data_1YEB # _entry.id 1YEB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.338 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1YEB WWPDB D_1000177378 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1YEB _pdbx_database_status.recvd_initial_deposition_date 1991-10-29 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Murphy, M.E.P.' 1 'Brayer, G.D.' 2 # _citation.id primary _citation.title 'Structure determination and analysis of yeast iso-2-cytochrome c and a composite mutant protein.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 227 _citation.page_first 160 _citation.page_last 176 _citation.year 1992 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 1326054 _citation.pdbx_database_id_DOI '10.1016/0022-2836(92)90689-H' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Murphy, M.E.' 1 ? primary 'Nall, B.T.' 2 ? primary 'Brayer, G.D.' 3 ? # _cell.entry_id 1YEB _cell.length_a 36.390 _cell.length_b 36.390 _cell.length_c 137.280 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1YEB _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CYTOCHROME C' 12123.826 1 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 non-polymer syn 'HEME C' 618.503 1 ? ? ? ? 4 water nat water 18.015 55 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;TEFKAGSAKKGATLFKTRCQQCHTIEEGGPNKVGPNLHGIFGRHSGQVKGYSYTDANINKNVKWDEDSMSEYLTNP (M3L)KYIPGTKMAFGGLKKEKDRNDLITYLKKACE ; _entity_poly.pdbx_seq_one_letter_code_can ;TEFKAGSAKKGATLFKTRCQQCHTIEEGGPNKVGPNLHGIFGRHSGQVKGYSYTDANINKNVKWDEDSMSEYLTNPKKYI PGTKMAFGGLKKEKDRNDLITYLKKACE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 GLU n 1 3 PHE n 1 4 LYS n 1 5 ALA n 1 6 GLY n 1 7 SER n 1 8 ALA n 1 9 LYS n 1 10 LYS n 1 11 GLY n 1 12 ALA n 1 13 THR n 1 14 LEU n 1 15 PHE n 1 16 LYS n 1 17 THR n 1 18 ARG n 1 19 CYS n 1 20 GLN n 1 21 GLN n 1 22 CYS n 1 23 HIS n 1 24 THR n 1 25 ILE n 1 26 GLU n 1 27 GLU n 1 28 GLY n 1 29 GLY n 1 30 PRO n 1 31 ASN n 1 32 LYS n 1 33 VAL n 1 34 GLY n 1 35 PRO n 1 36 ASN n 1 37 LEU n 1 38 HIS n 1 39 GLY n 1 40 ILE n 1 41 PHE n 1 42 GLY n 1 43 ARG n 1 44 HIS n 1 45 SER n 1 46 GLY n 1 47 GLN n 1 48 VAL n 1 49 LYS n 1 50 GLY n 1 51 TYR n 1 52 SER n 1 53 TYR n 1 54 THR n 1 55 ASP n 1 56 ALA n 1 57 ASN n 1 58 ILE n 1 59 ASN n 1 60 LYS n 1 61 ASN n 1 62 VAL n 1 63 LYS n 1 64 TRP n 1 65 ASP n 1 66 GLU n 1 67 ASP n 1 68 SER n 1 69 MET n 1 70 SER n 1 71 GLU n 1 72 TYR n 1 73 LEU n 1 74 THR n 1 75 ASN n 1 76 PRO n 1 77 M3L n 1 78 LYS n 1 79 TYR n 1 80 ILE n 1 81 PRO n 1 82 GLY n 1 83 THR n 1 84 LYS n 1 85 MET n 1 86 ALA n 1 87 PHE n 1 88 GLY n 1 89 GLY n 1 90 LEU n 1 91 LYS n 1 92 LYS n 1 93 GLU n 1 94 LYS n 1 95 ASP n 1 96 ARG n 1 97 ASN n 1 98 ASP n 1 99 LEU n 1 100 ILE n 1 101 THR n 1 102 TYR n 1 103 LEU n 1 104 LYS n 1 105 LYS n 1 106 ALA n 1 107 CYS n 1 108 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;baker's yeast ; _entity_src_gen.gene_src_genus Saccharomyces _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CYC7_YEAST _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00045 