data_1Y6U # _entry.id 1Y6U # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1Y6U pdb_00001y6u 10.2210/pdb1y6u/pdb RCSB RCSB031189 ? ? WWPDB D_1000031189 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-03-15 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1Y6U _pdbx_database_status.recvd_initial_deposition_date 2004-12-07 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Abbani, M.' 1 'Iwahara, M.' 2 'Clubb, R.T.' 3 # _citation.id primary _citation.title ;The structure of the excisionase (xis) protein from conjugative transposon tn916 provides insights into the regulation of heterobivalent tyrosine recombinases ; _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 347 _citation.page_first 11 _citation.page_last 25 _citation.year 2005 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15733914 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2005.01.019 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Abbani, M.' 1 ? primary 'Iwahara, M.' 2 ? primary 'Clubb, R.T.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Excisionase from transposon Tn916' _entity.formula_weight 8389.670 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name xis # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code AGHMKQTDIPIWERYTLTIEEASKYFRIGENKLRRLAEENKNANWLIMNGNRIQIKRKQFEKIIDTLDAI _entity_poly.pdbx_seq_one_letter_code_can AGHMKQTDIPIWERYTLTIEEASKYFRIGENKLRRLAEENKNANWLIMNGNRIQIKRKQFEKIIDTLDAI _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLY n 1 3 HIS n 1 4 MET n 1 5 LYS n 1 6 GLN n 1 7 THR n 1 8 ASP n 1 9 ILE n 1 10 PRO n 1 11 ILE n 1 12 TRP n 1 13 GLU n 1 14 ARG n 1 15 TYR n 1 16 THR n 1 17 LEU n 1 18 THR n 1 19 ILE n 1 20 GLU n 1 21 GLU n 1 22 ALA n 1 23 SER n 1 24 LYS n 1 25 TYR n 1 26 PHE n 1 27 ARG n 1 28 ILE n 1 29 GLY n 1 30 GLU n 1 31 ASN n 1 32 LYS n 1 33 LEU n 1 34 ARG n 1 35 ARG n 1 36 LEU n 1 37 ALA n 1 38 GLU n 1 39 GLU n 1 40 ASN n 1 41 LYS n 1 42 ASN n 1 43 ALA n 1 44 ASN n 1 45 TRP n 1 46 LEU n 1 47 ILE n 1 48 MET n 1 49 ASN n 1 50 GLY n 1 51 ASN n 1 52 ARG n 1 53 ILE n 1 54 GLN n 1 55 ILE n 1 56 LYS n 1 57 ARG n 1 58 LYS n 1 59 GLN n 1 60 PHE n 1 61 GLU n 1 62 LYS n 1 63 ILE n 1 64 ILE n 1 65 ASP n 1 66 THR n 1 67 LEU n 1 68 ASP n 1 69 ALA n 1 70 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Enterococcus _entity_src_gen.pdbx_gene_src_gene xis _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Enterococcus faecalis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1351 