data_1YD7 # _entry.id 1YD7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1YD7 pdb_00001yd7 10.2210/pdb1yd7/pdb RCSB RCSB031397 ? ? WWPDB D_1000031397 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-02-08 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-11 5 'Structure model' 1 4 2024-03-06 6 'Structure model' 1 5 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Refinement description' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Derived calculations' 7 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' software 2 5 'Structure model' chem_comp_atom 3 5 'Structure model' chem_comp_bond 4 5 'Structure model' database_2 5 5 'Structure model' pdbx_database_related 6 5 'Structure model' struct_conn 7 5 'Structure model' struct_ref_seq_dif 8 5 'Structure model' struct_site 9 6 'Structure model' pdbx_entry_details 10 6 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_software.classification' 2 4 'Structure model' '_software.contact_author' 3 4 'Structure model' '_software.contact_author_email' 4 4 'Structure model' '_software.date' 5 4 'Structure model' '_software.language' 6 4 'Structure model' '_software.location' 7 4 'Structure model' '_software.name' 8 4 'Structure model' '_software.type' 9 4 'Structure model' '_software.version' 10 5 'Structure model' '_database_2.pdbx_DOI' 11 5 'Structure model' '_database_2.pdbx_database_accession' 12 5 'Structure model' '_pdbx_database_related.db_name' 13 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 14 5 'Structure model' '_struct_ref_seq_dif.details' 15 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 16 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 17 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.entry_id 1YD7 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2004-12-23 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id Pfu-1647980-001 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Horanyi, P.' 1 'Florence, Q.' 2 'Zhou, W.' 3 'Chang, J.' 4 'Zhao, M.' 5 'Habel, J.' 6 'Xu, H.' 7 'Chen, L.' 8 'Lee, D.' 9 'Nguyen, D.' 10 'Chang, S.-H.' 11 'Tempel, W.' 12 'Lin, D.' 13 'Zhang, H.' 14 'Praissman, J.' 15 'Jenney Jr., F.E.' 16 'Adams, M.W.W.' 17 'Liu, Z.-J.' 18 'Rose, J.P.' 19 'Wang, B.-C.' 20 'Southeast Collaboratory for Structural Genomics (SECSG)' 21 # _citation.id primary _citation.title 'Conserved hypothetical protein Pfu-1647980-001 from Pyrococcus furiosus' _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Horanyi, P.' 1 ? primary 'Florence, Q.' 2 ? primary 'Zhou, W.' 3 ? primary 'Chang, J.' 4 ? primary 'Zhao, M.' 5 ? primary 'Habel, J.' 6 ? primary 'Xu, H.' 7 ? primary 'Chen, L.' 8 ? primary 'Lee, D.' 9 ? primary 'Nguyen, D.' 10 ? primary 'Chang, S.-H.' 11 ? primary 'Tempel, W.' 12 ? primary 'Lin, D.' 13 ? primary 'Zhang, H.' 14 ? primary 'Praissman, J.' 15 ? primary 'Jenney Jr., F.E.' 16 ? primary 'Adams, M.W.W.' 17 ? primary 'Liu, Z.-J.' 18 ? primary 'Rose, J.P.' 19 ? primary 'Wang, B.-C.' 20 ? primary 'Southeast Collaboratory for Structural Genomics (SECSG)' 21 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '2-keto acid:ferredoxin oxidoreductase subunit alpha' 44659.164 1 ? ? ? ? 2 non-polymer syn 'UNKNOWN ATOM OR ION' ? 6 ? ? ? ? 3 water nat water 18.015 25 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;AHHHHHHGSNKRFPFPVGEPDFIQGDEAIARAAILAGCRFYAGYPITPASEIFEA(MSE)ALY(MSE)PLVDGVVIQ (MSE)EDEIASIAAAIGASWAGAKA(MSE)TATSGPGFSL(MSE)QENIGYAV(MSE)TETPVVIVDVQRSGPSTGQPTL PAQGDI(MSE)QAIWGTHGDHSLIVLSPSTVQEAFDFTIRAFNLSEKYRTPVILLTDAEVGH(MSE)RERVYIPNPDEIE IINRKLPRNEEEAKLPFGDPHGDGVPP(MSE)PIFGKGYRTYVTGLTHDEKGRPRTVDREVHERLIKRIVEKIEKNKKDI FTYETYELEDAEIGVVATGIVARSALRAVK(MSE)LREEGIKAGLLKIETIWPFDFELIERIAERVDKLYVPE(MSE)NL GQLYHLIKEGANGKAEVKLISKIGGEVHTP(MSE)EIFEFIRREFK ; _entity_poly.pdbx_seq_one_letter_code_can ;AHHHHHHGSNKRFPFPVGEPDFIQGDEAIARAAILAGCRFYAGYPITPASEIFEAMALYMPLVDGVVIQMEDEIASIAAA IGASWAGAKAMTATSGPGFSLMQENIGYAVMTETPVVIVDVQRSGPSTGQPTLPAQGDIMQAIWGTHGDHSLIVLSPSTV QEAFDFTIRAFNLSEKYRTPVILLTDAEVGHMRERVYIPNPDEIEIINRKLPRNEEEAKLPFGDPHGDGVPPMPIFGKGY RTYVTGLTHDEKGRPRTVDREVHERLIKRIVEKIEKNKKDIFTYETYELEDAEIGVVATGIVARSALRAVKMLREEGIKA GLLKIETIWPFDFELIERIAERVDKLYVPEMNLGQLYHLIKEGANGKAEVKLISKIGGEVHTPMEIFEFIRREFK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier Pfu-1647980-001 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'UNKNOWN ATOM OR ION' UNX 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 GLY n 1 9 SER n 1 10 ASN n 1 11 LYS n 1 12 ARG n 1 13 PHE n 1 14 PRO n 1 15 PHE n 1 16 PRO n 1 17 VAL n 1 18 GLY n 1 19 GLU n 1 20 PRO n 1 21 ASP n 1 22 PHE n 1 23 ILE n 1 24 GLN n 1 25 GLY n 1 26 ASP n 1 27 GLU n 1 28 ALA n 1 29 ILE n 1 30 ALA n 1 31 ARG n 1 32 ALA n 1 33 ALA n 1 34 ILE n 1 35 LEU n 1 36 ALA n 1 37 GLY n 1 38 CYS n 1 39 ARG n 1 40 PHE n 1 41 TYR n 1 42 ALA n 1 43 GLY n 1 44 TYR n 1 45 PRO n 1 46 ILE n 1 47 THR n 1 48 PRO n 1 49 ALA n 1 50 SER n 1 51 GLU n 1 52 ILE n 1 53 PHE n 1 54 GLU n 1 55 ALA n 1 56 MSE n 1 57 ALA n 1 58 LEU n 1 59 TYR n 1 60 MSE n 1 61 PRO n 1 62 LEU n 1 63 VAL n 1 64 ASP n 1 65 GLY n 1 66 VAL n 1 67 VAL n 1 68 ILE n 1 69 GLN n 1 70 MSE n 1 71 GLU n 1 72 ASP n 1 73 GLU n 1 74 ILE n 1 75 ALA n 1 76 SER n 1 77 ILE n 1 78 ALA n 1 79 ALA n 1 80 ALA n 1 81 ILE n 1 82 GLY n 1 83 ALA n 1 84 SER n 1 85 TRP n 1 86 ALA n 1 87 GLY n 1 88 ALA n 1 89 LYS n 1 90 ALA n 1 91 MSE n 1 92 THR n 1 93 ALA n 1 94 THR n 1 95 SER n 1 96 GLY n 1 97 PRO n 1 98 GLY n 1 99 PHE n 1 100 SER n 1 101 LEU n 1 102 MSE n 1 103 GLN n 1 104 GLU n 1 105 ASN n 1 106 ILE n 1 107 GLY n 1 108 TYR n 1 109 ALA n 1 110 VAL n 1 111 MSE n 1 112 THR n 1 113 GLU n 1 114 THR n 1 115 PRO n 1 116 VAL n 1 117 VAL n 1 118 ILE n 1 119 VAL n 1 120 ASP n 1 121 VAL n 1 122 GLN n 1 123 ARG n 1 124 SER n 1 125 GLY n 1 126 PRO n 1 127 SER n 1 128 THR n 1 129 GLY n 1 130 GLN n 1 131 PRO n 1 132 THR n 1 133 LEU n 1 134 PRO n 1 135 ALA n 1 136 GLN n 1 137 GLY n 1 138 ASP n 1 139 ILE n 1 140 MSE n 1 141 GLN n 1 142 ALA n 1 143 ILE n 1 144 TRP n 1 145 GLY n 1 146 THR n 1 147 HIS n 1 148 GLY n 1 149 ASP n 1 150 HIS n 1 151 SER n 1 152 LEU n 1 153 ILE n 1 154 VAL n 1 155 LEU n 1 156 SER n 1 157 PRO n 1 158 SER n 1 159 THR n 1 160 VAL n 1 161 GLN n 1 162 GLU n 1 163 ALA n 1 164 PHE n 1 165 ASP n 1 166 PHE n 1 167 THR n 1 168 ILE n 1 169 ARG n 1 170 ALA n 1 171 PHE n 1 172 ASN n 1 173 LEU n 1 174 SER n 1 175 GLU n 1 176 LYS n 1 177 TYR n 1 178 ARG n 1 179 THR n 1 180 PRO n 1 181 VAL n 1 182 ILE n 1 183 LEU n 1 184 LEU n 1 185 THR n 1 186 ASP n 1 187 ALA n 1 188 GLU n 1 189 VAL n 1 190 GLY n 1 191 HIS n 1 192 MSE n 1 193 ARG n 1 194 GLU n 1 195 ARG n 1 196 VAL n 1 197 TYR n 1 198 ILE n 1 199 PRO n 1 200 ASN n 1 201 PRO n 1 202 ASP n 1 203 GLU n 1 204 ILE n 1 205 GLU n 1 206 ILE n 1 207 ILE n 1 208 ASN n 1 209 ARG n 1 210 LYS n 1 211 LEU n 1 212 PRO n 1 213 ARG n 1 214 ASN n 1 215 GLU n 1 216 GLU n 1 217 