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MAKESTGFKPGSAKKGATLFKTRCQQCHTIEEGGPNKVGPNLHGIFGRHSGQVKGYSYTDANINKNVKWDEDSMSEYLTN PKKYIPGTKMAFAGLKKEKDRNDLITYMTKAAK ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1YEB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 106 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00045 _struct_ref_seq.db_align_beg 6 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 111 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -5 _struct_ref_seq.pdbx_auth_seq_align_end 101 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1YEB GLU A 2 ? UNP P00045 GLY 7 conflict -4 1 1 1YEB ALA A 5 ? UNP P00045 PRO 10 conflict -1 2 1 1YEB GLY A 88 ? UNP P00045 ALA 93 conflict 83 3 1 1YEB LEU A 103 ? UNP P00045 MET 108 conflict 98 4 1 1YEB LYS A 104 ? UNP P00045 THR 109 conflict 99 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEC non-polymer . 'HEME C' ? 'C34 H34 Fe N4 O4' 618.503 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 M3L 'L-peptide linking' n N-TRIMETHYLLYSINE ? 'C9 H21 N2 O2 1' 189.275 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1YEB _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.88 _exptl_crystal.density_percent_sol 34.58 _exptl_crystal.description ? # _refine.entry_id 1YEB _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 6.0 _refine.ls_d_res_high 1.95 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.1750000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 847 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 51 _refine_hist.number_atoms_solvent 55 _refine_hist.number_atoms_total 953 _refine_hist.d_res_high 1.95 _refine_hist.d_res_low 6.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function p_bond_d 0.019 0.020 ? ? 'X-RAY DIFFRACTION' ? p_angle_d 0.037 0.030 ? ? 'X-RAY DIFFRACTION' ? p_angle_deg ? ? ? ? 'X-RAY DIFFRACTION' ? p_planar_d 0.047 0.045 ? ? 'X-RAY DIFFRACTION' ? p_hb_or_metal_coord ? ? ? ? 'X-RAY DIFFRACTION' ? p_mcbond_it 1.54 1.40 ? ? 'X-RAY DIFFRACTION' ? p_mcangle_it 2.24 2.30 ? ? 'X-RAY DIFFRACTION' ? p_scbond_it 2.59 1.70 ? ? 'X-RAY DIFFRACTION' ? p_scangle_it 4.06 3.00 ? ? 'X-RAY DIFFRACTION' ? p_plane_restr 0.016 0.020 ? ? 'X-RAY DIFFRACTION' ? p_chiral_restr 0.196 0.150 ? ? 'X-RAY DIFFRACTION' ? p_singtor_nbd 0.218 0.250 ? ? 'X-RAY DIFFRACTION' ? p_multtor_nbd 0.186 0.250 ? ? 'X-RAY DIFFRACTION' ? p_xhyhbond_nbd 0.227 0.250 ? ? 'X-RAY DIFFRACTION' ? p_xyhbond_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_planar_tor 2.6 3.0 ? ? 'X-RAY DIFFRACTION' ? p_staggered_tor 22.8 20.0 ? ? 'X-RAY DIFFRACTION' ? p_orthonormal_tor 12.0 15.0 ? ? 'X-RAY DIFFRACTION' ? p_transverse_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_special_tor ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1YEB _struct.title 'STRUCTURE DETERMINATION AND ANALYSIS OF YEAST ISO-2-CYTOCHROME C AND A COMPOSITE MUTANT PROTEIN' _struct.pdbx_descriptor 'CYTOCHROME C (B-2036 COMPOSITE, REDUCED STATE)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1YEB _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 H1 SER A 7 ? CYS A 19 ? SER A 2 CYS A 14 1 ? 