? 77.10 127.86 9 2 THR A 13 ? ? -19.14 -64.50 10 2 CYS A 14 ? ? -174.24 -174.23 11 2 ALA A 15 ? ? -51.75 -70.40 12 2 CYS A 17 ? ? -175.25 -34.76 13 2 GLU A 29 ? ? -68.63 78.46 14 2 VAL A 36 ? ? -156.03 81.63 15 2 ALA A 37 ? ? -142.18 47.22 16 2 MET A 39 ? ? -28.35 -46.16 17 2 ALA A 50 ? ? -137.52 -70.28 18 2 GLN A 53 ? ? 84.68 126.85 19 2 GLU A 63 ? ? -39.65 -31.98 20 3 CYS A 14 ? ? -113.97 66.47 21 3 ALA A 15 ? ? 57.72 -73.91 22 3 SER A 16 ? ? -152.63 25.45 23 3 ARG A 27 ? ? -90.92 -71.29 24 3 GLU A 28 ? ? 44.66 -153.71 25 3 VAL A 36 ? ? -162.32 82.96 26 3 ALA A 50 ? ? -145.25 -61.85 27 3 GLN A 53 ? ? 69.86 118.48 28 3 ASN A 73 ? ? -157.42 -47.62 29 4 THR A 10 ? ? -93.31 55.36 30 4 CYS A 17 ? ? -136.61 -54.09 31 4 GLU A 22 ? ? -49.67 -79.81 32 4 GLU A 29 ? ? -65.74 84.05 33 4 VAL A 36 ? ? -160.83 91.31 34 4 ALA A 37 ? ? -148.09 48.71 35 4 ALA A 50 ? ? -146.46 -47.05 36 4 GLN A 53 ? ? 79.31 128.21 37 4 ASN A 73 ? ? 57.56 85.41 38 4 ILE A 74 ? ? 57.08 177.45 39 5 SER A 2 ? ? 77.74 147.04 40 5 ALA A 15 ? ? 71.26 -46.08 41 5 SER A 16 ? ? -147.67 -89.20 42 5 CYS A 17 ? ? 57.84 -77.06 43 5 GLU A 28 ? ? -33.89 123.74 44 5 GLU A 29 ? ? -66.59 76.84 45 5 ALA A 37 ? ? -146.69 49.67 46 5 ALA A 50 ? ? -147.44 -69.09 47 5 GLN A 53 ? ? 71.67 115.50 48 5 ILE A 74 ? ? 52.22 -167.12 49 6 SER A 2 ? ? 14.97 102.64 50 6 ALA A 15 ? ? -16.28 -57.36 51 6 SER A 16 ? ? -149.64 47.49 52 6 VAL A 36 ? ? -160.57 87.13 53 6 ALA A 37 ? ? -140.54 46.10 54 6 MET A 39 ? ? -27.44 -45.15 55 6 TYR A 47 ? ? -126.28 -167.71 56 6 ALA A 50 ? ? -150.54 -47.94 57 6 VAL A 51 ? ? -123.33 -60.50 58 6 GLN A 53 ? ? 81.83 129.12 59 7 SER A 2 ? ? 176.35 133.91 60 7 THR A 13 ? ? -179.52 -55.02 61 7 CYS A 14 ? ? -168.20 -158.10 62 7 ALA A 15 ? ? -66.91 -78.88 63 7 CYS A 17 ? ? -131.13 -44.88 64 7 GLU A 29 ? ? -66.04 83.57 65 7 VAL A 36 ? ? -160.40 96.73 66 7 ALA A 37 ? ? -146.17 46.45 67 7 MET A 39 ? ? -37.79 -38.61 68 7 ALA A 50 ? ? -135.33 -58.49 69 7 GLN A 53 ? ? 73.70 119.17 70 7 ASN A 73 ? ? -155.39 -50.99 71 8 THR A 10 ? ? -109.42 64.46 72 8 MET A 12 ? ? 44.99 -106.41 73 8 THR A 13 ? ? -158.18 30.95 74 8 CYS A 14 ? ? 68.81 -79.80 75 8 ALA A 15 ? ? 179.72 129.60 76 8 SER A 16 ? ? 54.72 16.27 77 8 GLU A 29 ? ? -55.18 107.63 78 8 VAL A 36 ? ? -157.45 81.37 79 8 ALA A 50 ? ? -146.46 -50.73 80 8 VAL A 51 ? ? -104.44 -61.21 81 8 GLN A 53 ? ? 75.34 124.69 82 8 ILE A 74 ? ? 51.92 -168.89 83 9 ALA A 15 ? ? -64.83 90.63 84 9 ARG A 27 ? ? -142.45 -43.57 85 9 GLU A 28 ? ? 