GLU n 1 218 ALA n 1 219 LYS n 1 220 LEU n 1 221 PRO n 1 222 PHE n 1 223 GLY n 1 224 ASP n 1 225 PRO n 1 226 HIS n 1 227 GLY n 1 228 ASP n 1 229 GLY n 1 230 VAL n 1 231 PRO n 1 232 PRO n 1 233 MSE n 1 234 PRO n 1 235 ILE n 1 236 PHE n 1 237 GLY n 1 238 LYS n 1 239 GLY n 1 240 TYR n 1 241 ARG n 1 242 THR n 1 243 TYR n 1 244 VAL n 1 245 THR n 1 246 GLY n 1 247 LEU n 1 248 THR n 1 249 HIS n 1 250 ASP n 1 251 GLU n 1 252 LYS n 1 253 GLY n 1 254 ARG n 1 255 PRO n 1 256 ARG n 1 257 THR n 1 258 VAL n 1 259 ASP n 1 260 ARG n 1 261 GLU n 1 262 VAL n 1 263 HIS n 1 264 GLU n 1 265 ARG n 1 266 LEU n 1 267 ILE n 1 268 LYS n 1 269 ARG n 1 270 ILE n 1 271 VAL n 1 272 GLU n 1 273 LYS n 1 274 ILE n 1 275 GLU n 1 276 LYS n 1 277 ASN n 1 278 LYS n 1 279 LYS n 1 280 ASP n 1 281 ILE n 1 282 PHE n 1 283 THR n 1 284 TYR n 1 285 GLU n 1 286 THR n 1 287 TYR n 1 288 GLU n 1 289 LEU n 1 290 GLU n 1 291 ASP n 1 292 ALA n 1 293 GLU n 1 294 ILE n 1 295 GLY n 1 296 VAL n 1 297 VAL n 1 298 ALA n 1 299 THR n 1 300 GLY n 1 301 ILE n 1 302 VAL n 1 303 ALA n 1 304 ARG n 1 305 SER n 1 306 ALA n 1 307 LEU n 1 308 ARG n 1 309 ALA n 1 310 VAL n 1 311 LYS n 1 312 MSE n 1 313 LEU n 1 314 ARG n 1 315 GLU n 1 316 GLU n 1 317 GLY n 1 318 ILE n 1 319 LYS n 1 320 ALA n 1 321 GLY n 1 322 LEU n 1 323 LEU n 1 324 LYS n 1 325 ILE n 1 326 GLU n 1 327 THR n 1 328 ILE n 1 329 TRP n 1 330 PRO n 1 331 PHE n 1 332 ASP n 1 333 PHE n 1 334 GLU n 1 335 LEU n 1 336 ILE n 1 337 GLU n 1 338 ARG n 1 339 ILE n 1 340 ALA n 1 341 GLU n 1 342 ARG n 1 343 VAL n 1 344 ASP n 1 345 LYS n 1 346 LEU n 1 347 TYR n 1 348 VAL n 1 349 PRO n 1 350 GLU n 1 351 MSE n 1 352 ASN n 1 353 LEU n 1 354 GLY n 1 355 GLN n 1 356 LEU n 1 357 TYR n 1 358 HIS n 1 359 LEU n 1 360 ILE n 1 361 LYS n 1 362 GLU n 1 363 GLY n 1 364 ALA n 1 365 ASN n 1 366 GLY n 1 367 LYS n 1 368 ALA n 1 369 GLU n 1 370 VAL n 1 371 LYS n 1 372 LEU n 1 373 ILE n 1 374 SER n 1 375 LYS n 1 376 ILE n 1 377 GLY n 1 378 GLY n 1 379 GLU n 1 380 VAL n 1 381 HIS n 1 382 THR n 1 383 PRO n 1 384 MSE n 1 385 GLU n 1 386 ILE n 1 387 PHE n 1 388 GLU n 1 389 PHE n 1 390 ILE n 1 391 ARG n 1 392 ARG n 1 393 GLU n 1 394 PHE n 1 395 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Pyrococcus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pyrococcus furiosus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2261 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 UNX non-polymer . 'UNKNOWN ATOM OR ION' ? ? ? VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 -7 ? ? ? A . n A 1 2 HIS 2 -6 ? ? ? A . n A 1 3 HIS 3 -5 ? ? ? A . n A 1 4 HIS 4 -4 ? ? ? A . n A 1 5 HIS 5 -3 ? ? ? A . n A 1 6 HIS 6 -2 ? ? ? A . n A 1 7 HIS 7 -1 ? ? ? A . n A 1 8 GLY 8 0 ? ? ? A . n A 1 9 SER 9 1 ? ? ? A . n A 1 10 ASN 10 2 ? ? ? A . n A 1 11 LYS 11 3 ? ? ? A . n A 1 12 ARG 12 4 4 ARG ARG A . n A 1 13 PHE 13 5 5 PHE PHE A . n A 1 14 PRO 14 6 6 PRO PRO A . n A 1 15 PHE 15 7 7 PHE PHE A . n A 1 16 PRO 16 8 8 PRO PRO A . n A 1 17 VAL 17 9 9 VAL VAL A . n A 1 18 GLY 18 10 10 GLY GLY A . n A 1 19 GLU 19 11 11 GLU GLU A . n A 1 20 PRO 20 12 12 PRO PRO A . n A 1 21 ASP 21 13 13 ASP ASP A . n A 1 22 PHE 22 14 14 PHE PHE A . n A 1 23 ILE 23 15 15 ILE ILE A . n A 1 24 GLN 24 16 16 GLN GLN A . n A 1 25 GLY 25 17 17 GLY GLY A . n A 1 26 ASP 26 18 18 ASP ASP A . n A 1 27 GLU 27 19 19 GLU GLU A . n A 1 28 ALA 28 20 20 ALA ALA A . n A 1 29 ILE 29 21 21 ILE ILE A . n A 1 30 ALA 30 22 22 ALA ALA A . n A 1 31 ARG 31 23 23 ARG ARG A . n A 1 32 ALA 32 24 24 ALA ALA A . n A 1 33 ALA 33 25 25 ALA ALA A . n A 1 34 ILE 34 26 26 ILE ILE A . n A 1 35 LEU 35 27 27 LEU LEU A . n A 1 36 ALA 36 28 28 ALA ALA A . n A 1 37 GLY 37 29 29 GLY GLY A . n A 1 38 CYS 38 30 30 CYS CYS A . n A 1 39 ARG 39 31 31 ARG ARG A . n A 1 40 PHE 40 32 32 PHE PHE A . n A 1 41 TYR 41 33 33 TYR TYR A . n A 1 42 ALA 42 34 34 ALA ALA A . n A 1 43 GLY 43 35 35 GLY GLY A . n A 1 44 TYR 44 36 36 TYR TYR A . n A 1 45 PRO 45 37 37 PRO PRO A . n A 1 46 ILE 46 38 38 ILE ILE A . n A 1 47 THR 47 39 39 THR THR A . n A 1 48 PRO 48 40 40 PRO PRO A . n A 1 49 ALA 49 41 41 ALA ALA A . n A 1 50 SER 50 42 42 SER SER A . n A 1 51 GLU 51 43 43 GLU GLU A . n A 1 52 ILE 52 44 44 ILE ILE A . n A 1 53 PHE 53 45 45 PHE PHE A . n A 1 54 GLU 54 46 46 GLU GLU A . n A 1 55 ALA 55 47 47 ALA ALA A . n A 1 56 MSE 56 48 48 MSE MSE A . n A 1 57 ALA 57 49 49 ALA ALA A . n A 1 58 LEU 58 50 50 LEU LEU A . n A 1 59 TYR 59 51 51 TYR TYR A . n A 1 60 MSE 60 52 52 MSE MSE A . n A 1 61 PRO 61 53 53 PRO PRO A . n A 1 62 LEU 62 54 54 LEU LEU A . n A 1 63 VAL 63 55 55 VAL VAL A . n A 1 64 ASP 64 56 56 ASP ASP A . n A 1 65 GLY 65 57 57 GLY GLY A . n A 1 66 VAL 66 58 58 VAL VAL A . n A 1 67 VAL 67 59 59 VAL VAL A . n A 1 68 ILE 68 60 60 ILE ILE A . n A 1 69 GLN 69 61 61 GLN GLN A . n A 1 70 MSE 70 62 62 MSE MSE A . n A 1 71 GLU 71 63 63 GLU GLU A . n A 1 72 ASP 72 64 64 ASP ASP A . n A 1 73 GLU 73 65 65 GLU GLU A . n A 1 74 ILE 74 66 66 ILE ILE A . n A 1 75 ALA 75 67 67 ALA ALA A . n A 1 76 SER 76 68 68 SER SER A . n A 1 77 ILE 77 69 69 ILE ILE A . n A 1 78 ALA 78 70 70 ALA ALA A . n A 1 79 ALA 79 71 71 ALA ALA A . n A 1 80 ALA 80 72 72 ALA ALA A . n A 1 81 ILE 81 73 73 ILE ILE A . n A 1 82 GLY 82 74 74 GLY GLY A . n A 1 83 ALA 83 75 75 ALA ALA A . n A 1 84 SER 84 76 76 SER SER A . n A 1 85 TRP 85 77 77 TRP TRP A . n A 1 86 ALA 86 78 78 ALA ALA A . n A 1 87 GLY 87 79 79 GLY GLY A . n A 1 88 ALA 88 80 80 ALA ALA A . n A 1 89 LYS 89 81 81 LYS LYS A . n A 1 90 ALA 90 82 82 ALA ALA A . n A 1 91 MSE 91 83 83 MSE MSE A . n A 1 92 THR 92 84 84 THR THR A . n A 1 93 ALA 93 85 85 ALA ALA A . n A 1 94 THR 94 86 86 THR THR A . n A 1 95 SER 95 87 87 SER SER A . n A 1 96 GLY 96 88 88 GLY GLY A . n A 1 97 PRO 97 89 89 PRO PRO A . n A 1 98 GLY 98 90 90 GLY GLY A . n A 1 99 PHE 99 91 91 PHE PHE A . n A 1 100 SER 100 92 92 SER SER A . n A 1 101 LEU 101 93 93 LEU LEU A . n A 1 102 MSE 102 94 94 MSE MSE A . n A 1 103 GLN 103 95 95 GLN GLN A . n A 1 104 GLU 104 96 96 GLU GLU A . n A 1 105 ASN 105 97 97 ASN ASN A . n A 1 106 ILE 106 98 98 ILE ILE A . n A 1 107 GLY 107 99 ? ? ? A . n A 1 108 TYR 108 100 ? ? ? A . n A 1 109 ALA 109 101 ? ? ? A . n A 1 110 VAL 110 102 ? ? ? A . n A 1 111 MSE 111 103 103 MSE MSE A . n A 1 112 THR 112 104 104 THR THR A . n A 1 113 GLU 113 105 105 GLU GLU A . n A 1 114 THR 114 106 106 THR THR A . n A 1 115 PRO 115 107 107 PRO PRO A . n A 1 116 VAL 116 108 108 VAL VAL A . n A 1 117 VAL 117 109 109 VAL VAL A . n A 1 118 ILE 118 110 110 ILE ILE A . n A 1 119 VAL 119 111 111 VAL VAL A . n A 1 120 ASP 120 112 112 ASP ASP A . n A 1 121 VAL 121 113 113 VAL VAL A . n A 1 122 GLN 122 114 114 GLN GLN A . n A 1 123 ARG 123 115 ? ? ? A . n A 1 124 SER 124 116 ? ? ? A . n A 1 125 GLY 125 117 ? ? ? A . n A 1 126 PRO 126 118 ? ? ? A . n A 1 127 SER 127 119 ? ? ? A . n A 1 128 THR 128 120 ? ? ? A . n A 1 129 GLY 129 121 ? ? ? A . n A 1 130 