13 HELX_P HELX_P2 H2 THR A 54 ? ASN A 61 ? THR A 49 ASN A 56 1 ? 8 HELX_P HELX_P3 H3 ASP A 65 ? ASN A 75 ? ASP A 60 ASN A 70 1 'LAST TURN CLASS 5' 11 HELX_P HELX_P4 H4 ASN A 75 ? ILE A 80 ? ASN A 70 ILE A 75 1 ? 6 HELX_P HELX_P5 H5 LYS A 92 ? CYS A 107 ? LYS A 87 CYS A 102 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A CYS 19 SG ? ? ? 1_555 C HEC . CAB ? ? A CYS 14 A HEC 104 1_555 ? ? ? ? ? ? ? 1.749 ? ? covale2 covale none ? A CYS 22 SG ? ? ? 1_555 C HEC . CAC ? ? A CYS 17 A HEC 104 1_555 ? ? ? ? ? ? ? 1.828 ? ? covale3 covale both ? A PRO 76 C ? ? ? 1_555 A M3L 77 N ? ? A PRO 71 A M3L 72 1_555 ? ? ? ? ? ? ? 1.344 ? ? covale4 covale both ? A M3L 77 C ? ? ? 1_555 A LYS 78 N ? ? A M3L 72 A LYS 73 1_555 ? ? ? ? ? ? ? 1.325 ? ? metalc1 metalc ? ? A HIS 23 NE2 ? ? ? 1_555 C HEC . FE ? ? A HIS 18 A HEC 104 1_555 ? ? ? ? ? ? ? 2.064 ? ? metalc2 metalc ? ? A MET 85 SD ? ? ? 1_555 C HEC . FE ? ? A MET 80 A HEC 104 1_555 ? ? ? ? ? ? ? 2.330 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 105 ? 6 'BINDING SITE FOR RESIDUE SO4 A 105' AC2 Software A HEC 104 ? 21 'BINDING SITE FOR RESIDUE HEC A 104' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 SER A 7 ? SER A 2 . ? 1_555 ? 2 AC1 6 ALA A 8 ? ALA A 3 . ? 1_555 ? 3 AC1 6 LYS A 9 ? LYS A 4 . ? 1_555 ? 4 AC1 6 SER A 52 ? SER A 47 . ? 3_554 ? 5 AC1 6 LYS A 78 ? LYS A 73 . ? 7_565 ? 6 AC1 6 HOH D . ? HOH A 154 . ? 1_555 ? 7 AC2 21 LYS A 4 ? LYS A -2 . ? 4_455 ? 8 AC2 21 ARG A 18 ? ARG A 13 . ? 1_555 ? 9 AC2 21 CYS A 19 ? CYS A 14 . ? 1_555 ? 10 AC2 21 CYS A 22 ? CYS A 17 . ? 1_555 ? 11 AC2 21 HIS A 23 ? HIS A 18 . ? 1_555 ? 12 AC2 21 GLY A 28 ? GLY A 23 . ? 6_465 ? 13 AC2 21 VAL A 33 ? VAL A 28 . ? 1_555 ? 14 AC2 21 SER A 45 ? SER A 40 . ? 1_555 ? 15 AC2 21 GLY A 46 ? GLY A 41 . ? 1_555 ? 16 AC2 21 TYR A 51 ? TYR A 46 . ? 1_555 ? 17 AC2 21 TYR A 53 ? TYR A 48 . ? 1_555 ? 18 AC2 21 THR A 54 ? THR A 49 . ? 1_555 ? 19 AC2 21 ASN A 57 ? ASN A 52 . ? 1_555 ? 20 AC2 21 TRP A 64 ? TRP A 59 . ? 1_555 ? 21 AC2 21 THR A 83 ? THR A 78 . ? 1_555 ? 22 AC2 21 LYS A 84 ? LYS A 79 . ? 1_555 ? 23 AC2 21 MET A 85 ? MET A 80 . ? 1_555 ? 24 AC2 21 ALA A 86 ? ALA A 81 . ? 1_555 ? 25 AC2 21 PHE A 87 ? PHE A 82 . ? 1_555 ? 26 AC2 21 HOH D . ? HOH A 109 . ? 1_555 ? 27 AC2 21 HOH D . ? HOH A 122 . ? 1_555 ? # _database_PDB_matrix.entry_id 1YEB _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1YEB _atom_sites.fract_transf_matrix[1][1] 0.027480 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.027480 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007284 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # _atom_sites_footnote.id 1 _atom_sites_footnote.text 'RESIDUE LYS 72 AND TML 72 FORM EPSILON-N-TRIMETHYLLYSINE. SEE REMARK 7.' # loop_ _atom_type.symbol C FE N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 -5 -5 THR THR A . n A 1 2 GLU 