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'RJ3386 (BL21-DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pTYB12 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 -2 ? ? ? A . n A 1 2 GLY 2 -1 ? ? ? A . n A 1 3 HIS 3 0 ? ? ? A . n A 1 4 MET 4 1 ? ? ? A . n A 1 5 LYS 5 2 ? ? ? A . n A 1 6 GLN 6 3 ? ? ? A . n A 1 7 THR 7 4 ? ? ? A . n A 1 8 ASP 8 5 ? ? ? A . n A 1 9 ILE 9 6 6 ILE ILE A . n A 1 10 PRO 10 7 7 PRO PRO A . n A 1 11 ILE 11 8 8 ILE ILE A . n A 1 12 TRP 12 9 9 TRP TRP A . n A 1 13 GLU 13 10 10 GLU GLU A . n A 1 14 ARG 14 11 11 ARG ARG A . n A 1 15 TYR 15 12 12 TYR TYR A . n A 1 16 THR 16 13 13 THR THR A . n A 1 17 LEU 17 14 14 LEU LEU A . n A 1 18 THR 18 15 15 THR THR A . n A 1 19 ILE 19 16 16 ILE ILE A . n A 1 20 GLU 20 17 17 GLU GLU A . n A 1 21 GLU 21 18 18 GLU GLU A . n A 1 22 ALA 22 19 19 ALA ALA A . n A 1 23 SER 23 20 20 SER SER A . n A 1 24 LYS 24 21 21 LYS LYS A . n A 1 25 TYR 25 22 22 TYR TYR A . n A 1 26 PHE 26 23 23 PHE PHE A . n A 1 27 ARG 27 24 24 ARG ARG A . n A 1 28 ILE 28 25 25 ILE ILE A . n A 1 29 GLY 29 26 26 GLY GLY A . n A 1 30 GLU 30 27 27 GLU GLU A . n A 1 31 ASN 31 28 28 ASN ASN A . n A 1 32 LYS 32 29 29 LYS LYS A . n A 1 33 LEU 33 30 30 LEU LEU A . n A 1 34 ARG 34 31 31 ARG ARG A . n A 1 35 ARG 35 32 32 ARG ARG A . n A 1 36 LEU 36 33 33 LEU LEU A . n A 1 37 ALA 37 34 34 ALA ALA A . n A 1 38 GLU 38 35 35 GLU GLU A . n A 1 39 GLU 39 36 36 GLU GLU A . n A 1 40 ASN 40 37 37 ASN ASN A . n A 1 41 LYS 41 38 38 LYS LYS A . n A 1 42 ASN 42 39 39 ASN ASN A . n A 1 43 ALA 43 40 40 ALA ALA A . n A 1 44 ASN 44 41 41 ASN ASN A . n A 1 45 TRP 45 42 42 TRP TRP A . n A 1 46 LEU 46 43 43 LEU LEU A . n A 1 47 ILE 47 44 44 ILE ILE A . n A 1 48 MET 48 45 45 MET MET A . n A 1 49 ASN 49 46 46 ASN ASN A . n A 1 50 GLY 50 47 47 GLY GLY A . n A 1 51 ASN 51 48 48 ASN ASN A . n A 1 52 ARG 52 49 49 ARG ARG A . n A 1 53 ILE 53 50 50 ILE ILE A . n A 1 54 GLN 54 51 51 GLN GLN A . n A 1 55 ILE 55 52 52 ILE ILE A . n A 1 56 LYS 56 53 53 LYS LYS A . n A 1 57 ARG 57 54 54 ARG ARG A . n A 1 58 LYS 58 55 55 LYS LYS A . n A 1 59 GLN 59 56 56 GLN GLN A . n A 1 60 PHE 60 57 57 PHE PHE A . n A 1 61 GLU 61 58 58 GLU GLU A . n A 1 62 LYS 62 59 59 LYS LYS A . n A 1 63 ILE 63 60 60 ILE ILE A . n A 1 64 ILE 64 61 61 ILE ILE A . n A 1 65 ASP 65 62 62 ASP ASP A . n A 1 66 THR 66 63 63 THR THR A . n A 1 67 LEU 67 64 64 LEU LEU A . n A 1 68 ASP 68 65 ? ? ? A . n A 1 69 ALA 69 66 ? ? ? A . n A 1 70 ILE 70 67 ? ? ? A . n # _cell.entry_id 1Y6U _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1Y6U _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1Y6U _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1Y6U _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1Y6U _struct.title ;The Structure of the Excisionase (Xis) Protein from Conjugative Transposon Tn916 Provides Insights into the Regulation of Heterobivalent Tyrosine Recombinases ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1Y6U _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'DNA architectural protein, Tyrosine recombinase, Excisionase, Winged-helix protein, Conjugative transposon, DNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q79DA1_ENTFA _struct_ref.pdbx_db_accession Q79DA1 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MKQTDIPIWERYTLTIEEASKYFRIGENKLRRLAEENKNANWLIMNGNRIQIKRKQFEKIIDTLDAI _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1Y6U _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 70 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q79DA1 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 67 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 67 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1Y6U ALA A 1 ? UNP Q79DA1 ? ? 'cloning artifact' -2 1 1 1Y6U GLY A 2 ? UNP Q79DA1 ? ? 'cloning artifact' -1 2 1 1Y6U HIS A 3 ? UNP Q79DA1 ? ? 'cloning artifact' 0 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ILE A 19 ? PHE A 26 ? ILE A 16 PHE A 23 1 ? 8 HELX_P HELX_P2 2 GLY A 29 ? ASN A 40 ? GLY A 26 ASN A 37 1 ? 12 HELX_P HELX_P3 3 ARG A 57 ? ILE A 63 ? ARG A 54 ILE A 60 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 16 ? THR A 18 ? THR A 13 THR A 15 A 2 ARG A 52 ? LYS A 56 ? ARG A 49 LYS A 53 A 3 LEU A 46 ? ASN A 49 ? LEU A 43 ASN A 46 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 17 ? N LEU A 14 O ILE A 55 ? O ILE A 52 A 2 3 O ARG A 52 ? O ARG A 49 N ASN A 49 ? N ASN A 46 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A LEU 14 ? ? H A ILE 52 ? ? 1.38 2 1 H A LEU 14 ? ? O A ILE 52 ? ? 1.55 3 1 O A LEU 33 ? ? H A ASN 37 ? ? 1.56 4 1 O A ASN 37 ? ? H A ALA 40 ? ? 1.60 5 2 O A LEU 14 ? ? H A ILE 52 ? ? 1.40 6 2 O A ILE 8 ? ? HH11 A ARG 11 ? ? 1.47 7 2 O A ASN 37 ? ? H A ALA 40 ? ? 1.52 8 2 H A LEU 14 ? ? O A ILE 52 ? ? 1.58 9 3 O A LEU 14 ? ? H A ILE 52 ? ? 1.46 10 4 O A LEU 14 ? ? H A ILE 52 ? ? 1.42 11 4 O A ASN 37 ? ? H A ALA 40 ? ? 1.49 12 5 O A LEU 14 ? ? H A ILE 52 ? ? 1.44 13 5 O A PRO 7 ? ? H A GLU 10 ? ? 