GLN 130 122 ? ? ? A . n A 1 131 PRO 131 123 ? ? ? A . n A 1 132 THR 132 124 ? ? ? A . n A 1 133 LEU 133 125 ? ? ? A . n A 1 134 PRO 134 126 ? ? ? A . n A 1 135 ALA 135 127 ? ? ? A . n A 1 136 GLN 136 128 ? ? ? A . n A 1 137 GLY 137 129 ? ? ? A . n A 1 138 ASP 138 130 ? ? ? A . n A 1 139 ILE 139 131 ? ? ? A . n A 1 140 MSE 140 132 ? ? ? A . n A 1 141 GLN 141 133 ? ? ? A . n A 1 142 ALA 142 134 ? ? ? A . n A 1 143 ILE 143 135 ? ? ? A . n A 1 144 TRP 144 136 ? ? ? A . n A 1 145 GLY 145 137 ? ? ? A . n A 1 146 THR 146 138 ? ? ? A . n A 1 147 HIS 147 139 ? ? ? A . n A 1 148 GLY 148 140 ? ? ? A . n A 1 149 ASP 149 141 141 ASP ASP A . n A 1 150 HIS 150 142 142 HIS HIS A . n A 1 151 SER 151 143 143 SER SER A . n A 1 152 LEU 152 144 144 LEU LEU A . n A 1 153 ILE 153 145 145 ILE ILE A . n A 1 154 VAL 154 146 146 VAL VAL A . n A 1 155 LEU 155 147 147 LEU LEU A . n A 1 156 SER 156 148 148 SER SER A . n A 1 157 PRO 157 149 149 PRO PRO A . n A 1 158 SER 158 150 150 SER SER A . n A 1 159 THR 159 151 151 THR THR A . n A 1 160 VAL 160 152 152 VAL VAL A . n A 1 161 GLN 161 153 153 GLN GLN A . n A 1 162 GLU 162 154 154 GLU GLU A . n A 1 163 ALA 163 155 155 ALA ALA A . n A 1 164 PHE 164 156 156 PHE PHE A . n A 1 165 ASP 165 157 157 ASP ASP A . n A 1 166 PHE 166 158 158 PHE PHE A . n A 1 167 THR 167 159 159 THR THR A . n A 1 168 ILE 168 160 160 ILE ILE A . n A 1 169 ARG 169 161 161 ARG ARG A . n A 1 170 ALA 170 162 162 ALA ALA A . n A 1 171 PHE 171 163 163 PHE PHE A . n A 1 172 ASN 172 164 164 ASN ASN A . n A 1 173 LEU 173 165 165 LEU LEU A . n A 1 174 SER 174 166 166 SER SER A . n A 1 175 GLU 175 167 167 GLU GLU A . n A 1 176 LYS 176 168 168 LYS LYS A . n A 1 177 TYR 177 169 169 TYR TYR A . n A 1 178 ARG 178 170 170 ARG ARG A . n A 1 179 THR 179 171 171 THR THR A . n A 1 180 PRO 180 172 172 PRO PRO A . n A 1 181 VAL 181 173 173 VAL VAL A . n A 1 182 ILE 182 174 174 ILE ILE A . n A 1 183 LEU 183 175 175 LEU LEU A . n A 1 184 LEU 184 176 176 LEU LEU A . n A 1 185 THR 185 177 177 THR THR A . n A 1 186 ASP 186 178 178 ASP ASP A . n A 1 187 ALA 187 179 179 ALA ALA A . n A 1 188 GLU 188 180 180 GLU GLU A . n A 1 189 VAL 189 181 181 VAL VAL A . n A 1 190 GLY 190 182 182 GLY GLY A . n A 1 191 HIS 191 183 183 HIS HIS A . n A 1 192 MSE 192 184 184 MSE MSE A . n A 1 193 ARG 193 185 185 ARG ARG A . n A 1 194 GLU 194 186 186 GLU GLU A . n A 1 195 ARG 195 187 187 ARG ARG A . n A 1 196 VAL 196 188 188 VAL VAL A . n A 1 197 TYR 197 189 189 TYR TYR A . n A 1 198 ILE 198 190 190 ILE ILE A . n A 1 199 PRO 199 191 191 PRO PRO A . n A 1 200 ASN 200 192 192 ASN ASN A . n A 1 201 PRO 201 193 193 PRO PRO A . n A 1 202 ASP 202 194 194 ASP ASP A . n A 1 203 GLU 203 195 195 GLU GLU A . n A 1 204 ILE 204 196 196 ILE ILE A . n A 1 205 GLU 205 197 197 GLU GLU A . n A 1 206 ILE 206 198 198 ILE ILE A . n A 1 207 ILE 207 199 199 ILE ILE A . n A 1 208 ASN 208 200 200 ASN ASN A . n A 1 209 ARG 209 201 201 ARG ARG A . n A 1 210 LYS 210 202 202 LYS LYS A . n A 1 211 LEU 211 203 ? ? ? A . n A 1 212 PRO 212 204 ? ? ? A . n A 1 213 ARG 213 205 ? ? ? A . n A 1 214 ASN 214 206 ? ? ? A . n A 1 215 GLU 215 207 ? ? ? A . n A 1 216 GLU 216 208 ? ? ? A . n A 1 217 GLU 217 209 ? ? ? A . n A 1 218 ALA 218 210 ? ? ? A . n A 1 219 LYS 219 211 ? ? ? A . n A 1 220 LEU 220 212 ? ? ? A . n A 1 221 PRO 221 213 ? ? ? A . n A 1 222 PHE 222 214 ? ? ? A . n A 1 223 GLY 223 215 ? ? ? A . n A 1 224 ASP 224 216 ? ? ? A . n A 1 225 PRO 225 217 ? ? ? A . n A 1 226 HIS 226 218 ? ? ? A . n A 1 227 GLY 227 219 ? ? ? A . n A 1 228 ASP 228 220 ? ? ? A . n A 1 229 GLY 229 221 ? ? ? A . n A 1 230 VAL 230 222 ? ? ? A . n A 1 231 PRO 231 223 ? ? ? A . n A 1 232 PRO 232 224 ? ? ? A . n A 1 233 MSE 233 225 ? ? ? A . n A 1 234 PRO 234 226 ? ? ? A . n A 1 235 ILE 235 227 ? ? ? A . n A 1 236 PHE 236 228 ? ? ? A . n A 1 237 GLY 237 229 ? ? ? A . n A 1 238 LYS 238 230 ? ? ? A . n A 1 239 GLY 239 231 ? ? ? A . n A 1 240 TYR 240 232 ? ? ? A . n A 1 241 ARG 241 233 ? ? ? A . n A 1 242 THR 242 234 ? ? ? A . n A 1 243 TYR 243 235 ? ? ? A . n A 1 244 VAL 244 236 ? ? ? A . n A 1 245 THR 245 237 ? ? ? A . n A 1 246 GLY 246 238 ? ? ? A . n A 1 247 LEU 247 239 ? ? ? A . n A 1 248 THR 248 240 ? ? ? A . n A 1 249 HIS 249 241 ? ? ? A . n A 1 250 ASP 250 242 ? ? ? A . n A 1 251 GLU 251 243 ? ? ? A . n A 1 252 LYS 252 244 ? ? ? A . n A 1 253 GLY 253 245 ? ? ? A . n A 1 254 ARG 254 246 ? ? ? A . n A 1 255 PRO 255 247 ? ? ? A . n A 1 256 ARG 256 248 ? ? ? A . n A 1 257 THR 257 249 ? ? ? A . n A 1 258 VAL 258 250 ? ? ? A . n A 1 259 ASP 259 251 ? ? ? A . n A 1 260 ARG 260 252 ? ? ? A . n A 1 261 GLU 261 253 ? ? ? A . n A 1 262 VAL 262 254 ? ? ? A . n A 1 263 HIS 263 255 ? ? ? A . n A 1 264 GLU 264 256 ? ? ? A . n A 1 265 ARG 265 257 ? ? ? A . n A 1 266 LEU 266 258 ? ? ? A . n A 1 267 ILE 267 259 ? ? ? A . n A 1 268 LYS 268 260 ? ? ? A . n A 1 269 ARG 269 261 ? ? ? A . n A 1 270 ILE 270 262 ? ? ? A . n A 1 271 VAL 271 263 ? ? ? A . n A 1 272 GLU 272 264 ? ? ? A . n A 1 273 LYS 273 265 ? ? ? A . n A 1 274 ILE 274 266 ? ? ? A . n A 1 275 GLU 275 267 ? ? ? A . n A 1 276 LYS 276 268 ? ? ? A . n A 1 277 ASN 277 269 ? ? ? A . n A 1 278 LYS 278 270 ? ? ? A . n A 1 279 LYS 279 271 ? ? ? A . n A 1 280 ASP 280 272 ? ? ? A . n A 1 281 ILE 281 273 ? ? ? A . n A 1 282 PHE 282 274 ? ? ? A . n A 1 283 THR 283 275 ? ? ? A . n A 1 284 TYR 284 276 ? ? ? A . n A 1 285 GLU 285 277 ? ? ? A . n A 1 286 THR 286 278 ? ? ? A . n A 1 287 TYR 287 279 ? ? ? A . n A 1 288 GLU 288 280 ? ? ? A . n A 1 289 LEU 289 281 ? ? ? A . n A 1 290 GLU 290 282 ? ? ? A . n A 1 291 ASP 291 283 ? ? ? A . n A 1 292 ALA 292 284 ? ? ? A . n A 1 293 GLU 293 285 ? ? ? A . n A 1 294 ILE 294 286 ? ? ? A . n A 1 295 GLY 295 287 ? ? ? A . n A 1 296 VAL 296 288 ? ? ? A . n A 1 297 VAL 297 289 ? ? ? A . n A 1 298 ALA 298 290 ? ? ? A . n A 1 299 THR 299 291 ? ? ? A . n A 1 300 GLY 300 292 ? ? ? A . n A 1 301 ILE 301 293 ? ? ? A . n A 1 302 VAL 302 294 ? ? ? A . n A 1 303 ALA 303 295 ? ? ? A . n A 1 304 ARG 304 296 ? ? ? A . n A 1 305 SER 305 297 ? ? ? A . n A 1 306 ALA 306 298 ? ? ? A . n A 1 307 LEU 307 299 ? ? ? A . n A 1 308 ARG 308 300 ? ? ? A . n A 1 309 ALA 309 301 ? ? ? A . n A 1 310 VAL 310 302 ? ? ? A . n A 1 311 LYS 311 303 ? ? ? A . n A 1 312 MSE 312 304 ? ? ? A . n A 1 313 LEU 313 305 ? ? ? A . n A 1 314 ARG 314 306 ? ? ? A . n A 1 315 GLU 315 307 ? ? ? A . n A 1 316 GLU 316 308 ? ? ? A . n A 1 317 GLY 317 309 ? ? ? A . n A 1 318 ILE 318 310 ? ? ? A . n A 1 319 LYS 319 311 ? ? ? A . n A 1 320 ALA 320 312 ? ? ? A . n A 1 321 GLY 321 313 ? ? ? A . n A 1 322 LEU 322 314 ? ? ? A . n A 1 323 LEU 323 315 ? ? ? A . n A 1 324 LYS 324 316 ? ? ? A . n A 1 325 ILE 325 317 ? ? ? A . n A 1 326 GLU 326 318 ? ? ? A . n A 1 327 THR 327 319 ? ? ? A . n A 1 328 ILE 328 320 ? ? ? A . n A 1 329 TRP 329 321 ? ? ? A . n A 1 330 PRO 330 322 ? ? ? A . n A 1 331 PHE 331 