52.53 -141.70 86 9 GLU A 29 ? ? -113.78 62.29 87 9 ALA A 37 ? ? -146.43 43.59 88 9 MET A 39 ? ? -35.65 -32.61 89 9 ALA A 40 ? ? -124.94 -50.08 90 9 ALA A 50 ? ? -136.41 -53.13 91 9 GLN A 53 ? ? 79.39 123.65 92 9 ASN A 73 ? ? -151.86 -58.98 93 10 THR A 13 ? ? 177.69 -54.20 94 10 ALA A 15 ? ? -70.33 32.17 95 10 SER A 16 ? ? -163.68 11.48 96 10 LEU A 25 ? ? -80.54 -79.93 97 10 ARG A 26 ? ? 53.04 -77.89 98 10 GLU A 28 ? ? 43.97 -134.53 99 10 GLU A 29 ? ? -109.39 48.95 100 10 ALA A 37 ? ? -152.18 48.92 101 10 ALA A 50 ? ? -138.00 -64.35 102 10 GLN A 53 ? ? 77.54 120.19 103 10 GLU A 72 ? ? 68.86 139.00 104 10 ASN A 73 ? ? -167.61 45.80 105 11 THR A 10 ? ? -115.49 78.39 106 11 CYS A 14 ? ? -105.36 -85.92 107 11 ALA A 15 ? ? -161.47 92.24 108 11 ARG A 26 ? ? -31.72 -33.51 109 11 ARG A 27 ? ? -169.61 -40.33 110 11 GLU A 28 ? ? 48.17 -134.39 111 11 GLU A 29 ? ? -116.18 53.86 112 11 ALA A 37 ? ? -141.02 45.18 113 11 GLU A 44 ? ? -114.62 67.12 114 11 ALA A 50 ? ? -137.64 -71.16 115 11 GLN A 53 ? ? 81.33 131.29 116 11 GLU A 72 ? ? 67.48 -67.17 117 12 ALA A 15 ? ? -67.75 77.22 118 12 SER A 16 ? ? 70.10 46.71 119 12 ARG A 26 ? ? -21.45 -50.98 120 12 GLU A 28 ? ? 52.19 -145.30 121 12 GLU A 29 ? ? -109.38 54.55 122 12 VAL A 36 ? ? -150.26 73.77 123 12 MET A 39 ? ? -39.84 -35.64 124 12 ALA A 50 ? ? -143.56 -56.95 125 12 GLN A 53 ? ? 70.35 118.20 126 13 SER A 2 ? ? -48.14 154.41 127 13 ALA A 15 ? ? 66.08 87.16 128 13 SER A 16 ? ? 79.83 115.95 129 13 CYS A 17 ? ? 168.97 -55.86 130 13 VAL A 36 ? ? -159.06 88.15 131 13 ALA A 37 ? ? -152.80 42.57 132 13 ALA A 50 ? ? -148.56 -43.46 133 13 VAL A 51 ? ? -124.06 -61.08 134 13 GLN A 53 ? ? 84.09 122.98 135 13 GLU A 72 ? ? -165.25 -168.73 136 14 MET A 12 ? ? 58.86 -158.45 137 14 CYS A 14 ? ? 64.19 -68.82 138 14 ALA A 15 ? ? -160.48 -124.54 139 14 SER A 16 ? ? -71.20 30.55 140 14 ARG A 26 ? ? -12.34 -70.86 141 14 GLU A 28 ? ? 54.21 -137.14 142 14 ALA A 37 ? ? -154.68 45.36 143 14 MET A 39 ? ? -37.25 -35.65 144 14 TYR A 47 ? ? -146.07 -156.83 145 14 ALA A 50 ? ? -177.86 -49.84 146 14 ILE A 52 ? ? -112.54 -93.11 147 14 GLN A 53 ? ? 162.82 127.24 148 14 GLU A 72 ? ? 41.40 73.11 149 14 ASN A 73 ? ? -152.00 72.14 150 15 MET A 12 ? ? 52.93 -150.53 151 15 CYS A 14 ? ? 56.50 -162.22 152 15 SER A 16 ? ? 75.95 74.77 153 15 ARG A 27 ? ? -131.26 -48.35 154 15 GLU A 28 ? ? 54.09 -162.99 155 15 GLU A 29 ? ? -91.20 53.77 156 15 ALA A 37 ? ? -148.48 36.97 157 15 MET A 39 ? ? -38.99 -38.33 158 15 GLU A 44 ? ? -115.63 68.47 159 15 PRO A 49 ? ? -69.80 72.62 160 15 ALA A 50 ? ? -152.79 -45.41 161 15 VAL A 51 ? ? -109.76 -61.16 162 15 GLN A 53 ? ? 