1.57 14 6 O A LEU 14 ? ? H A ILE 52 ? ? 1.38 15 6 H A LEU 14 ? ? O A ILE 52 ? ? 1.51 16 6 O A ASN 37 ? ? H A ALA 40 ? ? 1.54 17 7 O A LEU 14 ? ? H A ILE 52 ? ? 1.43 18 7 O A PRO 7 ? ? H A GLU 10 ? ? 1.50 19 7 O A ASN 37 ? ? H A ALA 40 ? ? 1.57 20 8 O A LEU 14 ? ? H A ILE 52 ? ? 1.42 21 8 O A PRO 7 ? ? H A GLU 10 ? ? 1.56 22 9 O A LEU 14 ? ? H A ILE 52 ? ? 1.47 23 9 O A PRO 7 ? ? H A GLU 10 ? ? 1.48 24 9 H A LEU 14 ? ? O A ILE 52 ? ? 1.48 25 9 O A THR 15 ? ? H A ALA 19 ? ? 1.51 26 9 O A ASN 37 ? ? H A ALA 40 ? ? 1.53 27 10 O A LEU 14 ? ? H A ILE 52 ? ? 1.44 28 10 O A ILE 8 ? ? HH11 A ARG 11 ? ? 1.48 29 10 O A ASN 37 ? ? H A ALA 40 ? ? 1.58 30 11 HD21 A ASN 28 ? ? H A LYS 29 ? ? 1.32 31 11 O A LEU 14 ? ? H A ILE 52 ? ? 1.44 32 11 O A ASN 37 ? ? H A ALA 40 ? ? 1.55 33 12 O A PRO 7 ? ? H A GLU 10 ? ? 1.45 34 12 O A LEU 14 ? ? H A ILE 52 ? ? 1.47 35 12 H A LEU 14 ? ? O A ILE 52 ? ? 1.52 36 12 O A ASN 37 ? ? H A ALA 40 ? ? 1.58 37 13 O A LEU 14 ? ? H A ILE 52 ? ? 1.43 38 13 O A PRO 7 ? ? H A GLU 10 ? ? 1.49 39 13 O A GLU 35 ? ? HZ1 A LYS 38 ? ? 1.53 40 13 O A ASN 37 ? ? H A ALA 40 ? ? 1.54 41 14 O A LEU 14 ? ? H A ILE 52 ? ? 1.38 42 14 H A LEU 14 ? ? O A ILE 52 ? ? 1.49 43 14 O A ASN 37 ? ? H A ALA 40 ? ? 1.51 44 15 O A LEU 14 ? ? H A ILE 52 ? ? 1.41 45 15 O A ILE 8 ? ? HH11 A ARG 11 ? ? 1.45 46 15 O A ASN 37 ? ? H A ALA 40 ? ? 1.55 47 15 H A LEU 14 ? ? O A ILE 52 ? ? 1.55 48 16 H A LEU 14 ? ? O A ILE 52 ? ? 1.44 49 16 O A LEU 14 ? ? H A ILE 52 ? ? 1.48 50 16 O A ASN 37 ? ? H A ALA 40 ? ? 1.55 51 17 O A LEU 14 ? ? H A ILE 52 ? ? 1.43 52 17 O A ASN 37 ? ? H A ALA 40 ? ? 1.58 53 18 HH21 A ARG 11 ? ? HE21 A GLN 51 ? ? 1.26 54 18 O A LEU 14 ? ? H A ILE 52 ? ? 1.44 55 18 H A LEU 14 ? ? O A ILE 52 ? ? 1.50 56 18 O A ASN 37 ? ? H A ALA 40 ? ? 1.57 57 19 O A LEU 14 ? ? H A ILE 52 ? ? 1.41 58 19 O A ASN 37 ? ? H A ALA 40 ? ? 1.56 59 20 O A LEU 14 ? ? H A ILE 52 ? ? 1.39 60 20 O A ASN 37 ? ? H A ALA 40 ? ? 1.54 61 20 O A PRO 7 ? ? H A GLU 10 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 24 ? ? -42.75 85.73 2 1 ASN A 37 ? ? -103.13 60.22 3 1 ASN A 48 ? ? -151.76 -29.07 4 1 GLU A 58 ? ? -39.89 -30.23 5 1 ILE A 60 ? ? -95.94 30.72 6 2 ARG A 24 ? ? -42.55 86.03 7 2 ASN A 37 ? ? -99.54 50.65 8 2 ASN A 48 ? ? -152.08 -31.88 9 3 PRO A 7 ? ? -46.81 109.84 10 3 ILE A 8 ? ? -29.02 -41.31 11 3 ARG A 24 ? ? -45.88 83.06 12 3 ASN A 37 ? ? -100.77 64.96 13 3 ASN A 48 ? ? -149.97 -14.92 14 3 ILE A 60 ? ? -96.36 33.39 15 4 ARG