data_1YJT # _entry.id 1YJT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1YJT pdb_00001yjt 10.2210/pdb1yjt/pdb RCSB RCSB031594 ? ? WWPDB D_1000031594 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1YJR 'the apo form of the same protein, A69P mutant' unspecified PDB 1YJU 'the apo form of the same protein' unspecified PDB 1YJV 'the Cu(I) form of the same protein' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1YJT _pdbx_database_status.recvd_initial_deposition_date 2005-01-15 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Banci, L.' 1 'Bertini, I.' 2 'Cantini, F.' 3 'Migliardi, M.' 4 'Rosato, A.' 5 'Wang, S.' 6 # _citation.id primary _citation.title 'An atomic-level investigation of the disease-causing A629P mutant of the Menkes protein, ATP7A' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 352 _citation.page_first 409 _citation.page_last 417 _citation.year 2005 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16083905 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2005.07.034 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Banci, L.' 1 ? primary 'Bertini, I.' 2 ? primary 'Cantini, F.' 3 ? primary 'Migliardi, M.' 4 ? primary 'Rosato, A.' 5 ? primary 'Wang, S.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Copper-transporting ATPase 1' 8217.630 1 3.6.3.4 A69P 'Sixth soluble domain' ? 2 non-polymer syn 'COPPER (I) ION' 63.546 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Copper pump 1, Menkes disease-associated protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MGDGVLELVVRGMTCASCVHKIESSLTKHRGILYCSVALATNKAHIKYDPEIIGPRDIIHTIESLGFEPSLVKIE _entity_poly.pdbx_seq_one_letter_code_can MGDGVLELVVRGMTCASCVHKIESSLTKHRGILYCSVALATNKAHIKYDPEIIGPRDIIHTIESLGFEPSLVKIE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 ASP n 1 4 GLY n 1 5 VAL n 1 6 LEU n 1 7 GLU n 1 8 LEU n 1 9 VAL n 1 10 VAL n 1 11 ARG n 1 12 GLY n 1 13 MET n 1 14 THR n 1 15 CYS n 1 16 ALA n 1 17 SER n 1 18 CYS n 1 19 VAL n 1 20 HIS n 1 21 LYS n 1 22 ILE n 1 23 GLU n 1 24 SER n 1 25 SER n 1 26 LEU n 1 27 THR n 1 28 LYS n 1 29 HIS n 1 30 ARG n 1 31 GLY n 1 32 ILE n 1 33 LEU n 1 34 TYR n 1 35 CYS n 1 36 SER n 1 37 VAL n 1 38 ALA n 1 39 LEU n 1 40 ALA n 1 41 THR n 1 42 ASN n 1 43 LYS n 1 44 ALA n 1 45 HIS n 1 46 ILE n 1 47 LYS n 1 48 TYR n 1 49 ASP n 1 50 PRO n 1 51 GLU n 1 52 ILE n 1 53 ILE n 1 54 GLY n 1 55 PRO n 1 56 ARG n 1 57 ASP n 1 58 ILE n 1 59 ILE n 1 60 HIS n 1 61 THR n 1 62 ILE n 1 63 GLU n 1 64 SER n 1 65 LEU n 1 66 GLY n 1 67 PHE n 1 68 GLU n 1 69 PRO n 1 70 SER n 1 71 LEU n 1 72 VAL n 1 73 LYS n 1 74 ILE n 1 75 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ATP7A _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pLysS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET20b+ _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ATP7A_HUMAN _struct_ref.pdbx_db_accession Q04656 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GDGVLELVVRGMTCASCVHKIESSLTKHRGILYCSVALATNKAHIKYDPEIIGPRDIIHTIESLGFEASLVK _struct_ref.pdbx_align_begin 562 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1YJT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 73 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q04656 _struct_ref_seq.db_align_beg 562 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 633 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 73 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1YJT MET A 1 ? UNP Q04656 ? ? 'cloning artifact' 1 1 1 1YJT PRO A 69 ? UNP Q04656 ALA 629 'engineered mutation' 69 2 1 1YJT ILE A 74 ? UNP Q04656 ? ? 'cloning artifact' 74 3 1 1YJT GLU A 75 ? UNP Q04656 ? ? 'cloning artifact' 75 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CU1 non-polymer . 'COPPER (I) ION' ? 