2 -4 -4 GLU GLU A . n A 1 3 PHE 3 -3 -3 PHE PHE A . n A 1 4 LYS 4 -2 -2 LYS LYS A . n A 1 5 ALA 5 -1 -1 ALA ALA A . n A 1 6 GLY 6 1 1 GLY GLY A . n A 1 7 SER 7 2 2 SER SER A . n A 1 8 ALA 8 3 3 ALA ALA A . n A 1 9 LYS 9 4 4 LYS LYS A . n A 1 10 LYS 10 5 5 LYS LYS A . n A 1 11 GLY 11 6 6 GLY GLY A . n A 1 12 ALA 12 7 7 ALA ALA A . n A 1 13 THR 13 8 8 THR THR A . n A 1 14 LEU 14 9 9 LEU LEU A . n A 1 15 PHE 15 10 10 PHE PHE A . n A 1 16 LYS 16 11 11 LYS LYS A . n A 1 17 THR 17 12 12 THR THR A . n A 1 18 ARG 18 13 13 ARG ARG A . n A 1 19 CYS 19 14 14 CYS CYS A . n A 1 20 GLN 20 15 15 GLN GLN A . n A 1 21 GLN 21 16 16 GLN GLN A . n A 1 22 CYS 22 17 17 CYS CYS A . n A 1 23 HIS 23 18 18 HIS HIS A . n A 1 24 THR 24 19 19 THR THR A . n A 1 25 ILE 25 20 20 ILE ILE A . n A 1 26 GLU 26 21 21 GLU GLU A . n A 1 27 GLU 27 22 22 GLU GLU A . n A 1 28 GLY 28 23 23 GLY GLY A . n A 1 29 GLY 29 24 24 GLY GLY A . n A 1 30 PRO 30 25 25 PRO PRO A . n A 1 31 ASN 31 26 26 ASN ASN A . n A 1 32 LYS 32 27 27 LYS LYS A . n A 1 33 VAL 33 28 28 VAL VAL A . n A 1 34 GLY 34 29 29 GLY GLY A . n A 1 35 PRO 35 30 30 PRO PRO A . n A 1 36 ASN 36 31 31 ASN ASN A . n A 1 37 LEU 37 32 32 LEU LEU A . n A 1 38 HIS 38 33 33 HIS HIS A . n A 1 39 GLY 39 34 34 GLY GLY A . n A 1 40 ILE 40 35 35 ILE ILE A . n A 1 41 PHE 41 36 36 PHE PHE A . n A 1 42 GLY 42 37 37 GLY GLY A . n A 1 43 ARG 43 38 38 ARG ARG A . n A 1 44 HIS 44 39 39 HIS HIS A . n A 1 45 SER 45 40 40 SER SER A . n A 1 46 GLY 46 41 41 GLY GLY A . n A 1 47 GLN 47 42 42 GLN GLN A . n A 1 48 VAL 48 43 43 VAL VAL A . n A 1 49 LYS 49 44 44 LYS LYS A . n A 1 50 GLY 50 45 45 GLY GLY A . n A 1 51 TYR 51 46 46 TYR TYR A . n A 1 52 SER 52 47 47 SER SER A . n A 1 53 TYR 53 48 48 TYR TYR A . n A 1 54 THR 54 49 49 THR THR A . n A 1 55 ASP 55 50 50 ASP ASP A . n A 1 56 ALA 56 51 51 ALA ALA A . n A 1 57 ASN 57 52 52 ASN ASN A . n A 1 58 ILE 58 53 53 ILE ILE A . n A 1 59 ASN 59 54 54 ASN ASN A . n A 1 60 LYS 60 55 55 LYS LYS A . n A 1 61 ASN 61 56 56 ASN ASN A . n A 1 62 VAL 62 57 57 VAL VAL A . n A 1 63 LYS 63 58 58 LYS LYS A . n A 1 64 TRP 64 59 59 TRP TRP A . n A 1 65 ASP 65 60 60 ASP ASP A . n A 1 66 GLU 66 61 61 GLU GLU A . n A 1 67 ASP 67 62 62 ASP ASP A . n A 1 68 SER 68 63 63 SER SER A . n A 1 69 MET 69 64 64 MET MET A . n A 1 70 SER 70 65 65 SER SER A . n A 1 71 GLU 71 66 66 GLU GLU A . n A 1 72 TYR 72 67 67 TYR TYR A . n A 1 73 LEU 73 68 68 LEU LEU A . n A 1 74 THR 74 69 69 THR THR A . n A 1 75 ASN 75 70 70 ASN ASN A . n A 1 76 PRO 76 71 71 PRO PRO A . n A 1 77 M3L 77 72 72 M3L LYS A . n A 1 78 LYS 78 73 73 LYS LYS A . n A 1 79 TYR 79 74 74 TYR TYR A . n A 1 80 ILE 80 75 75 ILE ILE A . n A 1 81 PRO 81 76 76 PRO PRO A . n A 1 82 GLY 82 77 77 GLY GLY A . n A 1 83 THR 83 78 78 THR THR A . n A 1 84 LYS 84 79 79 LYS LYS A . n A 1 85 MET 85 80 80 MET MET A . n A 1 86 ALA 86 81 81 ALA ALA A . n A 1 87 PHE 87 82 82 PHE PHE A . n A 1 88 GLY 88 83 83 GLY GLY A . n A 1 89 GLY 89 84 84 GLY GLY A . n A 1 90 LEU 90 85 85 LEU LEU A . n A 1 