323 ? ? ? A . n A 1 332 ASP 332 324 ? ? ? A . n A 1 333 PHE 333 325 ? ? ? A . n A 1 334 GLU 334 326 ? ? ? A . n A 1 335 LEU 335 327 ? ? ? A . n A 1 336 ILE 336 328 ? ? ? A . n A 1 337 GLU 337 329 ? ? ? A . n A 1 338 ARG 338 330 ? ? ? A . n A 1 339 ILE 339 331 ? ? ? A . n A 1 340 ALA 340 332 ? ? ? A . n A 1 341 GLU 341 333 ? ? ? A . n A 1 342 ARG 342 334 ? ? ? A . n A 1 343 VAL 343 335 ? ? ? A . n A 1 344 ASP 344 336 ? ? ? A . n A 1 345 LYS 345 337 ? ? ? A . n A 1 346 LEU 346 338 ? ? ? A . n A 1 347 TYR 347 339 ? ? ? A . n A 1 348 VAL 348 340 ? ? ? A . n A 1 349 PRO 349 341 ? ? ? A . n A 1 350 GLU 350 342 ? ? ? A . n A 1 351 MSE 351 343 ? ? ? A . n A 1 352 ASN 352 344 ? ? ? A . n A 1 353 LEU 353 345 ? ? ? A . n A 1 354 GLY 354 346 ? ? ? A . n A 1 355 GLN 355 347 ? ? ? A . n A 1 356 LEU 356 348 ? ? ? A . n A 1 357 TYR 357 349 ? ? ? A . n A 1 358 HIS 358 350 ? ? ? A . n A 1 359 LEU 359 351 ? ? ? A . n A 1 360 ILE 360 352 ? ? ? A . n A 1 361 LYS 361 353 ? ? ? A . n A 1 362 GLU 362 354 ? ? ? A . n A 1 363 GLY 363 355 ? ? ? A . n A 1 364 ALA 364 356 ? ? ? A . n A 1 365 ASN 365 357 ? ? ? A . n A 1 366 GLY 366 358 ? ? ? A . n A 1 367 LYS 367 359 ? ? ? A . n A 1 368 ALA 368 360 ? ? ? A . n A 1 369 GLU 369 361 ? ? ? A . n A 1 370 VAL 370 362 ? ? ? A . n A 1 371 LYS 371 363 ? ? ? A . n A 1 372 LEU 372 364 ? ? ? A . n A 1 373 ILE 373 365 ? ? ? A . n A 1 374 SER 374 366 ? ? ? A . n A 1 375 LYS 375 367 ? ? ? A . n A 1 376 ILE 376 368 ? ? ? A . n A 1 377 GLY 377 369 ? ? ? A . n A 1 378 GLY 378 370 ? ? ? A . n A 1 379 GLU 379 371 ? ? ? A . n A 1 380 VAL 380 372 ? ? ? A . n A 1 381 HIS 381 373 ? ? ? A . n A 1 382 THR 382 374 ? ? ? A . n A 1 383 PRO 383 375 ? ? ? A . n A 1 384 MSE 384 376 ? ? ? A . n A 1 385 GLU 385 377 ? ? ? A . n A 1 386 ILE 386 378 ? ? ? A . n A 1 387 PHE 387 379 ? ? ? A . n A 1 388 GLU 388 380 ? ? ? A . n A 1 389 PHE 389 381 ? ? ? A . n A 1 390 ILE 390 382 ? ? ? A . n A 1 391 ARG 391 383 ? ? ? A . n A 1 392 ARG 392 384 ? ? ? A . n A 1 393 GLU 393 385 ? ? ? A . n A 1 394 PHE 394 386 ? ? ? A . n A 1 395 LYS 395 387 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 UNX 1 388 301 UNX UNX A . C 2 UNX 1 389 302 UNX UNX A . D 2 UNX 1 390 303 UNX UNX A . E 2 UNX 1 391 304 UNX UNX A . F 2 UNX 1 392 305 UNX UNX A . G 2 UNX 1 393 306 UNX UNX A . H 3 HOH 1 394 1 HOH HOH A . H 3 HOH 2 395 2 HOH HOH A . H 3 HOH 3 396 3 HOH HOH A . H 3 HOH 4 397 4 HOH HOH A . H 3 HOH 5 398 5 HOH HOH A . H 3 HOH 6 399 6 HOH HOH A . H 3 HOH 7 400 7 HOH HOH A . H 3 HOH 8 401 8 HOH HOH A . H 3 HOH 9 402 9 HOH HOH A . H 3 HOH 10 403 10 HOH HOH A . H 3 HOH 11 404 11 HOH HOH A . H 3 HOH 12 405 12 HOH HOH A . H 3 HOH 13 406 13 HOH HOH A . H 3 HOH 14 407 14 HOH HOH A . H 3 HOH 15 408 15 HOH HOH A . H 3 HOH 16 409 16 HOH HOH A . H 3 HOH 17 410 17 HOH HOH A . H 3 HOH 18 411 18 HOH HOH A . H 3 HOH 19 412 19 HOH HOH A . H 3 HOH 20 413 20 HOH HOH A . H 3 HOH 21 414 21 HOH HOH A . H 3 HOH 22 415 22 HOH HOH A . H 3 HOH 23 416 23 HOH HOH A . H 3 HOH 24 417 24 HOH HOH A . H 3 HOH 25 418 25 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 4 ? CG ? A ARG 12 CG 2 1 Y 1 A ARG 4 ? CD ? A ARG 12 CD 3 1 Y 1 A ARG 4 ? NE ? A ARG 12 NE 4 1 Y 1 A ARG 4 ? CZ ? A ARG 12 CZ 5 1 Y 1 A ARG 4 ? NH1 ? A ARG 12 NH1 6 1 Y 1 A ARG 4 ? NH2 ? A ARG 12 NH2 7 1 Y 1 A TYR 36 ? CE2 ? A TYR 44 CE2 8 1 Y 1 A TYR 36 ? CZ ? A TYR 44 CZ 9 1 Y 1 A TYR 36 ? OH ? A TYR 44 OH 10 1 Y 1 A GLU 46 ? CD ? A GLU 54 CD 11 1 Y 1 A GLU 46 ? OE1 ? A GLU 54 OE1 12 1 Y 1 A GLU 46 ? OE2 ? A GLU 54 OE2 13 1 Y 1 A GLN 95 ? CG ? A GLN 103 CG 14 1 Y 1 A GLN 95 ? CD ? A GLN 103 CD 15 1 Y 1 A GLN 95 ? OE1 ? A GLN 103 OE1 16 1 Y 1 A GLN 95 ? NE2 ? A GLN 103 NE2 17 1 Y 1 A GLN 114 ? CG ? A GLN 122 CG 18 1 Y 1 A GLN 114 ? CD ? A GLN 122 CD 19 1 Y 1 A GLN 114 ? OE1 ? A GLN 122 OE1 20 1 Y 1 A GLN 114 ? NE2 ? A GLN 122 NE2 21 1 Y 1 A ARG 170 ? NE ? A ARG 178 NE 22 1 Y 1 A ARG 170 ? CZ ? A ARG 178 CZ 23 1 Y 1 A ARG 170 ? NH1 ? A ARG 178 NH1 24 1 Y 1 A ARG 170 ? NH2 ? A ARG 178 NH2 25 1 Y 1 A LYS 202 ? CG ? A LYS 210 CG 26 1 Y 1 A LYS 202 ? CD ? A LYS 210 CD 27 1 Y 1 A LYS 202 ? CE ? A LYS 210 CE 28 1 Y 1 A LYS 202 ? NZ ? A LYS 210 NZ # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal DENZO . ? package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu 'data reduction' http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ? ? 1 SCALEPACK . ? package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu 'data scaling' http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ? ? 2 SOLVE 2.06 28-Dec-2003 program 'Tom Terwilliger' terwilliger@LANL.gov phasing http://www.solve.lanl.gov/ ? ? 3 RESOLVE 2.06 02-Jan-2004 program 'Terwilliger, T. C' terwilliger@LANL.gov phasing http://www.solve.lanl.gov/ ? ? 4 REFMAC refmac_5.2.0005 24/04/2001 program 'Murshudov, G.N.' ccp4@dl.ac.uk refinement http://www.ccp4.ac.uk/main.html Fortran ? 5 PDB_EXTRACT 1.0 02/20/2004 program H.Yang sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C/C++ ? 6 MAR345 . ? ? ? ? 'data collection' ? ? ? 7 # _cell.entry_id 1YD7 _cell.length_a 61.448 _cell.length_b 61.448 _cell.length_c 129.084 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 1YD7 _symmetry.space_group_name_H-M 'P 32 1 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 153 _symmetry.space_group_name_Hall ? # _exptl.entry_id 1YD7 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'modified microbatch' _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.9 _exptl_crystal_grow.pdbx_details '0.1M TRIS-HCl/NaOH, 0.5M ammonium sulfate, pH 8.9, modified microbatch, temperature 291K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9793 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 22-ID' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 22-ID _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9793 # _reflns.entry_id 1YD7 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 30.00 _reflns.d_resolution_high 1.90 _reflns.number_obs 17709 _reflns.number_all ? _reflns.percent_possible_obs ? _reflns.pdbx_Rmerge_I_obs 0.08 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_unique_obs _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_ordinal 1.90 1.97 19.400 0.477 ? ? ? ? ? ? ? ? ? ? 1 1.97 2.05 34.500 0.52 ? ? ? ? ? ? ? ? ? ? 2 2.05 2.14 56.500 0.442 ? ? ? ? ? ? ? ? ? ? 3 2.14 2.25 82.600 0.359 ? ? ? ? ? ? ? ? ? ? 4 2.25 2.39 97.000 0.315 ? ? ? ? ? ? ? ? ? ? 5 2.39 2.58 99.900 0.237 ? ? ? ? ? ? ? ? ? ? 6 2.58 2.84 99.800 0.153 ? ? ? ? ? ? ? ? ? ? 7 2.84 3.25 100.000 0.096 ? ? ? ? ? ? ? ? ? ? 8 3.25 4.09 100.000 0.065 ? ? ? ? ? ? ? ? ? ? 9 4.09 30.00 100.000 0.058 ? ? ? ? ? ? ? ? ? ? 