75.97 117.76 163 15 GLU A 72 ? ? -76.34 -162.37 164 15 ASN A 73 ? ? -155.37 -85.73 165 16 THR A 10 ? ? -104.33 72.55 166 16 ALA A 15 ? ? -60.84 83.04 167 16 GLU A 28 ? ? -39.89 130.42 168 16 ALA A 37 ? ? -141.54 46.00 169 16 ALA A 50 ? ? -135.56 -66.03 170 16 GLN A 53 ? ? 71.96 117.64 171 16 ASN A 73 ? ? -135.98 -64.61 172 17 SER A 2 ? ? 80.93 82.55 173 17 CYS A 14 ? ? -113.26 -167.99 174 17 ALA A 15 ? ? -69.20 76.97 175 17 GLU A 22 ? ? -49.94 -79.41 176 17 GLU A 29 ? ? -65.96 79.02 177 17 ALA A 37 ? ? -142.63 43.10 178 17 TYR A 47 ? ? -128.80 -169.97 179 17 ALA A 50 ? ? -147.82 -47.95 180 17 GLN A 53 ? ? 78.43 131.29 181 17 ILE A 74 ? ? -52.18 109.18 182 18 SER A 16 ? ? 79.60 123.61 183 18 CYS A 17 ? ? -176.18 -62.81 184 18 GLU A 22 ? ? -42.28 -73.13 185 18 GLU A 29 ? ? -62.89 80.64 186 18 VAL A 36 ? ? -157.99 71.64 187 18 TYR A 47 ? ? -121.23 -162.36 188 18 PRO A 49 ? ? -69.33 90.64 189 18 ALA A 50 ? ? -154.72 -67.47 190 18 GLN A 53 ? ? 71.51 115.70 191 18 GLU A 63 ? ? -39.71 -35.08 192 18 GLU A 72 ? ? -123.14 -68.59 193 19 THR A 13 ? ? -67.00 25.22 194 19 ALA A 15 ? ? 59.62 -76.89 195 19 SER A 16 ? ? -155.01 35.21 196 19 ARG A 27 ? ? -147.06 -46.86 197 19 GLU A 28 ? ? 58.24 -136.01 198 19 ALA A 37 ? ? -157.56 47.99 199 19 MET A 39 ? ? -38.73 -35.98 200 19 ALA A 40 ? ? -131.53 -43.68 201 19 ALA A 50 ? ? -172.04 -48.62 202 19 ILE A 52 ? ? -104.21 -80.01 203 19 GLN A 53 ? ? 161.34 123.30 204 19 GLU A 72 ? ? 54.89 -179.82 205 19 ASN A 73 ? ? 169.56 91.17 206 20 ALA A 15 ? ? -171.13 -81.79 207 20 ARG A 27 ? ? -158.40 -4.52 208 20 GLU A 29 ? ? 50.67 -153.42 209 20 ALA A 37 ? ? -142.64 53.63 210 20 MET A 39 ? ? -38.11 -34.38 211 20 ALA A 40 ? ? -135.07 -46.06 212 20 PRO A 49 ? ? -69.16 79.04 213 20 ALA A 50 ? ? -143.73 -53.12 214 20 GLN A 53 ? ? 78.18 116.12 215 20 GLU A 72 ? ? -172.21 -168.54 216 20 ASN A 73 ? ? -131.04 -58.87 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 6 ASN A 1 ? ? SER A 2 ? ? 136.35 2 9 ASN A 1 ? ? SER A 2 ? ? -144.39 3 13 ASN A 1 ? ? SER A 2 ? ? 142.03 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 47 ? ? 0.159 'SIDE CHAIN' 2 1 ARG A 62 ? ? 0.100 'SIDE CHAIN' 3 1 PHE A 66 ? ? 0.111 'SIDE CHAIN' 4 2 TYR A 47 ? ? 0.111 'SIDE CHAIN' 5 3 TYR A 47 ? ? 0.068 'SIDE CHAIN' 6 4 TYR A 32 ? ? 0.068 'SIDE CHAIN' 7 5 TYR A 6 ? ? 0.087 'SIDE CHAIN' 8 5 TYR A 47 ? ? 0.085 'SIDE CHAIN' 9 6 TYR A 32 ? ? 