A 24 ? ? -42.19 87.67 16 4 LYS A 38 ? ? -46.28 -19.28 17 4 ASN A 46 ? ? -153.32 76.74 18 5 ILE A 8 ? ? -36.00 -25.00 19 5 ARG A 24 ? ? -45.62 86.02 20 5 ASN A 46 ? ? -150.18 75.35 21 5 GLU A 58 ? ? -39.32 -31.54 22 6 ARG A 24 ? ? -52.63 78.69 23 6 ASN A 37 ? ? -99.49 48.38 24 6 ASN A 48 ? ? -149.99 11.12 25 6 LYS A 55 ? ? -92.09 -66.00 26 7 ILE A 8 ? ? -37.58 -22.88 27 7 ARG A 24 ? ? -53.01 83.01 28 7 ASN A 37 ? ? -115.94 61.34 29 7 LYS A 38 ? ? -45.86 -16.27 30 7 ASN A 46 ? ? -106.47 77.91 31 7 ASN A 48 ? ? -149.96 -13.81 32 7 GLN A 56 ? ? -54.81 -70.93 33 8 ARG A 24 ? ? -48.75 87.28 34 8 ASN A 48 ? ? -150.87 9.79 35 8 LYS A 55 ? ? -91.86 -65.66 36 9 ARG A 24 ? ? -40.05 86.75 37 9 ASN A 37 ? ? -98.39 50.37 38 9 ASN A 46 ? ? -110.86 75.48 39 9 ASN A 48 ? ? -149.50 12.67 40 10 ILE A 8 ? ? -48.40 -12.68 41 10 ARG A 24 ? ? -41.62 86.81 42 10 ASN A 48 ? ? -148.87 -8.97 43 11 ILE A 8 ? ? -37.60 -39.46 44 11 ARG A 24 ? ? -41.28 85.84 45 11 GLU A 35 ? ? -47.71 -15.11 46 11 LYS A 38 ? ? -48.02 -14.70 47 11 ASN A 48 ? ? -150.19 -24.73 48 12 ILE A 8 ? ? -37.86 -30.58 49 12 ARG A 24 ? ? -49.77 87.75 50 12 ASN A 37 ? ? -103.88 66.31 51 12 LYS A 38 ? ? -46.48 -19.49 52 12 ASN A 48 ? ? -149.07 -4.73 53 12 LYS A 55 ? ? -93.47 -66.28 54 12 PHE A 57 ? ? -95.27 -60.88 55 12 ILE A 60 ? ? -97.55 33.12 56 13 ARG A 24 ? ? -42.65 86.73 57 13 LYS A 38 ? ? -47.75 -16.38 58 13 ASN A 48 ? ? -150.81 10.63 59 13 GLN A 56 ? ? -55.49 -73.99 60 14 ARG A 24 ? ? -52.27 81.79 61 14 ASN A 37 ? ? -97.68 44.77 62 14 LYS A 38 ? ? -46.45 -14.33 63 14 ASN A 48 ? ? -147.42 -2.24 64 14 GLU A 58 ? ? -37.89 -32.66 65 15 GLU A 10 ? ? -113.38 70.75 66 15 ARG A 24 ? ? -44.18 83.52 67 15 LYS A 38 ? ? -47.33 -13.80 68 15 ILE A 60 ? ? -98.77 33.68 69 16 THR A 15 ? ? -79.95 -166.04 70 16 ARG A 24 ? ? -41.26 87.58 71 16 ASN A 37 ? ? -106.14 60.89 72 16 LYS A 38 ? ? -45.30 -18.17 73 16 ASN A 48 ? ? -148.11 -9.68 74 17 ARG A 24 ? ? -42.71 87.25 75 17 LYS A 38 ? ? -46.77 -16.78 76 17 GLN A 56 ? ? -58.32 -72.27 77 17 ILE A 60 ? ? -94.97 34.54 78 18 THR A 15 ? ? -79.14 -165.55 79 18 ARG A 24 ? ? -41.26 86.44 80 18 ASN A 37 ? ? -102.87 62.54 81 18 LYS A 38 ? ? -46.46 -16.56 82 19 GLU A 10 ? ? -104.58 63.66 83 19 ARG A 24 ? ? -51.57 82.09 84 19 GLU A 35 ? ? -44.60 -18.78 85 19 ASN A 37 ? ? -106.29 61.36 86 19 ASN A 48 ? ? -152.67 -25.79 87 19 ILE A 60 ? ? -93.34 33.33 88 20 ARG A 24 ? ? -43.77 88.64 89 20 GLU A 35 ? ? -48.13 -15.70 90 20 LYS A 38 ? ? -46.64 -15.67 91 20 ASN A 46 ? ? -105.94 75.46 # _pdbx_nmr_ensemble.entry_id 1Y6U _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1Y6U _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM 15N/13C labeled Xis, 30 mM NaOAc, 60 mM NaCl, 93% H2O, 7% D2O' _pdbx_nmr_sample_details.solvent_system '30 mM NaOAc, pH 4.5, 60 mM NaCl, 93% H2O, 7% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure Ambient _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '60 mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY 3 1 1 4D_13C/15N-separated_NOESY 4 1 1 HNCA-J 5 1 1 HNHA # _pdbx_nmr_refine.entry_id 1Y6U _pdbx_nmr_refine.method 'Hybrid distance geometry and simulated annealing calculations' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 collection ? 1 X-PLOR 3.1 processing ? 2 NMRPipe sgi6x processing ? 3 PIPP 4.3.5 'data analysis' ? 4 XPLOR-NIH ? refinement ? 5 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA -2 ? A ALA 1 2 1 Y 1 A GLY -1 ? A GLY 2 3 1 Y 1 A HIS 0 ? A HIS 3 4 1 Y 1 A MET 1 ? A MET 4 5 1 Y 1 A LYS 2 ? A LYS 5 6 1 Y 1 A GLN 3 ? A GLN 6 7 1 Y 1 A THR 4 ? A THR 7 8 1 Y 1 A ASP 5 ? A ASP 8 9 1 Y 1 A ASP 65 ? A ASP 68 10 1 Y 1 A ALA 66 ? A ALA 69 11 1 Y 1 A ILE 67 ? A ILE 70 12 2 Y 1 A ALA -2 ? A ALA 1 13 2 Y 1 A GLY -1 ? A GLY 2 14 2 Y 1 A HIS 0 ? A HIS 3 15 2 Y 1 A MET 1 ? A MET 4 16 2 Y 1 A LYS 2 ? A LYS 5 17 2 Y 1 A GLN 3 ? A GLN 6 18 2 Y 1 A THR 4 ? A THR 7 19 2 Y 1 A ASP 5 ? A ASP 8 20 2 Y 1 A ASP 65 ? A ASP 68 21 2 Y 1 A ALA 66 ? A ALA 69 22 2 Y 1 A ILE 67 ? A ILE 70 23 3 Y 1 A ALA -2 ? A ALA 1 24 3 Y 1 A GLY -1 ? A GLY 2 25 3 Y 1 A HIS 0 ? A HIS 3 26 3 Y 1 A MET 1 ? A MET 4 27 3 Y 1 A LYS 2 ? A LYS 5 28 3 Y 1 A GLN 3 ? A GLN 6 29 3 Y 1 A THR 4 ? A THR 7 30 3 Y 1 A ASP 5 ? A ASP 8 31 3 Y 1 A ASP 65 ? A ASP 68 32 3 Y 1 A ALA 66 ? A ALA 69 33 3 Y 1 A ILE 67 ? A ILE 70 34 4 Y 1 A ALA -2 ? A ALA 1 35 4 Y 1 A GLY -1 ? A GLY 2 36 4 Y 1 A HIS 0 ? A HIS 3 37 4 Y 1 A MET 1 ? A MET 4 38 4 Y 1 A LYS 2 ? A LYS 5 39 4 Y 1 A GLN 3 ? A GLN 6 40 4 Y 1 A THR 4 ? A THR 7 41 4 Y 1 A ASP 5 ? A ASP 8 42 4 Y 1 A ASP 65 ? A ASP 68 43 4 Y 1 A ALA 66 ? A ALA 69 44 4 Y 1 A ILE 67 ? A ILE 70 45 5 Y 1 A ALA -2 ? A ALA 1 46 5 Y 1 A GLY -1 ? A GLY 2 47 5 Y 1 A HIS 0 ? A HIS 3 48 5 Y 1 A MET 1 ? A MET 4 49 5 Y 1 A LYS 2 ? A LYS 5 50 5 Y 1 A GLN 3 ? A GLN 6 51 5 Y 1 A THR 4 ? A THR 7 52 5 Y 1 A ASP 5 ? A ASP 8 53 5 Y 1 A ASP 65 ? A ASP 68 54 5 Y 1 A ALA 66 ? A ALA 69 55 5 Y 1 A ILE 67 ? A ILE 70 56 6 Y 1 A ALA -2 ? A ALA 1 57 6 Y 1 A GLY -1 ? A