10 # _refine.entry_id 1YD7 _refine.ls_number_reflns_obs 12041 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 29.89 _refine.ls_d_res_high 2.30 _refine.ls_percent_reflns_obs 99.87 _refine.ls_R_factor_obs 0.20764 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.20586 _refine.ls_R_factor_R_free 0.24274 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 630 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.941 _refine.correlation_coeff_Fo_to_Fc_free 0.906 _refine.B_iso_mean 38.163 _refine.aniso_B[1][1] 0.05 _refine.aniso_B[2][2] 0.05 _refine.aniso_B[3][3] -0.07 _refine.aniso_B[1][2] 0.02 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAS _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.212 _refine.pdbx_overall_ESU_R_Free 0.187 _refine.overall_SU_ML 0.138 _refine.overall_SU_B 5.577 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1279 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 6 _refine_hist.number_atoms_solvent 25 _refine_hist.number_atoms_total 1310 _refine_hist.d_res_high 2.30 _refine_hist.d_res_low 29.89 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.015 0.022 ? 1305 'X-RAY DIFFRACTION' ? r_bond_other_d 0.001 0.020 ? 1223 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.450 1.967 ? 1778 'X-RAY DIFFRACTION' ? r_angle_other_deg 0.889 3.000 ? 2824 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.780 5.000 ? 166 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 32.136 24.151 ? 53 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 15.344 15.000 ? 202 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 15.657 15.000 ? 7 'X-RAY DIFFRACTION' ? r_chiral_restr 0.096 0.200 ? 210 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.005 0.020 ? 1449 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.001 0.020 ? 258 'X-RAY DIFFRACTION' ? r_nbd_refined 0.200 0.200 ? 245 'X-RAY DIFFRACTION' ? r_nbd_other 0.180 0.200 ? 1188 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.174 0.200 ? 642 'X-RAY DIFFRACTION' ? r_nbtor_other 0.083 0.200 ? 758 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.148 0.200 ? 47 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.177 0.200 ? 4 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 0.220 0.200 ? 28 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.118 0.200 ? 2 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 3.043 2.000 ? 919 'X-RAY DIFFRACTION' ? r_mcbond_other 0.708 2.000 ? 338 'X-RAY DIFFRACTION' ? r_mcangle_it 4.059 3.000 ? 1370 'X-RAY DIFFRACTION' ? r_scbond_it 2.482 2.000 ? 497 'X-RAY DIFFRACTION' ? r_scangle_it 3.559 3.000 ? 408 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.300 _refine_ls_shell.d_res_low 2.359 _refine_ls_shell.number_reflns_R_work 873 _refine_ls_shell.R_factor_R_work 0.257 _refine_ls_shell.percent_reflns_obs 98.71 _refine_ls_shell.R_factor_R_free 0.292 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 47 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 1YD7 _struct.title 'Conserved hypothetical protein Pfu-1647980-001 from Pyrococcus furiosus' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.text ;Structural Genomics, Southeast Collaboratory for Structural Genomics, SECSG, Protein Structure Initiative, PSI, conserved hypothetical protein, Pyrococcus furiosus, hyperthermophile, OXIDOREDUCTASE ; _struct_keywords.entry_id 1YD7 _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8U046_PYRFU _struct_ref.pdbx_db_accession Q8U046 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NKRFPFPVGEPDFIQGDEAIARAAILAGCRFYAGYPITPASEIFEAMALYMPLVDGVVIQMEDEIASIAAAIGASWAGAK AMTATSGPGFSLMQENIGYAVMTETPVVIVDVQRSGPSTGQPTLPAQGDIMQAIWGTHGDHSLIVLSPSTVQEAFDFTIR AFNLSEKYRTPVILLTDAEVGHMRERVYIPNPDEIEIINRKLPRNEEEAKLPFGDPHGDGVPPMPIFGKGYRTYVTGLTH DEKGRPRTVDREVHERLIKRIVEKIEKNKKDIFTYETYELEDAEIGVVATGIVARSALRAVKMLREEGIKAGLLKIETIW PFDFELIERIAERVDKLYVPEMNLGQLYHLIKEGANGKAEVKLISKIGGEVHTPMEIFEFIRREFK ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1YD7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 10 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 395 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8U046 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 387 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 387 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1YD7 ALA A 1 ? UNP Q8U046 ? ? 'cloning artifact' -7 1 1 1YD7 HIS A 2 ? UNP Q8U046 ? ? 'cloning artifact' -6 2 1 1YD7 HIS A 3 ? UNP Q8U046 ? ? 'cloning artifact' -5 3 1 1YD7 HIS A 4 ? UNP Q8U046 ? ? 'cloning artifact' -4 4 1 1YD7 HIS A 5 ? UNP Q8U046 ? ? 'cloning artifact' -3 5 1 1YD7 HIS A 6 ? UNP Q8U046 ? ? 'cloning artifact' -2 6 1 1YD7 HIS A 7 ? UNP Q8U046 ? ? 'cloning artifact' -1 7 1 1YD7 GLY A 8 ? UNP Q8U046 ? ? 'cloning artifact' 0 8 1 1YD7 SER A 9 ? UNP Q8U046 ? ? 'cloning artifact' 1 9 1 1YD7 MSE A 56 ? UNP Q8U046 MET 48 'modified residue' 48 10 1 1YD7 MSE A 60 ? UNP Q8U046 MET 52 'modified residue' 52 11 1 1YD7 MSE A 70 ? UNP Q8U046 MET 62 'modified residue' 62 12 1 1YD7 MSE A 91 ? UNP Q8U046 MET 83 'modified residue' 83 13 1 1YD7 MSE A 102 ? UNP Q8U046 MET 94 'modified residue' 94 14 1 1YD7 MSE A 111 ? UNP Q8U046 MET 103 'modified residue' 103 15 1 1YD7 MSE A 140 ? UNP Q8U046 MET 132 'modified residue' 132 16 1 1YD7 MSE A 192 ? UNP Q8U046 MET 184 'modified residue' 184 17 1 1YD7 MSE A 233 ? UNP Q8U046 MET 225 'modified residue' 225 18 1 1YD7 MSE A 312 ? UNP Q8U046 MET 304 'modified residue' 304 19 1 1YD7 MSE A 351 ? UNP Q8U046 MET 343 'modified residue' 343 20 1 1YD7 MSE A 384 ? UNP Q8U046 MET 376 'modified residue' 376 21 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 25 ? GLY A 37 ? GLY A 17 GLY A 29 1 ? 13 HELX_P HELX_P2 2 GLU A 51 ? MSE A 60 ? GLU A 43 MSE A 52 1 ? 10 HELX_P HELX_P3 3 PRO A 61 ? ASP A 64 ? PRO A 53 ASP A 56 5 ? 4 HELX_P HELX_P4 4 ASP A 72 ? ALA A 86 ? ASP A 64 ALA A 78 1 ? 15 HELX_P HELX_P5 5 PRO A 97 ? GLN A 103 ? PRO A 89 GLN A 95 1 ? 7 HELX_P HELX_P6 6 THR A 159 ? ARG A 178 ? THR A 151 ARG A 170 1 ? 20 HELX_P HELX_P7 7 ASP A 186 ? MSE A 192 ? ASP A 178 MSE A 184 1 ? 7 HELX_P HELX_P8 8 ASN A 200 ? ILE A 204 ? ASN A 192 ILE A 196 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ALA 55 C ? ? ? 1_555 A MSE 56 N ? ? A ALA 47 A MSE 48 1_555 ? ? ? ? ? ? ? 1.339 ? ? covale2 covale both ? A MSE 56 C ? ? ? 1_555 A ALA 57 N ? ? A MSE 48 A ALA 49 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale3 covale both ? A TYR 59 C ? ? ? 1_555 A MSE 60 N ? ? A TYR 51 A MSE 52 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale4 covale both ? A MSE 60 C ? ? ? 1_555 A PRO 61 N ? ? A MSE 52 A PRO 53 1_555 ? ? ? ? ? ? ? 1.356 ? ? covale5 covale both ? A GLN 69 C ? ? ? 1_555 A MSE 70 N ? ? A GLN 61 A MSE 62 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale6 covale both ? A MSE 70 C ? ? ? 1_555 A GLU 71 N ? ? A MSE 62 A GLU 63 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale7 covale both ? A ALA 90 C ? ? ? 1_555 A MSE 91 N ? ? A ALA 82 A MSE 83 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale8 covale both ? A MSE 91 C ? ? ? 