0.074 'SIDE CHAIN' 10 8 ARG A 23 ? ? 0.092 'SIDE CHAIN' 11 9 TYR A 47 ? ? 0.089 'SIDE CHAIN' 12 11 TYR A 47 ? ? 0.119 'SIDE CHAIN' 13 12 TYR A 6 ? ? 0.074 'SIDE CHAIN' 14 14 TYR A 6 ? ? 0.066 'SIDE CHAIN' 15 15 TYR A 6 ? ? 0.101 'SIDE CHAIN' 16 15 TYR A 47 ? ? 0.081 'SIDE CHAIN' 17 15 ARG A 62 ? ? 0.094 'SIDE CHAIN' 18 17 TYR A 6 ? ? 0.110 'SIDE CHAIN' 19 18 TYR A 6 ? ? 0.071 'SIDE CHAIN' 20 18 TYR A 47 ? ? 0.069 'SIDE CHAIN' 21 20 ARG A 26 ? ? 0.086 'SIDE CHAIN' 22 20 TYR A 47 ? ? 0.133 'SIDE CHAIN' 23 20 ARG A 62 ? ? 0.107 'SIDE CHAIN' # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'Structural Proteomics in Europe' _pdbx_SG_project.initial_of_center SPINE # _pdbx_nmr_ensemble.entry_id 1Y3K _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1Y3K _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1mM MNK5 domain U-15N,13C; 50mM phosphate buffer NA' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50mM sodium phosphate' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY 3 1 1 HCCH-TOCSY 4 1 1 HNHA 5 1 1 CBCANH 6 1 1 'CBCA(CO)NH' 7 1 1 HNCO 8 1 1 '2D NOESY' # _pdbx_nmr_details.entry_id 1Y3K _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_refine.entry_id 1Y3K _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'The structures are based on NOE-derived distance constraints and dihedral angle restraints.' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 3.1 collection ? 1 XwinNMR 3.1 processing ? 2 NEASY ? 'data analysis' ? 3 DYANA ? 'structure solution' ? 4 Amber 5.0 refinement ? 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 CYS N N N N 58 CYS CA C N R 59 CYS C C N N 60 CYS O O N N 61 CYS CB C N N 62 CYS SG S N N 63 CYS OXT O N N 64 CYS H H N N 65 CYS H2 H N N 66 CYS HA H N N 67 CYS HB2 H N N 68 CYS HB3 H N N 69 CYS HG H N N 70 CYS HXT H N N 71 GLN N N N N 72 GLN CA C N S 73 GLN C C N N 74 GLN O O N N 75 GLN CB C N N 76 GLN CG C N N 77 GLN CD C N N 78 GLN OE1 O N N 79 GLN NE2 N N N 80 GLN OXT O N N 81 GLN H H N N 82 GLN H2 H N N 83 GLN HA H N N 84 GLN HB2 H N N 85 GLN HB3 H N N 86 GLN HG2 H N N 87 GLN HG3 H N N 88 GLN HE21 H N N 89 GLN HE22 H N N 90 GLN HXT H N N 91 GLU N N N N 92 GLU CA C N S 93 GLU C C N N 94 GLU O O N N 95 GLU CB C N N 96 GLU CG C N N 97 GLU CD C N N 98 GLU OE1 O N N 99 GLU OE2 O N N 100 GLU OXT O N N 101 GLU H H N N 102 GLU H2 H N N 103 GLU HA H N N 104 GLU HB2 H N N 105 GLU HB3 H N N 106 GLU HG2 H N N 107 GLU HG3 H N N 108 GLU HE2 H N N 109 GLU HXT H N N 110 