91 LYS 91 86 86 LYS LYS A . n A 1 92 LYS 92 87 87 LYS LYS A . n A 1 93 GLU 93 88 88 GLU GLU A . n A 1 94 LYS 94 89 89 LYS LYS A . n A 1 95 ASP 95 90 90 ASP ASP A . n A 1 96 ARG 96 91 91 ARG ARG A . n A 1 97 ASN 97 92 92 ASN ASN A . n A 1 98 ASP 98 93 93 ASP ASP A . n A 1 99 LEU 99 94 94 LEU LEU A . n A 1 100 ILE 100 95 95 ILE ILE A . n A 1 101 THR 101 96 96 THR THR A . n A 1 102 TYR 102 97 97 TYR TYR A . n A 1 103 LEU 103 98 98 LEU LEU A . n A 1 104 LYS 104 99 99 LYS LYS A . n A 1 105 LYS 105 100 100 LYS LYS A . n A 1 106 ALA 106 101 101 ALA ALA A . n A 1 107 CYS 107 102 102 CYS CYS A . n A 1 108 GLU 108 103 103 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 105 105 SO4 SO4 A . C 3 HEC 1 104 104 HEC HEM A . D 4 HOH 1 106 106 HOH HOH A . D 4 HOH 2 107 107 HOH HOH A . D 4 HOH 3 108 108 HOH HOH A . D 4 HOH 4 109 109 HOH HOH A . D 4 HOH 5 110 110 HOH HOH A . D 4 HOH 6 111 111 HOH HOH A . D 4 HOH 7 112 112 HOH HOH A . D 4 HOH 8 113 113 HOH HOH A . D 4 HOH 9 114 114 HOH HOH A . D 4 HOH 10 115 115 HOH HOH A . D 4 HOH 11 116 116 HOH HOH A . D 4 HOH 12 117 117 HOH HOH A . D 4 HOH 13 118 118 HOH HOH A . D 4 HOH 14 119 119 HOH HOH A . D 4 HOH 15 120 120 HOH HOH A . D 4 HOH 16 121 121 HOH HOH A . D 4 HOH 17 122 122 HOH HOH A . D 4 HOH 18 123 123 HOH HOH A . D 4 HOH 19 124 124 HOH HOH A . D 4 HOH 20 125 125 HOH HOH A . D 4 HOH 21 126 126 HOH HOH A . D 4 HOH 22 127 127 HOH HOH A . D 4 HOH 23 128 128 HOH HOH A . D 4 HOH 24 129 129 HOH HOH A . D 4 HOH 25 130 130 HOH HOH A . D 4 HOH 26 131 131 HOH HOH A . D 4 HOH 27 132 132 HOH HOH A . D 4 HOH 28 133 133 HOH HOH A . D 4 HOH 29 134 134 HOH HOH A . D 4 HOH 30 135 135 HOH HOH A . D 4 HOH 31 136 136 HOH HOH A . D 4 HOH 32 137 137 HOH HOH A . D 4 HOH 33 138 138 HOH HOH A . D 4 HOH 34 139 139 HOH HOH A . D 4 HOH 35 140 140 HOH HOH A . D 4 HOH 36 141 141 HOH HOH A . D 4 HOH 37 142 142 HOH HOH A . D 4 HOH 38 143 143 HOH HOH A . D 4 HOH 39 144 144 HOH HOH A . D 4 HOH 40 145 145 HOH HOH A . D 4 HOH 41 146 146 HOH HOH A . D 4 HOH 42 147 147 HOH HOH A . D 4 HOH 43 148 148 HOH HOH A . D 4 HOH 44 149 149 HOH HOH A . D 4 HOH 45 150 150 HOH HOH A . D 4 HOH 46 151 151 HOH HOH A . D 4 HOH 47 152 152 HOH HOH A . D 4 HOH 48 153 153 HOH HOH A . D 4 HOH 49 154 154 HOH HOH A . D 4 HOH 50 155 155 HOH HOH A . D 4 HOH 51 156 156 HOH HOH A . D 4 HOH 52 157 157 HOH HOH A . D 4 HOH 53 158 158 HOH HOH A . D 4 HOH 54 159 159 HOH HOH A . D 4 HOH 55 160 160 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id M3L _pdbx_struct_mod_residue.label_seq_id 77 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id M3L _pdbx_struct_mod_residue.auth_seq_id 72 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id LYS _pdbx_struct_mod_residue.details N-TRIMETHYLLYSINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_465 y-1,x+1,-z 0.0000000000 1.0000000000 0.0000000000 -36.3900000000 1.0000000000 0.0000000000 0.0000000000 36.3900000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 23 ? A HIS 18 ? 1_555 FE ? C HEC . ? A HEC 104 ? 