1_555 A THR 92 N ? ? A MSE 83 A THR 84 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale9 covale both ? A LEU 101 C ? ? ? 1_555 A MSE 102 N ? ? A LEU 93 A MSE 94 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale10 covale both ? A MSE 102 C ? ? ? 1_555 A GLN 103 N ? ? A MSE 94 A GLN 95 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale11 covale both ? A MSE 111 C ? ? ? 1_555 A THR 112 N ? ? A MSE 103 A THR 104 1_555 ? ? ? ? ? ? ? 1.342 ? ? covale12 covale both ? A HIS 191 C ? ? ? 1_555 A MSE 192 N ? ? A HIS 183 A MSE 184 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale13 covale both ? A MSE 192 C ? ? ? 1_555 A ARG 193 N ? ? A MSE 184 A ARG 185 1_555 ? ? ? ? ? ? ? 1.332 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 56 ? . . . . MSE A 48 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 60 ? . . . . MSE A 52 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE A 70 ? . . . . MSE A 62 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 4 MSE A 91 ? . . . . MSE A 83 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 5 MSE A 102 ? . . . . MSE A 94 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 6 MSE A 111 ? . . . . MSE A 103 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 7 MSE A 192 ? . . . . MSE A 184 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id THR _struct_mon_prot_cis.label_seq_id 47 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id THR _struct_mon_prot_cis.auth_seq_id 39 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 48 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 40 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 10.03 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? parallel B 2 3 ? parallel B 3 4 ? parallel B 4 5 ? parallel B 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 19 ? GLN A 24 ? GLU A 11 GLN A 16 A 2 ARG A 193 ? ILE A 198 ? ARG A 185 ILE A 190 B 1 VAL A 66 ? GLN A 69 ? VAL A 58 GLN A 61 B 2 PHE A 40 ? GLY A 43 ? PHE A 32 GLY A 35 B 3 ALA A 90 ? SER A 95 ? ALA A 82 SER A 87 B 4 VAL A 116 ? VAL A 121 ? VAL A 108 VAL A 113 B 5 PRO A 180 ? THR A 185 ? PRO A 172 THR A 177 B 6 ILE A 153 ? LEU A 155 ? ILE A 145 LEU A 147 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ASP A 21 ? N ASP A 13 O VAL A 196 ? O VAL A 188 B 1 2 O ILE A 68 ? O ILE A 60 N TYR A 41 ? N TYR A 33 B 2 3 N ALA A 42 ? N ALA A 34 O MSE A 91 ? O MSE A 83 B 3 4 N THR A 94 ? N THR A 86 O VAL A 121 ? O VAL A 113 B 4 5 N ASP A 120 ? N ASP A 112 O THR A 185 ? O THR A 177 B 5 6 O LEU A 184 ? O LEU A 176 N LEU A 155 ? N LEU A 147 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A UNX 388 ? 2 'BINDING SITE FOR RESIDUE UNX A 388' AC2 Software A UNX 389 ? 5 'BINDING SITE FOR RESIDUE UNX A 389' AC3 Software A UNX 390 ? 4 'BINDING SITE FOR RESIDUE UNX A 390' AC4 Software A UNX 391 ? 4 'BINDING SITE FOR RESIDUE UNX A 391' AC5 Software A UNX 392 ? 3 'BINDING SITE FOR RESIDUE UNX A 392' AC6 Software A UNX 393 ? 5 'BINDING SITE FOR RESIDUE UNX A 393' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 LEU A 152 ? LEU A 144 . ? 1_555 ? 2 AC1 2 VAL A 154 ? VAL A 146 . ? 1_555 ? 3 AC2 5 PHE A 22 ? PHE A 14 . ? 6_556 ? 4 AC2 5 GLU A 51 ? GLU A 43 . ? 1_555 ? 5 AC2 5 ALA A 55 ? ALA A 47 . ? 1_555 ? 6 AC2 5 ARG A 193 ? ARG A 185 . ? 6_556 ? 7 AC2 5 UNX E . ? UNX A 391 . ? 1_555 ? 8 AC3 4 GLN A 24 ? GLN A 16 . ? 1_555 ? 9 AC3 4 ASP A 26 ? ASP A 18 . ? 1_555 ? 10 AC3 4 GLU A 27 ? GLU A 19 . ? 1_555 ? 11 AC3 4 UNX E . ? UNX A 391 . ? 1_555 ? 12 AC4 4 GLU A 27 ? GLU A 19 . ? 1_555 ? 13 AC4 4 ARG A 193 ? ARG A 185 . ? 6_556 ? 14 AC4 4 UNX C . ? UNX A 389 . ? 1_555 ? 15 AC4 4 UNX D . ? UNX A 390 . ? 1_555 ? 16 AC5 3 SER A 84 ? SER A 76 . ? 1_555 ? 17 AC5 3 TRP A 85 ? TRP A 77 . ? 1_555 ? 18 AC5 3 PRO A 115 ? PRO A 107 . ? 1_555 ? 19 AC6 5 PRO A 45 ? PRO A 37 . ? 1_555 ? 20 AC6 5 ILE A 46 ? ILE A 38 . ? 1_555 ? 21 AC6 5 THR A 47 ? THR A 39 . ? 1_555 ? 22 AC6 5 SER A 50 ? SER A 42 . ? 1_555 ? 23 AC6 5 PHE A 53 ? PHE A 45 . ? 1_555 ? # _pdbx_entry_details.entry_id 1YD7 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id THR _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 104 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 72.11 _pdbx_validate_torsion.psi -52.52 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 MSE _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 103 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 THR _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 104 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 34.83 # _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Southeast Collaboratory for Structural Genomics' _pdbx_SG_project.initial_of_center SECSG _pdbx_SG_project.id 1 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 56 A MSE 48 ? MET SELENOMETHIONINE 2 A MSE 60 A MSE 52 ? MET SELENOMETHIONINE 3 A MSE 70 A MSE 62 ? MET SELENOMETHIONINE 4 A MSE 91 A MSE 83 ? MET SELENOMETHIONINE 5 A MSE 102 A MSE 94 ? MET SELENOMETHIONINE 6 A MSE 111 A MSE 103 ? MET SELENOMETHIONINE 7 A MSE 192 A MSE 184 ? MET SELENOMETHIONINE # loop_ _pdbx_phasing_MAD_shell.d_res_low _pdbx_phasing_MAD_shell.d_res_high _pdbx_phasing_MAD_shell.reflns _pdbx_phasing_MAD_shell.fom 20.000 8.81 477 0.43 8.81 5.75 733 0.48 5.75 4.55 942 0.46 4.55 3.88 1082 0.47 3.88 3.44 1222 0.43 3.44 3.12 1323 0.39 3.12 2.88 1417 0.31 2.88 2.68 1473 0.26 # _pdbx_phasing_dm.entry_id 1YD7 _pdbx_phasing_dm.fom_acentric 0.61 _pdbx_phasing_dm.fom_centric 0.66 _pdbx_phasing_dm.fom 0.62 _pdbx_phasing_dm.reflns_acentric 10141 _pdbx_phasing_dm.reflns_centric 1028 _pdbx_phasing_dm.reflns 11169 # loop_ _pdbx_phasing_dm_shell.d_res_low _pdbx_phasing_dm_shell.d_res_high _pdbx_phasing_dm_shell.fom_acentric _pdbx_phasing_dm_shell.fom_centric _pdbx_phasing_dm_shell.fom _pdbx_phasing_dm_shell.reflns_acentric _pdbx_phasing_dm_shell.reflns_centric _pdbx_phasing_dm_shell.reflns 19.946 6.9 0.93 0.81 0.93 387 109 496 6.9 4.3 0.90 0.77 0.89 1321 198 1519 4.3 3.4 0.87 0.81 0.86 1683 177 1860 3.4 3.0 0.72 0.66 0.72 1732 170 1902 3.0 2.6 0.49 0.65 0.50 3090 235 3325 2.6 2.4 0.22 0.24 0.22 1928 139 2067 # _phasing.method sad # _phasing_MAD.entry_id 1YD7 _phasing_MAD.pdbx_d_res_high 2.600 _phasing_MAD.pdbx_d_res_low 20.000 _phasing_MAD.pdbx_reflns 8669 _phasing_MAD.pdbx_fom 0.39 # _pdbx_database_remark.id 300 _pdbx_database_remark.text ;BIOMOLECULE: THIS ENTRY CONTAINS THE CRYSTALLOGRAPHIC ASYMMETRIC UNIT WHICH CONSISTS OF 1 CHAIN. THE BIOLOGICAL UNIT IS UNKNOWN. ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA -7 ? A ALA 1 2 1 Y 1 A HIS -6 ? A HIS 2 3 1 Y 1 A HIS -5 ? A HIS 3 4 1 Y 1 A HIS -4 ? A HIS 4 5 1 Y 1 A HIS -3 ? A HIS 5 6 1 Y 1 A HIS -2 ? A HIS 6 7 1 Y 1 A HIS -1 ? A HIS 7 8 1 Y 1 A GLY 0 ? A GLY 8 9 1 Y 1 A SER 1 ? A SER 9 10 1 Y 1 A ASN 2 ? A ASN 10 11 1 Y 1 A LYS 3 ? A LYS 11 12 1 Y 1 A GLY 99 ? A GLY 107 13 1 Y 1 A TYR 100 ? A TYR 108 14 1 Y 1 A ALA 101 ? A ALA 109 15 1 Y 1 A VAL 102 ? A VAL 110 16 1 Y 1 A ARG 115 ? A ARG 123 17 1 Y 1 A SER 116 ? A SER 124 18 1 Y 1 A GLY 117 ? A GLY 125 19 1 Y 1 A PRO 118 ? A PRO 126 20 1 Y 1 A SER 119 ? A SER 127 21 1 Y 1 A THR 120 ? A THR 128 22 1 Y 1 A GLY 121 ? A GLY 129 23 1 Y 1 A GLN 122 ? A GLN 130 24 1 Y 1 A PRO 123 ? A PRO 131 25 1 Y 1 A THR 124 ? A THR 132 26 1 Y 1 A LEU 125 ? A LEU 133 27 1 Y 1 A PRO 126 ? A PRO 134 28 1 Y 1 A ALA 127 ? A ALA 135 29 1 Y 1 A GLN 128 ? A GLN 136 30 1 Y 1 A GLY 129 ? A GLY 137 31 1 Y 1 A ASP 130 ? A ASP 138 32 1 Y 1 A ILE 131 ? A ILE 139 33 1 Y 1 A MSE 132 ? A MSE 140 34 1 Y 1 A GLN 133 ? A GLN 141 35 1 Y 1 A ALA 134 ? A ALA 142 36 1 Y 1 A ILE 135 ? A ILE 143 37 1 Y 1 A TRP 136 ? A TRP 144 38 1 Y 1 A GLY 137 ? A GLY 145 39 1 Y 1 A THR 138 ? A THR 146 40 1 Y 1 A HIS 139 ? A HIS 147 41 1 Y 1 A GLY 140 ? A GLY 148 42 1 Y 1 A LEU 203 ? A LEU 211 43 1 Y 1 A PRO 204 ? A PRO 212 44 1 Y 1 A ARG 205 ? A ARG 213 45 1 Y 1 A ASN 206 ? A ASN 214 46 1 Y 1 A GLU 207 ? A GLU 215 47 1 Y 1 A GLU 208 ? A GLU 216 48 1 Y 1 A GLU 209 ? A GLU 217 49 1 Y 1 A ALA 210 ? A ALA 218 50 1 Y 1 A LYS 211 ? A LYS 219 51 1 Y 1 A LEU 212 ? A LEU 220 52 1 Y 1 A PRO 213 ? A PRO 221 53 1 Y 1 A PHE 214 ? A PHE 222 54 1 Y 1 A GLY 215 ? A GLY 223 55 1 Y 1 A ASP 216 ? A ASP 224 56 1 Y 1 A PRO 217 ? A PRO 225 57 1 Y 1 A HIS 218 ? A HIS 226 58 1 Y 1 A GLY 219 ? A GLY 227 59 1 Y 1 A ASP 220 ? A ASP 228 60 1 Y 1 A GLY 221 ? A GLY 229 61 1 Y 1 A VAL 222 ? A VAL 230 62 1 Y 1 A PRO 223 ? A PRO 231 63 1 Y 1 A PRO 224 ? A PRO 232 64 1 Y 1 A MSE 225 ? A MSE 233 65 1 Y 1 A PRO 226 ? A PRO 234 66 1 Y 1 A ILE 227 ? A ILE 235 67 1 Y 1 A PHE 228 ? A PHE 236 68 1 Y 1 A GLY 229 ? A GLY 237 69 1 Y 1 A LYS 230 ? A LYS 238 70 1 Y 1 A GLY 231 ? A GLY 239 71 1 Y 1 A TYR 232 ? A TYR 240 72 1 Y 1 A ARG 233 ? A ARG 241 73 1 Y 1 A THR 234 ? A THR 242 74 1 Y 1 A TYR 235 ? A TYR 243 75 1 Y 1 A VAL 236 ? A VAL 244 76 1 Y 1 A THR 237 ? A THR 245 77 1 Y 1 A GLY 238 ? A GLY 246 78 1 Y 1 A LEU 239 ? A LEU 247 79 1 Y 1 A THR 240 ? A THR 248 80 1 Y 1 A HIS 241 ? A HIS 249 81 1 Y 1 A ASP 242 ? A ASP 250 82 1 Y 1 A GLU 243 ? A GLU 251 83 1 Y 1 A LYS 244 ? A LYS 252 84 1 Y 1 A GLY 245 ? A GLY 253 85 1 Y 1 A ARG 246 ? A ARG 254 86 1 Y 1 A PRO 247 ? A PRO 255 87 1 Y 1 A ARG 248 ? A ARG 256 88 1 Y 1 A THR 249 ? A THR 257 89 1 Y 1 A VAL 250 ? A VAL 258 90 1 Y 1 A ASP 251 ? A ASP 259 91 1 Y 1 A ARG 252 ? A ARG 260 92 1 Y 1 A GLU 253 ? A GLU 261 93 1 Y 1 A VAL 254 ? A VAL 262 94 1 Y 1 A HIS 255 ? A HIS 263 95 1 Y 1 A GLU 256 ? A GLU 264 96 1 Y 1 A ARG 257 ? A ARG 265 97 1 Y 1 A LEU 258 ? A LEU 266 98 1 Y 1 A ILE 259 ? A ILE 267 99 1 Y 1 A LYS 260 ? A LYS 268 100 1 Y 1 A ARG 261 ? A ARG 269 101 1 Y 1 A ILE 262 ? A ILE 270 102 1 Y 1 A VAL 263 ? A VAL 271 103 1 Y 1 A GLU 264 ? A GLU 272 104 1 Y 1 A LYS 265 ? A LYS 273 105 1 Y 1 A ILE 266 ? A ILE 274 106 1 Y 1 A GLU 267 ? A GLU 275 107 1 Y 1 A LYS 268 ? A LYS 276 108 1 Y 1 A ASN 269 ? A ASN 277 109 1 Y 1 A LYS 270 ? A LYS 278 110 1 Y 1 A LYS 271 ? A LYS 279 111 1 Y 1 A ASP 272 ? A ASP 280 112 1 Y 1 A ILE 273 ? A ILE 281 113 1 Y 1 A PHE 274 ? A PHE 282 114 1 Y 1 A THR 275 ? A THR 283 115 1 Y 1 A TYR 276 ? A TYR 284 116 1 Y 1 A GLU 277 ? A GLU 285 117 1 Y 1 A THR 278 ? A THR 286 118 1 Y 1 A TYR 279 ? A TYR 287 119 1 Y 1 A GLU 280 ? A GLU 288 120 1 Y 1 A LEU 281 ? A LEU 289 121 1 Y 1 A GLU 282 ? A GLU 290 122 1 Y 1 A ASP 283 ? A ASP 291 123 1 Y 1 A ALA 284 ? A ALA 292 124 1 Y 1 A GLU 285 ? A GLU 293 125 1 Y 1 A ILE 286 ? A ILE 294 126 1 Y 1 A GLY 287 ? A GLY 295 127 1 Y 1 A VAL 288 ? A VAL 296 128 1 Y 1 A VAL 289 ? A VAL 297 129 1 Y 1 A ALA 290 ? A ALA 298 130 1 Y 1 A THR 291 ? A THR 299 131 1 Y 1 A GLY 292 ? A GLY 300 132 1 Y 1 A ILE 293 ? A ILE 301 133 1 Y 1 A VAL 294 ? A VAL 302 134 1 Y 1 A ALA 295 ? A ALA 303 135 1 Y 1 A ARG 296 ? A ARG 304 136 1 Y 1 A SER 297 ? A SER 305 137 1 Y 1 A ALA 298 ? A ALA 306 138 1 Y 1 A LEU 299 ? A LEU 307 139 1 Y 1 A ARG 300 ? A ARG 308 140 1 Y 1 A ALA 301 ? A ALA 309 141 1 Y 1 A VAL 302 ? A VAL 310 142 1 Y 1 A LYS 303 ? A LYS 311 143 1 Y 1 A MSE 304 ? A MSE 312 144 1 Y 1 A LEU 305 ? A LEU 313 145 1 Y 1 A ARG 306 ? A ARG 314 146 1 Y 1 A GLU 307 ? A GLU 315 147 1 Y 1 A GLU 308 ? A GLU 316 148 1 Y 1 A GLY 309 ? A GLY 317 149 1 Y 1 A ILE 310 ? A ILE 318 150 1 Y 1 A LYS 311 ? A LYS 319 151 1 Y 1 A ALA 312 ? A ALA 320 152 1 Y 1 A GLY 313 ? A GLY 321 153 1 Y 1 A LEU 314 ? A LEU 322 154 1 Y 1 A LEU 315 ? A LEU 323 155 1 Y 1 A LYS 316 ? A LYS 324 156 1 Y 1 A ILE 317 ? A ILE 325 157 1 Y 1 A GLU 318 ? A GLU 326 158 1 Y 1 A THR 319 ? A THR 327 159 1 Y 1 A ILE 320 ? A ILE 328 160 1 Y 1 A TRP 321 ? A TRP 329 161 1 Y 1 A PRO 322 ? A PRO 330 162 1 Y 1 A PHE 323 ? A PHE 331 163 1 Y 1 A ASP 324 ? A ASP 332 164 1 Y 1 A PHE 325 ? A PHE 333 165 1 Y 1 A GLU 326 ? A GLU 334 166 1 Y 1 A LEU 327 ? A LEU 335 167 1 Y 1 A ILE 328 ? A ILE 336 168 1 Y 1 A GLU 329 ? A GLU 337 169 1 Y 1 A ARG 330 ? A ARG 338 170 1 Y 1 A ILE 331 ? A ILE 339 171 1 Y 1 A ALA 332 ? A ALA 340 172 1 Y 1 A GLU 333 ? A GLU 341 173 1 Y 1 A ARG 334 ? A ARG 342 174 1 Y 1 A VAL 335 ? A VAL 343 175 1 Y 1 A ASP 336 ? A ASP 344 176 1 Y 1 A LYS 337 ? A LYS 345 177 1 Y 1 A LEU 338 ? A LEU 346 178 1 Y 1 A TYR 339 ? A TYR 347 179 1 Y 1 A VAL 340 ? A VAL 348 180 1 Y 1 A PRO 341 ? A PRO 349 181 1 Y 1 A GLU 342 ? A GLU 350 182 1 Y 1 A MSE 343 ? A MSE 351 183 1 Y 1 A ASN 344 ? A ASN 352 184 1 Y 1 A LEU 345 ? A LEU 353 185 1 Y 1 A GLY 346 ? A GLY 354 186 1 Y 1 A GLN 347 ? A GLN 355 187 1 Y 1 A LEU 348 ? A LEU 356 188 1 Y 1 A TYR 349 ? A TYR 357 189 1 Y 1 A HIS 350 ? A HIS 358 190 1 Y 1 A LEU 351 ? A LEU 359 191 1 Y 1 A ILE 352 ? A ILE 360 192 1 Y 1 A LYS 353 ? A LYS 361 193 1 Y 1 A GLU 354 ? A GLU 362 194 1 Y 1 A GLY 355 ? A GLY 363 195 1 Y 1 A ALA 356 ? A ALA 364 196 1 Y 1 A ASN 357 ? A ASN 365 197 1 Y 1 A GLY 358 ? A GLY 366 198 1 Y 1 A LYS 359 ? A LYS 367 199 1 Y 1 A ALA 360 ? A ALA 368 200 1 Y 1 A GLU 361 ? A GLU 369 201 1 Y 1 A VAL 362 ? A VAL 370 202 1 Y 1 A LYS 363 ? A LYS 371 203 1 Y 1 A LEU 364 ? A LEU 372 204 1 Y 1 A ILE 365 ? A ILE 373 205 1 Y 1 A SER 366 ? A SER 374 206 1 Y 1 A LYS 367 ? A LYS 375 207 1 Y 1 A ILE 368 ? A ILE 376 208 1 Y 1 A GLY 369 ? A GLY 377 209 1 Y 1 A GLY 370 ? A GLY 378 210 1 Y 1 A GLU 371 ? A GLU 379 211 1 Y 1 A VAL 372 ? A VAL 380 212 1 Y 1 A HIS 373 ? A HIS 381 213 1 Y 1 A THR 374 ? A THR 382 214 1 Y 1 A PRO 375 ? A PRO 383 215 1 Y 1 A MSE 376 ? A MSE 384 216 1 Y 1 A GLU 377 ? A GLU 385 217 1 Y 1 A ILE 378 ? A ILE 386 218 1 Y 1 A PHE 379 ? A PHE 387 219 1 Y 1 A GLU 380 ? A GLU 388 220 1 Y 1 A PHE 381 ? A PHE 389 221 1 Y 1 A ILE 382 ? A ILE 390 222 1 Y 1 A ARG 383 ? A ARG 391 223 1 Y 1 A ARG 384 ? A ARG 392 224 1 Y 1 A GLU 385 ? A GLU 393 225 1 Y 1 A PHE 386 ? A PHE 394 226 1 Y 1 A LYS 387 ? A LYS 395 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 MSE N N N N 250 MSE CA C N S 251 MSE C C N N 252 MSE