GLY N N N N 111 GLY CA C N N 112 GLY C C N N 113 GLY O O N N 114 GLY OXT O N N 115 GLY H H N N 116 GLY H2 H N N 117 GLY HA2 H N N 118 GLY HA3 H N N 119 GLY HXT H N N 120 ILE N N N N 121 ILE CA C N S 122 ILE C C N N 123 ILE O O N N 124 ILE CB C N S 125 ILE CG1 C N N 126 ILE CG2 C N N 127 ILE CD1 C N N 128 ILE OXT O N N 129 ILE H H N N 130 ILE H2 H N N 131 ILE HA H N N 132 ILE HB H N N 133 ILE HG12 H N N 134 ILE HG13 H N N 135 ILE HG21 H N N 136 ILE HG22 H N N 137 ILE HG23 H N N 138 ILE HD11 H N N 139 ILE HD12 H N N 140 ILE HD13 H N N 141 ILE HXT H N N 142 LEU N N N N 143 LEU CA C N S 144 LEU C C N N 145 LEU O O N N 146 LEU CB C N N 147 LEU CG C N N 148 LEU CD1 C N N 149 LEU CD2 C N N 150 LEU OXT O N N 151 LEU H H N N 152 LEU H2 H N N 153 LEU HA H N N 154 LEU HB2 H N N 155 LEU HB3 H N N 156 LEU HG H N N 157 LEU HD11 H N N 158 LEU HD12 H N N 159 LEU HD13 H N N 160 LEU HD21 H N N 161 LEU HD22 H N N 162 LEU HD23 H N N 163 LEU HXT H N N 164 LYS N N N N 165 LYS CA C N S 166 LYS C C N N 167 LYS O O N N 168 LYS CB C N N 169 LYS CG C N N 170 LYS CD C N N 171 LYS CE C N N 172 LYS NZ N N N 173 LYS OXT O N N 174 LYS H H N N 175 LYS H2 H N N 176 LYS HA H N N 177 LYS HB2 H N N 178 LYS HB3 H N N 179 LYS HG2 H N N 180 LYS HG3 H N N 181 LYS HD2 H N N 182 LYS HD3 H N N 183 LYS HE2 H N N 184 LYS HE3 H N N 185 LYS HZ1 H N N 186 LYS HZ2 H N N 187 LYS HZ3 H N N 188 LYS HXT H N N 189 MET N N N N 190 MET CA C N S 191 MET C C N N 192 MET O O N N 193 MET CB C N N 194 MET CG C N N 195 MET SD S N N 196 MET CE C N N 197 MET OXT O N N 198 MET H H N N 199 MET H2 H N N 200 MET HA H N N 201 MET HB2 H N N 202 MET HB3 H N N 203 MET HG2 H N N 204 MET HG3 H N N 205 MET HE1 H N N 206 MET HE2 H N N 207 MET HE3 H N N 208 MET HXT H N N 209 PHE N N N N 210 PHE CA C N S 211 PHE C C N N 212 PHE O O N N 213 PHE CB C N N 214 PHE CG C Y N 215 PHE CD1 C Y N 216 PHE CD2 C Y N 217 PHE CE1 C Y N 218 PHE CE2 C Y N 219 PHE CZ C Y N 220 PHE OXT O N N 221 PHE H H N N 222 PHE H2 H N N 223 PHE HA H N N 224 PHE HB2 H N N 225 PHE HB3 H N N 226 PHE HD1 H N N 227 PHE HD2 H N N 228 PHE HE1 H N N 229 PHE HE2 H N N 230 PHE HZ H N N 231 PHE HXT H N N 232 PRO N N N N 233 PRO CA C N S 234 PRO C C N N 235 PRO O O N N 236 PRO CB C N N 237 PRO CG C N N 238 PRO CD C N N 239 PRO OXT O N N 240 PRO H H N N 241 PRO HA H N N 242 PRO HB2 H N N 243 PRO HB3 H N N 244 PRO HG2 H N N 245 PRO HG3 H N N 246 PRO HD2 H N N 247 PRO HD3 H N N 248 PRO HXT H N N 249 SER N N N N 250 SER CA C N S 251 SER C C N N 252 