1_555 NA ? C HEC . ? A HEC 104 ? 1_555 83.3 ? 2 NE2 ? A HIS 23 ? A HIS 18 ? 1_555 FE ? C HEC . ? A HEC 104 ? 1_555 NB ? C HEC . ? A HEC 104 ? 1_555 88.7 ? 3 NA ? C HEC . ? A HEC 104 ? 1_555 FE ? C HEC . ? A HEC 104 ? 1_555 NB ? C HEC . ? A HEC 104 ? 1_555 90.3 ? 4 NE2 ? A HIS 23 ? A HIS 18 ? 1_555 FE ? C HEC . ? A HEC 104 ? 1_555 NC ? C HEC . ? A HEC 104 ? 1_555 90.7 ? 5 NA ? C HEC . ? A HEC 104 ? 1_555 FE ? C HEC . ? A HEC 104 ? 1_555 NC ? C HEC . ? A HEC 104 ? 1_555 173.8 ? 6 NB ? C HEC . ? A HEC 104 ? 1_555 FE ? C HEC . ? A HEC 104 ? 1_555 NC ? C HEC . ? A HEC 104 ? 1_555 87.8 ? 7 NE2 ? A HIS 23 ? A HIS 18 ? 1_555 FE ? C HEC . ? A HEC 104 ? 1_555 ND ? C HEC . ? A HEC 104 ? 1_555 86.5 ? 8 NA ? C HEC . ? A HEC 104 ? 1_555 FE ? C HEC . ? A HEC 104 ? 1_555 ND ? C HEC . ? A HEC 104 ? 1_555 92.2 ? 9 NB ? C HEC . ? A HEC 104 ? 1_555 FE ? C HEC . ? A HEC 104 ? 1_555 ND ? C HEC . ? A HEC 104 ? 1_555 174.3 ? 10 NC ? C HEC . ? A HEC 104 ? 1_555 FE ? C HEC . ? A HEC 104 ? 1_555 ND ? C HEC . ? A HEC 104 ? 1_555 89.1 ? 11 NE2 ? A HIS 23 ? A HIS 18 ? 1_555 FE ? C HEC . ? A HEC 104 ? 1_555 SD ? A MET 85 ? A MET 80 ? 1_555 172.1 ? 12 NA ? C HEC . ? A HEC 104 ? 1_555 FE ? C HEC . ? A HEC 104 ? 1_555 SD ? A MET 85 ? A MET 80 ? 1_555 88.8 ? 13 NB ? C HEC . ? A HEC 104 ? 1_555 FE ? C HEC . ? A HEC 104 ? 1_555 SD ? A MET 85 ? A MET 80 ? 1_555 91.8 ? 14 NC ? C HEC . ? A HEC 104 ? 1_555 FE ? C HEC . ? A HEC 104 ? 1_555 SD ? A MET 85 ? A MET 80 ? 1_555 97.2 ? 15 ND ? C HEC . ? A HEC 104 ? 1_555 FE ? C HEC . ? A HEC 104 ? 1_555 SD ? A MET 85 ? A MET 80 ? 1_555 93.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1993-10-31 2 'Structure model' 1 1 2008-03-21 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 5 'Structure model' 2 0 2021-03-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other 5 5 'Structure model' 'Atomic model' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Derived calculations' 9 5 'Structure model' 'Non-polymer description' 10 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' struct_conf 3 4 'Structure model' struct_conf_type 4 5 'Structure model' atom_site 5 5 'Structure model' chem_comp 6 5 'Structure model' entity 7 5 'Structure model' pdbx_entity_nonpoly 8 5 'Structure model' pdbx_nonpoly_scheme 9 5 'Structure model' pdbx_struct_conn_angle 10 5 'Structure model' struct_conn 11 5 'Structure model' struct_ref_seq_dif 12 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.process_site' 2 5 'Structure model' '_atom_site.B_iso_or_equiv' 3 5 'Structure model' '_atom_site.Cartn_x' 4 5 'Structure model' '_atom_site.Cartn_y' 5 5 'Structure model' '_atom_site.Cartn_z' 6 5 'Structure model' '_atom_site.auth_atom_id' 7 5 'Structure model' '_atom_site.auth_comp_id' 8 5 'Structure model' '_atom_site.label_atom_id' 9 5 'Structure model' '_atom_site.label_comp_id' 10 5 'Structure model' '_atom_site.type_symbol' 11 5 'Structure model' '_chem_comp.formula' 12 5 'Structure model' '_chem_comp.formula_weight' 13 5 'Structure