O O N N 253 MSE OXT O N N 254 MSE CB C N N 255 MSE CG C N N 256 MSE SE SE N N 257 MSE CE C N N 258 MSE H H N N 259 MSE H2 H N N 260 MSE HA H N N 261 MSE HXT H N N 262 MSE HB2 H N N 263 MSE HB3 H N N 264 MSE HG2 H N N 265 MSE HG3 H N N 266 MSE HE1 H N N 267 MSE HE2 H N N 268 MSE HE3 H N N 269 PHE N N N N 270 PHE CA C N S 271 PHE C C N N 272 PHE O O N N 273 PHE CB C N N 274 PHE CG C Y N 275 PHE CD1 C Y N 276 PHE CD2 C Y N 277 PHE CE1 C Y N 278 PHE CE2 C Y N 279 PHE CZ C Y N 280 PHE OXT O N N 281 PHE H H N N 282 PHE H2 H N N 283 PHE HA H N N 284 PHE HB2 H N N 285 PHE HB3 H N N 286 PHE HD1 H N N 287 PHE HD2 H N N 288 PHE HE1 H N N 289 PHE HE2 H N N 290 PHE HZ H N N 291 PHE HXT H N N 292 PRO N N N N 293 PRO CA C N S 294 PRO C C N N 295 PRO O O N N 296 PRO CB C N N 297 PRO CG C N N 298 PRO CD C N N 299 PRO OXT O N N 300 PRO H H N N 301 PRO HA H N N 302 PRO HB2 H N N 303 PRO HB3 H N N 304 PRO HG2 H N N 305 PRO HG3 H N N 306 PRO HD2 H N N 307 PRO HD3 H N N 308 PRO HXT H N N 309 SER N N N N 310 SER CA C N S 311 SER C C N N 312 SER O O N N 313 SER CB C N N 314 SER OG O N N 315 SER OXT O N N 316 SER H H N N 317 SER H2 H N N 318 SER HA H N N 319 SER HB2 H N N 320 SER HB3 H N N 321 SER HG H N N 322 SER HXT H N N 323 THR N N N N 324 THR CA C N S 325 THR C C N N 326 THR O O N N 327 THR CB C N R 328 THR OG1 O N N 329 THR CG2 C N N 330 THR OXT O N N 331 THR H H N N 332 THR H2 H N N 333 THR HA H N N 334 THR HB H N N 335 THR HG1 H N N 336 THR HG21 H N N 337 THR HG22 H N N 338 THR HG23 H N N 339 THR HXT H N N 340 TRP N N N N 341 TRP CA C N S 342 TRP C C N N 343 TRP O O N N 344 TRP CB C N N 345 TRP CG C Y N 346 TRP CD1 C Y N 347 TRP CD2 C Y N 348 TRP NE1 N Y N 349 TRP CE2 C Y N 350 TRP CE3 C Y N 351 TRP CZ2 C Y N 352 TRP CZ3 C Y N 353 TRP CH2 C Y N 354 TRP OXT O N N 355 TRP H H N N 356 TRP H2 H N N 357 TRP HA H N N 358 TRP HB2 H N N 359 TRP HB3 H N N 360 TRP HD1 H N N 361 TRP HE1 H N N 362 TRP HE3 H N N 363 TRP HZ2 H N N 364 TRP HZ3 H N N 365 TRP HH2 H N N 366 TRP HXT H N N 367 TYR N N N N 368 TYR CA C N S 369 TYR C C N N 370 TYR O O N N 371 TYR CB C N N 372 TYR CG C Y N 373 TYR CD1 C Y N 374 TYR CD2 C Y N 375 TYR CE1 C Y N 376 TYR CE2 C Y N 377 TYR CZ C Y N 378 TYR OH O N N 379 TYR OXT O N N 380 TYR H H N N 381 TYR H2 H N N 382 TYR HA H N N 383 TYR HB2 H N N 384 TYR HB3 H N N 385 TYR HD1 H N N 386 TYR HD2 H N N 387 TYR HE1 H N N 388 TYR HE2 H N N 389 TYR HH H N N 390 TYR HXT H N N 391 VAL N N N N 392 VAL CA C N S 393 VAL C C N N 394 VAL O O N N 395 VAL CB C N N 396 VAL CG1 C N N 397 VAL CG2 C N N 398 VAL OXT O N N 399 VAL H H N N 400 VAL H2 H N N 401 VAL HA H N N 402 VAL HB H N N 403 VAL HG11 H N N 404 VAL HG12 H N N 405 VAL HG13 H N N 406 VAL HG21 H N N 407 VAL HG22 H N N 408 VAL HG23 H N N 409 VAL HXT H N N 410 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 MSE N CA sing N N 237 MSE N H sing N N 238 MSE N H2 sing N N 239 MSE CA C sing N N 240 MSE CA CB sing N N 241 MSE CA HA sing N N 242 MSE C O doub N N 243 MSE C OXT sing N N 244 MSE OXT HXT sing N N 245 MSE CB CG sing N N 246 MSE CB HB2 sing N N 247 MSE CB HB3 sing N N 248 MSE CG SE sing N N 249 MSE CG HG2 sing N N 250 MSE CG HG3 sing N N 251 MSE SE CE sing N N 252 MSE CE HE1 sing N N 253 MSE CE HE2 sing N N 254 MSE CE HE3 sing N N 255 PHE N CA sing N N 256 PHE N H sing N N 257 PHE N H2 sing N N 258 PHE CA C sing N N 259 PHE CA CB sing N N 260 PHE CA HA sing N N 261 PHE C O doub N N 262 PHE C OXT sing N N 263 PHE CB CG sing N N 264 PHE CB HB2 sing N N 265 PHE CB HB3 sing N N 266 PHE CG CD1 doub Y N 267 PHE CG CD2 sing Y N 268 PHE CD1 CE1 sing Y N 269 PHE CD1 HD1 sing N N 270 PHE CD2 CE2 doub Y N 271 PHE CD2 HD2 sing N N 272 PHE CE1 CZ doub Y N 273 PHE CE1 HE1 sing N N 274 PHE CE2 CZ sing Y N 275 PHE CE2 HE2 sing N N 276 PHE CZ HZ sing N N 277 PHE OXT HXT sing N N 278 PRO N CA sing N N 279 PRO N CD sing N N 280 PRO N H sing N N 281 PRO CA C sing N N 282 PRO CA CB sing N N 283 PRO CA HA sing N N 284 PRO C O doub N N 285 PRO C OXT sing N N 286 PRO CB CG sing N N 287 PRO CB HB2 sing N N 288 PRO CB HB3 sing N N 289 PRO CG CD sing N N 290 PRO CG HG2 sing N N 291 PRO CG HG3 sing N N 292 PRO CD HD2 sing N N 293 PRO CD HD3 sing N N 294 PRO OXT HXT sing N N 295 SER N CA sing N N 296 SER N H sing N N 297 SER N H2 sing N N 298 SER CA C sing N N 299 SER CA CB sing N N 300 SER CA HA sing N N 301 SER C O doub N N 302 SER C OXT sing N N 303 SER CB OG sing N N 304 SER CB HB2 sing N N 305 SER CB HB3 sing N N 306 SER OG HG sing N N 307 SER OXT HXT sing N N 308 THR N CA sing N N 309 THR N H sing N N 310 THR N H2 sing N N 311 THR CA C sing N N 312 THR CA CB sing N N 313 THR CA HA sing N N 314 THR C O doub N N 315 THR C OXT sing N N 316 THR CB OG1 sing N N 317 THR CB CG2 sing N N 318 THR CB HB sing N N 319 THR OG1 HG1 sing N N 320 THR CG2 HG21 sing N N 321 THR CG2 HG22 sing N N 322 THR CG2 HG23 sing N N 323 THR OXT HXT sing N N 324 TRP N CA sing N N 325 TRP N H sing N N 326 TRP N H2 sing N N 327 TRP CA C sing N N 328 TRP CA CB sing N N 329 TRP CA HA sing N N 330 TRP C O doub N N 331 TRP C OXT sing N N 332 TRP CB CG sing N N 333 TRP CB HB2 sing N N 334 TRP CB HB3 sing N N 335 TRP CG CD1 doub Y N 336 TRP CG CD2 sing Y N 337 TRP CD1 NE1 sing Y N 338 TRP CD1 HD1 sing N N 339 TRP CD2 CE2 doub Y N 340 TRP CD2 CE3 sing Y N 341 TRP NE1 CE2 sing Y N 342 TRP NE1 HE1 sing N N 343 TRP CE2 CZ2 sing Y N 344 TRP CE3 CZ3 doub Y N 345 TRP CE3 HE3 sing N N 346 TRP CZ2 CH2 doub Y N 347 TRP CZ2 HZ2 sing N N 348 TRP CZ3 CH2 sing Y N 349 TRP CZ3 HZ3 sing N N 350 TRP CH2 HH2 sing N N 351 TRP OXT HXT sing N N 352 TYR N CA sing N N 353 TYR N H sing N N 354 TYR N H2 sing N N 355 TYR CA C sing N N 356 TYR CA CB sing N N 357 TYR CA HA sing N N 358 TYR C O doub N N 359 TYR C OXT sing N N 360 TYR CB CG sing N N 361 TYR CB HB2 sing N N 362 TYR CB HB3 sing N N 363 TYR CG CD1 doub Y N 364 TYR CG CD2 sing Y N 365 TYR CD1 CE1 sing Y N 366 TYR CD1 HD1 sing N N 367 TYR CD2 CE2 doub Y N 368 TYR CD2 HD2 sing N N 369 TYR CE1 CZ doub Y N 370 TYR CE1 HE1 sing N N 371 TYR CE2 CZ sing Y N 372 TYR CE2 HE2 sing N N 373 TYR CZ OH sing N N 374 TYR OH HH sing N N 375 TYR OXT HXT sing N N 376 VAL N CA sing N N 377 VAL N H sing N N 378 VAL N H2 sing N N 379 VAL CA C sing N N 380 VAL CA CB sing N N 381 VAL CA HA sing N N 382 VAL C O doub N N 383 VAL C OXT sing N N 384 VAL CB CG1 sing N N 385 VAL CB CG2 sing N N 386 VAL CB HB sing N N 387 VAL CG1 HG11 sing N N 388 VAL CG1 HG12 sing N N 389 VAL CG1 HG13 sing N N 390 VAL CG2 HG21 sing N N 391 VAL CG2 HG22 sing N N 392 VAL CG2 HG23 sing N N 393 VAL OXT HXT sing N N 394 # _atom_sites.entry_id 1YD7 _atom_sites.fract_transf_matrix[1][1] 0.016274 _atom_sites.fract_transf_matrix[1][2] 0.009396 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018792 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007747 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE X # loop_