SER O O N N 253 SER CB C N N 254 SER OG O N N 255 SER OXT O N N 256 SER H H N N 257 SER H2 H N N 258 SER HA H N N 259 SER HB2 H N N 260 SER HB3 H N N 261 SER HG H N N 262 SER HXT H N N 263 THR N N N N 264 THR CA C N S 265 THR C C N N 266 THR O O N N 267 THR CB C N R 268 THR OG1 O N N 269 THR CG2 C N N 270 THR OXT O N N 271 THR H H N N 272 THR H2 H N N 273 THR HA H N N 274 THR HB H N N 275 THR HG1 H N N 276 THR HG21 H N N 277 THR HG22 H N N 278 THR HG23 H N N 279 THR HXT H N N 280 TYR N N N N 281 TYR CA C N S 282 TYR C C N N 283 TYR O O N N 284 TYR CB C N N 285 TYR CG C Y N 286 TYR CD1 C Y N 287 TYR CD2 C Y N 288 TYR CE1 C Y N 289 TYR CE2 C Y N 290 TYR CZ C Y N 291 TYR OH O N N 292 TYR OXT O N N 293 TYR H H N N 294 TYR H2 H N N 295 TYR HA H N N 296 TYR HB2 H N N 297 TYR HB3 H N N 298 TYR HD1 H N N 299 TYR HD2 H N N 300 TYR HE1 H N N 301 TYR HE2 H N N 302 TYR HH H N N 303 TYR HXT H N N 304 VAL N N N N 305 VAL CA C N S 306 VAL C C N N 307 VAL O O N N 308 VAL CB C N N 309 VAL CG1 C N N 310 VAL CG2 C N N 311 VAL OXT O N N 312 VAL H H N N 313 VAL H2 H N N 314 VAL HA H N N 315 VAL HB H N N 316 VAL HG11 H N N 317 VAL HG12 H N N 318 VAL HG13 H N N 319 VAL HG21 H N N 320 VAL HG22 H N N 321 VAL HG23 H N N 322 VAL HXT H N N 323 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 CYS N CA sing N N 55 CYS N H sing N N 56 CYS N H2 sing N N 57 CYS CA C sing N N 58 CYS CA CB sing N N 59 CYS CA HA sing N N 60 CYS C O doub N N 61 CYS C OXT sing N N 62 CYS CB SG sing N N 63 CYS CB HB2 sing N N 64 CYS CB HB3 sing N N 65 CYS SG HG sing N N 66 CYS OXT HXT sing N N 67 GLN N CA sing N N 68 GLN N H sing N N 69 GLN N H2 sing N N 70 GLN CA C sing N N 71 GLN CA CB sing N N 72 GLN CA HA sing N N 73 GLN C O doub N N 74 GLN C OXT sing N N 75 GLN CB CG sing N N 76 GLN CB HB2 sing N N 77 GLN CB HB3 sing N N 78 GLN CG CD sing N N 79 GLN CG HG2 sing N N 80 GLN CG HG3 sing N N 81 GLN CD OE1 doub N N 82 GLN CD NE2 sing N N 83 GLN NE2 HE21 sing N N 84 GLN NE2 HE22 sing N N 85 GLN OXT HXT sing N N 86 GLU N CA sing N N 87 GLU N H sing N N 88 GLU N H2 sing N N 89 GLU CA C sing N N 90 GLU CA CB sing N N 91 GLU CA HA sing N N 92 GLU C O doub N N 93 GLU C OXT sing N N 94 GLU CB CG sing N N 95 GLU CB HB2 sing N N 96 GLU CB HB3 sing N N 97 GLU CG CD sing N N 98 GLU CG HG2 sing N N 99 GLU CG HG3 sing N N 100 GLU CD OE1 doub N N 101 GLU CD OE2 sing N N 102 GLU OE2 HE2 sing N N 103 GLU OXT HXT sing N N 104 GLY N CA sing N N 105 GLY N H sing N N 106 GLY N H2 sing N N 107 