GLY 2 58 6 Y 1 A HIS 0 ? A HIS 3 59 6 Y 1 A MET 1 ? A MET 4 60 6 Y 1 A LYS 2 ? A LYS 5 61 6 Y 1 A GLN 3 ? A GLN 6 62 6 Y 1 A THR 4 ? A THR 7 63 6 Y 1 A ASP 5 ? A ASP 8 64 6 Y 1 A ASP 65 ? A ASP 68 65 6 Y 1 A ALA 66 ? A ALA 69 66 6 Y 1 A ILE 67 ? A ILE 70 67 7 Y 1 A ALA -2 ? A ALA 1 68 7 Y 1 A GLY -1 ? A GLY 2 69 7 Y 1 A HIS 0 ? A HIS 3 70 7 Y 1 A MET 1 ? A MET 4 71 7 Y 1 A LYS 2 ? A LYS 5 72 7 Y 1 A GLN 3 ? A GLN 6 73 7 Y 1 A THR 4 ? A THR 7 74 7 Y 1 A ASP 5 ? A ASP 8 75 7 Y 1 A ASP 65 ? A ASP 68 76 7 Y 1 A ALA 66 ? A ALA 69 77 7 Y 1 A ILE 67 ? A ILE 70 78 8 Y 1 A ALA -2 ? A ALA 1 79 8 Y 1 A GLY -1 ? A GLY 2 80 8 Y 1 A HIS 0 ? A HIS 3 81 8 Y 1 A MET 1 ? A MET 4 82 8 Y 1 A LYS 2 ? A LYS 5 83 8 Y 1 A GLN 3 ? A GLN 6 84 8 Y 1 A THR 4 ? A THR 7 85 8 Y 1 A ASP 5 ? A ASP 8 86 8 Y 1 A ASP 65 ? A ASP 68 87 8 Y 1 A ALA 66 ? A ALA 69 88 8 Y 1 A ILE 67 ? A ILE 70 89 9 Y 1 A ALA -2 ? A ALA 1 90 9 Y 1 A GLY -1 ? A GLY 2 91 9 Y 1 A HIS 0 ? A HIS 3 92 9 Y 1 A MET 1 ? A MET 4 93 9 Y 1 A LYS 2 ? A LYS 5 94 9 Y 1 A GLN 3 ? A GLN 6 95 9 Y 1 A THR 4 ? A THR 7 96 9 Y 1 A ASP 5 ? A ASP 8 97 9 Y 1 A ASP 65 ? A ASP 68 98 9 Y 1 A ALA 66 ? A ALA 69 99 9 Y 1 A ILE 67 ? A ILE 70 100 10 Y 1 A ALA -2 ? A ALA 1 101 10 Y 1 A GLY -1 ? A GLY 2 102 10 Y 1 A HIS 0 ? A HIS 3 103 10 Y 1 A MET 1 ? A MET 4 104 10 Y 1 A LYS 2 ? A LYS 5 105 10 Y 1 A GLN 3 ? A GLN 6 106 10 Y 1 A THR 4 ? A THR 7 107 10 Y 1 A ASP 5 ? A ASP 8 108 10 Y 1 A ASP 65 ? A ASP 68 109 10 Y 1 A ALA 66 ? A ALA 69 110 10 Y 1 A ILE 67 ? A ILE 70 111 11 Y 1 A ALA -2 ? A ALA 1 112 11 Y 1 A GLY -1 ? A GLY 2 113 11 Y 1 A HIS 0 ? A HIS 3 114 11 Y 1 A MET 1 ? A MET 4 115 11 Y 1 A LYS 2 ? A LYS 5 116 11 Y 1 A GLN 3 ? A GLN 6 117 11 Y 1 A THR 4 ? A THR 7 118 11 Y 1 A ASP 5 ? A ASP 8 119 11 Y 1 A ASP 65 ? A ASP 68 120 11 Y 1 A ALA 66 ? A ALA 69 121 11 Y 1 A ILE 67 ? A ILE 70 122 12 Y 1 A ALA -2 ? A ALA 1 123 12 Y 1 A GLY -1 ? A GLY 2 124 12 Y 1 A HIS 0 ? A HIS 3 125 12 Y 1 A MET 1 ? A MET 4 126 12 Y 1 A LYS 2 ? A LYS 5 127 12 Y 1 A GLN 3 ? A GLN 6 128 12 Y 1 A THR 4 ? A THR 7 129 12 Y 1 A ASP 5 ? A ASP 8 130 12 Y 1 A ASP 65 ? A ASP 68 131 12 Y 1 A ALA 66 ? A ALA 69 132 12 Y 1 A ILE 67 ? A ILE 70 133 13 Y 1 A ALA -2 ? A ALA 1 134 13 Y 1 A GLY -1 ? A GLY 2 135 13 Y 1 A HIS 0 ? A HIS 3 136 13 Y 1 A MET 1 ? A MET 4 137 13 Y 1 A LYS 2 ? A LYS 5 138 13 Y 1 A GLN 3 ? A GLN 6 139 13 Y 1 A THR 4 ? A THR 7 140 13 Y 1 A ASP 5 ? A ASP 8 141 13 Y 1 A ASP 65 ? A ASP 68 142 13 Y 1 A ALA 66 ? A ALA 69 143 13 Y 1 A ILE 67 ? A ILE 70 144 14 Y 1 A ALA -2 ? A ALA 1 145 14 Y 1 A GLY -1 ? A GLY 2 146 14 Y 1 A HIS 0 ? A HIS 3 147 14 Y 1 A MET 1 ? A MET 4 148 14 Y 1 A LYS 2 ? A LYS 5 149 14 Y 1 A GLN 3 ? A GLN 6 150 14 Y 1 A THR 4 ? A THR 7 151 14 Y 1 A ASP 5 ? A ASP 8 152 14 Y 1 A ASP 65 ? A ASP 68 153 14 Y 1 A ALA 66 ? A ALA 69 154 14 Y 1 A ILE 67 ? A ILE 70 155 15 Y 1 A ALA -2 ? A ALA 1 156 15 Y 1 A GLY -1 ? A GLY 2 157 15 Y 1 A HIS 0 ? A HIS 3 158 15 Y 1 A MET 1 ? A MET 4 159 15 Y 1 A LYS 2 ? A LYS 5 160 15 Y 1 A GLN 3 ? A GLN 6 161 15 Y 1 A THR 4 ? A THR 7 162 15 Y 1 A ASP 5 ? A ASP 8 163 15 Y 1 A ASP 65 ? A ASP 68 164 15 Y 1 A ALA 66 ? A ALA 69 165 15 Y 1 A ILE 67 ? A ILE 70 166 16 Y 1 A ALA -2 ? A ALA 1 167 16 Y 1 A GLY -1 ? A GLY 2 168 16 Y 1 A HIS 0 ? A HIS 3 169 16 Y 1 A MET 1 ? A MET 4 170 16 Y 1 A LYS 2 ? A LYS 5 171 16 Y 1 A GLN 3 ? A GLN 6 172 16 Y 1 A THR 4 ? A THR 7 173 16 Y 1 A ASP 5 ? A ASP 8 174 16 Y 1 A ASP 65 ? A ASP 68 175 16 Y 1 A ALA 66 ? A ALA 69 176 16 Y 1 A ILE 67 ? A ILE 70 177 17 Y 1 A ALA -2 ? A ALA 1 178 17 Y 1 A GLY -1 ? A GLY 2 179 17 Y 1 A HIS 0 ? A HIS 3 180 17 Y 1 A MET 1 ? A MET 4 181 17 Y 1 A LYS 2 ? A LYS 5 182 17 Y 1 A GLN 3 ? A GLN 6 183 17 Y 1 A THR 4 ? A THR 7 184 17 Y 1 A ASP 5 ? A ASP 8 185 17 Y 1 A ASP 65 ? A ASP 68 186 17 Y 1 A ALA 66 ? A ALA 69 187 17 Y 1 A ILE 67 ? A ILE 70 188 18 Y 1 A ALA -2 ? A ALA 1 189 18 Y 1 A GLY -1 ? A GLY 2 190 18 Y 1 A HIS 0 ? A HIS 3 191 18 Y 1 A MET 1 ? A MET 4 192 18 Y 1 A LYS 2 ? A LYS 5 193 18 Y 1 A GLN 3 ? A GLN 6 194 18 Y 1 A THR 4 ? A THR 7 195 18 Y 1 A ASP 5 ? A ASP 8 196 18 Y 1 A ASP 65 ? A ASP 68 197 18 Y 1 A ALA 66 ? A ALA 69 198 18 Y 1 A ILE 67 ? A ILE 70 199 19 Y 1 A ALA -2 ? A ALA 1 200 19 Y 1 A GLY -1 ? A GLY 2 201 19 Y 1 A HIS 0 ? A HIS 3 202 19 Y 1 A MET 1 ? A MET 4 203 19 Y 1 A LYS 2 ? A LYS 5 204 19 Y 1 A GLN 3 ? A GLN 6 205 19 Y 1 A THR 4 ? A THR 7 206 19 Y 1 A ASP 5 ? A ASP 8 207 19 Y 1 A ASP 65 ? A ASP 68 208 19 Y 1 A ALA 66 ? A ALA 69 209 19 Y 1 A ILE 67 ? A ILE 70 210 20 Y 1 A ALA -2 ? A ALA 1 211 20 Y 1 A GLY -1 ? A GLY 2 212 20 Y 1 A HIS 0 ? A HIS 3 213 20 Y 1 A MET 1 ? A MET 4 214 20 Y 1 A LYS 2 ? A LYS 5 215 20 Y 1 A GLN 3 ? A GLN 6 216 20 Y 1 A THR 4 ? A THR 7 217 20 Y 1 A ASP 5 ? A ASP 8 218 20 Y 1 A ASP 65 ? A ASP 68 219 20 Y 1 A ALA 66 ? A ALA 69 220 20 Y 1 A ILE 67 ? A ILE 70 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DRX 600 2 ? Bruker DRX 500 # _atom_sites.entry_id 1Y6U _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_