model' '_chem_comp.id' 14 5 'Structure model' '_chem_comp.name' 15 5 'Structure model' '_chem_comp.pdbx_synonyms' 16 5 'Structure model' '_entity.formula_weight' 17 5 'Structure model' '_entity.pdbx_description' 18 5 'Structure model' '_pdbx_entity_nonpoly.comp_id' 19 5 'Structure model' '_pdbx_entity_nonpoly.name' 20 5 'Structure model' '_pdbx_nonpoly_scheme.mon_id' 21 5 'Structure model' '_pdbx_nonpoly_scheme.pdb_mon_id' 22 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 23 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 24 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id' 25 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 26 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 27 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 28 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 29 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 30 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 31 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 32 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 33 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 34 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 35 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 36 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 37 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 38 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 39 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 40 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 41 5 'Structure model' '_struct_ref_seq_dif.details' 42 5 'Structure model' '_struct_site.details' 43 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 44 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 45 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _software.name PROLSQ _software.classification refinement _software.version . _software.citation_id ? _software.pdbx_ordinal 1 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 CE1 A HIS 33 ? ? 1_555 OE1 A GLU 88 ? ? 7_565 2.08 2 1 CB A GLU -4 ? ? 1_555 OE1 A GLU 21 ? ? 7_455 2.12 3 1 NZ A LYS 87 ? ? 1_555 NZ A LYS 87 ? ? 7_465 2.12 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A LYS 4 ? ? CB A LYS 4 ? ? CG A LYS 4 ? ? 130.63 113.40 17.23 2.20 N 2 1 CG A ARG 13 ? ? CD A ARG 13 ? ? NE A ARG 13 ? ? 126.18 111.80 14.38 2.10 N 3 1 CA A HIS 18 ? ? CB A HIS 18 ? ? CG A HIS 18 ? ? 124.31 113.60 10.71 1.70 N 4 1 CB A SER 47 ? ? CA A SER 47 ? ? C A SER 47 ? ? 123.36 110.10 13.26 1.90 N 5 1 CB A ASP 60 ? ? CG A ASP 60 ? ? OD1 A ASP 60 ? ? 125.16 118.30 6.86 0.90 N 6 1 CD A ARG 91 ? ? NE A ARG 91 ? ? CZ A ARG 91 ? ? 137.80 123.60 14.20 1.40 N 7 1 NE A ARG 91 ? ? CZ A ARG 91 ? ? NH2 A ARG 91 ? ? 126.82 120.30 6.52 0.50 N 8 1 CA A CYS 102 ? ? CB A CYS 102 ? ? SG A CYS 102 ? ? 101.50 114.00 -12.50 1.80 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 27 ? ? -136.63 -127.11 2 1 ASN A 70 ? ? -169.02 100.09 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 'HEME C' HEC 4 water HOH #