GLY CA C sing N N 108 GLY CA HA2 sing N N 109 GLY CA HA3 sing N N 110 GLY C O doub N N 111 GLY C OXT sing N N 112 GLY OXT HXT sing N N 113 ILE N CA sing N N 114 ILE N H sing N N 115 ILE N H2 sing N N 116 ILE CA C sing N N 117 ILE CA CB sing N N 118 ILE CA HA sing N N 119 ILE C O doub N N 120 ILE C OXT sing N N 121 ILE CB CG1 sing N N 122 ILE CB CG2 sing N N 123 ILE CB HB sing N N 124 ILE CG1 CD1 sing N N 125 ILE CG1 HG12 sing N N 126 ILE CG1 HG13 sing N N 127 ILE CG2 HG21 sing N N 128 ILE CG2 HG22 sing N N 129 ILE CG2 HG23 sing N N 130 ILE CD1 HD11 sing N N 131 ILE CD1 HD12 sing N N 132 ILE CD1 HD13 sing N N 133 ILE OXT HXT sing N N 134 LEU N CA sing N N 135 LEU N H sing N N 136 LEU N H2 sing N N 137 LEU CA C sing N N 138 LEU CA CB sing N N 139 LEU CA HA sing N N 140 LEU C O doub N N 141 LEU C OXT sing N N 142 LEU CB CG sing N N 143 LEU CB HB2 sing N N 144 LEU CB HB3 sing N N 145 LEU CG CD1 sing N N 146 LEU CG CD2 sing N N 147 LEU CG HG sing N N 148 LEU CD1 HD11 sing N N 149 LEU CD1 HD12 sing N N 150 LEU CD1 HD13 sing N N 151 LEU CD2 HD21 sing N N 152 LEU CD2 HD22 sing N N 153 LEU CD2 HD23 sing N N 154 LEU OXT HXT sing N N 155 LYS N CA sing N N 156 LYS N H sing N N 157 LYS N H2 sing N N 158 LYS CA C sing N N 159 LYS CA CB sing N N 160 LYS CA HA sing N N 161 LYS C O doub N N 162 LYS C OXT sing N N 163 LYS CB CG sing N N 164 LYS CB HB2 sing N N 165 LYS CB HB3 sing N N 166 LYS CG CD sing N N 167 LYS CG HG2 sing N N 168 LYS CG HG3 sing N N 169 LYS CD CE sing N N 170 LYS CD HD2 sing N N 171 LYS CD HD3 sing N N 172 LYS CE NZ sing N N 173 LYS CE HE2 sing N N 174 LYS CE HE3 sing N N 175 LYS NZ HZ1 sing N N 176 LYS NZ HZ2 sing N N 177 LYS NZ HZ3 sing N N 178 LYS OXT HXT sing N N 179 MET N CA sing N N 180 MET N H sing N N 181 MET N H2 sing N N 182 MET CA C sing N N 183 MET CA CB sing N N 184 MET CA HA sing N N 185 MET C O doub N N 186 MET C OXT sing N N 187 MET CB CG sing N N 188 MET CB HB2 sing N N 189 MET CB HB3 sing N N 190 MET CG SD sing N N 191 MET CG HG2 sing N N 192 MET CG HG3 sing N N 193 MET SD CE sing N N 194 MET CE HE1 sing N N 195 MET CE HE2 sing N N 196 MET CE HE3 sing N N 197 MET OXT HXT sing N N 198 PHE N CA sing N N 199 PHE N H sing N N 200 PHE N H2 sing N N 201 PHE CA C sing N N 202 PHE CA CB sing N N 203 PHE CA HA sing N N 204 PHE C O doub N N 205 PHE C OXT sing N N 206 PHE CB CG sing N N 207 PHE CB HB2 sing N N 208 PHE CB HB3 sing N N 209 PHE CG CD1 doub Y N 210 PHE CG CD2 sing Y N 211 PHE CD1 CE1 sing Y N 212 PHE CD1 HD1 sing N N 213 PHE CD2 CE2 doub Y N 214 PHE CD2 HD2 sing N N 215 PHE CE1 CZ doub Y N 216 PHE CE1 HE1 sing N N 217 PHE CE2 CZ sing Y N 218 PHE CE2 HE2 sing N N 219 PHE CZ HZ sing N N 220 PHE OXT HXT sing N N 221 PRO N CA sing N N 222 PRO N CD sing N N 223 PRO N H sing N N 224 PRO CA C sing N N 225 PRO CA CB sing N N 226 PRO CA HA sing N N 227 PRO C O doub N N 228 PRO C OXT sing N N 229 PRO CB CG sing N N 230 PRO CB HB2 sing N N 231 PRO CB HB3 sing N N 232 PRO CG CD sing N N 233 PRO CG HG2 sing N N 234 PRO CG HG3 sing N N 235 PRO CD HD2 sing N N 236 PRO CD HD3 sing N N 237 PRO OXT HXT sing N N 238 SER N CA sing N N 239 SER N H sing N N 240 SER N H2 sing N N 241 SER CA C sing N N 242 SER CA CB sing N N 243 SER CA HA sing N N 244 SER C O doub N N 245 SER C OXT sing N N 246 SER CB OG sing N N 247 SER CB HB2 sing N N 248 SER CB HB3 sing N N 249 SER OG HG sing N N 250 SER OXT HXT sing N N 251 THR N CA sing N N 252 THR N H sing N N 253 THR N H2 sing N N 254 THR CA C sing N N 255 THR CA CB sing N N 256 THR CA HA sing N N 257 THR C O doub N N 258 THR C OXT sing N N 259 THR CB OG1 sing N N 260 THR CB CG2 sing N N 261 THR CB HB sing N N 262 THR OG1 HG1 sing N N 263 THR CG2 HG21 sing N N 264 THR CG2 HG22 sing N N 265 THR CG2 HG23 sing N N 266 THR OXT HXT sing N N 267 TYR N CA sing N N 268 TYR N H sing N N 269 TYR N H2 sing N N 270 TYR CA C sing N N 271 TYR CA CB sing N N 272 TYR CA HA sing N N 273 TYR C O doub N N 274 TYR C OXT sing N N 275 TYR CB CG sing N N 276 TYR CB HB2 sing N N 277 TYR CB HB3 sing N N 278 TYR CG CD1 doub Y N 279 TYR CG CD2 sing Y N 280 TYR CD1 CE1 sing Y N 281 TYR CD1 HD1 sing N N 282 TYR CD2 CE2 doub Y N 283 TYR CD2 HD2 sing N N 284 TYR CE1 CZ doub Y N 285 TYR CE1 HE1 sing N N 286 TYR CE2 CZ sing Y N 287 TYR CE2 HE2 sing N N 288 TYR CZ OH sing N N 289 TYR OH HH sing N N 290 TYR OXT HXT sing N N 291 VAL N CA sing N N 292 VAL N H sing N N 293 VAL N H2 sing N N 294 VAL CA C sing N N 295 VAL CA CB sing N N 296 VAL CA HA sing N N 297 VAL C O doub N N 298 VAL C OXT sing N N 299 VAL CB CG1 sing N N 300 VAL CB CG2 sing N N 301 VAL CB HB sing N N 302 VAL CG1 HG11 sing N N 303 VAL CG1 HG12 sing N N 304 VAL CG1 HG13 sing N N 305 VAL CG2 HG21 sing N N 306 VAL CG2 HG22 sing N N 307 VAL CG2 HG23 sing N N 308 VAL OXT HXT sing N N 309 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker AVANCE 800 2 ? Bruker AVANCE 900 3 ? Bruker AVANCE 600 # _atom_sites.entry_id 1Y3K _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_