'Cu 1' 63.546 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 2 'CBCANH; CBCACONH; HNCO; HNCACO' 2 3 3 '2D NOESY' 3 4 3 '2D TOCSY' 3 5 1 HNHA 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100mM phosphate buffer' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '0.8mM 15N labeled sample; 5mM DTT; 100mM phosphate buffer' '90% H2O/10% D2O' 2 '0.8mM 15N 13C labeled sample; 5mM DTT; 100mM phosphate buffer' '90% H2O/10% D2O' 3 '1.0mM unlabeled sample; 5mM DTT; 100mM phosphate buffer' '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AVANCE Bruker 900 ? 2 AVANCE Bruker 500 ? # _pdbx_nmr_refine.entry_id 1YJT _pdbx_nmr_refine.method 'torsion angle dynamics coupled with simulated annealing followed by restrained energy minimization' _pdbx_nmr_refine.details 'the structures were based on a total of 1901 meaningful distance constraints, 81 dihedral angle restraints' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1YJT _pdbx_nmr_ensemble.conformers_calculated_total_number 300 _pdbx_nmr_ensemble.conformers_submitted_total_number 30 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1YJT _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR ? ? 1 'data analysis' CARA 1.2 ? 2 'structure solution' DYANA 1.5 ? 3 refinement Amber 5.0 ? 4 # _exptl.entry_id 1YJT _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1YJT _struct.title 'Solution structure of the Cu(I) form of the sixth soluble domain A69P mutant of Menkes protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1YJT _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'metallochaperone, protein-protein interaction, copper(I), metal homeostasis, hydrolase' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 15 ? THR A 27 ? CYS A 15 THR A 27 1 ? 13 HELX_P HELX_P2 2 GLY A 54 ? SER A 64 ? GLY A 54 SER A 64 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 15 SG ? ? ? 1_555 B CU1 . CU ? ? A CYS 15 A CU1 76 1_555 ? ? ? ? ? ? ? 2.151 ? ? metalc2 metalc ? ? A CYS 18 SG ? ? ? 1_555 B CU1 . CU ? ? A CYS 18 A CU1 76 1_555 ? ? ? ? ? ? ? 2.151 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 32 ? ALA A 38 ? ILE A 32 ALA A 38 A 2 LYS A 43 ? TYR A 48 ? LYS A 43 TYR A 48 A 3 LEU A 6 ? ARG A 11 ? LEU A 6 ARG A 11 A 4 GLU A 68 ? LEU A 71 ? GLU A 68 LEU A 71 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 34 ? N TYR A 34 O LYS A 47 ? O LYS A 47 A 2 3 O ALA A 44 ? O ALA A 44 N LEU A 8 ? N LEU A 8 A 3 4 N VAL A 9 ? N VAL A 9 O SER A 70 ? O SER A 70 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CU1 _struct_site.pdbx_auth_seq_id 76 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 2 _struct_site.details 'BINDING SITE FOR RESIDUE CU1 A 76' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 CYS A 15 ? CYS A 15 . ? 1_555 ? 2 AC1 2 CYS A 18 ? CYS A 18 . ? 1_555 ? # _database_PDB_matrix.entry_id 1YJT _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1YJT _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CU H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 GLU 75 75 75 GLU GLU A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id CU1 _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 76 _pdbx_nonpoly_scheme.auth_seq_num 76 _pdbx_nonpoly_scheme.pdb_mon_id CU1 _pdbx_nonpoly_scheme.auth_mon_id CU _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_conn_angle.id 1 _pdbx_struct_conn_angle.ptnr1_label_atom_id SG _pdbx_struct_conn_angle.ptnr1_label_alt_id ? _pdbx_struct_conn_angle.ptnr1_label_asym_id A _pdbx_struct_conn_angle.ptnr1_label_comp_id CYS _pdbx_struct_conn_angle.ptnr1_label_seq_id 15 _pdbx_struct_conn_angle.ptnr1_auth_atom_id ? _pdbx_struct_conn_angle.ptnr1_auth_asym_id A _pdbx_struct_conn_angle.ptnr1_auth_comp_id CYS _pdbx_struct_conn_angle.ptnr1_auth_seq_id 15 _pdbx_struct_conn_angle.ptnr1_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr1_symmetry 1_555 _pdbx_struct_conn_angle.ptnr2_label_atom_id CU _pdbx_struct_conn_angle.ptnr2_label_alt_id ? _pdbx_struct_conn_angle.ptnr2_label_asym_id B _pdbx_struct_conn_angle.ptnr2_label_comp_id CU1 _pdbx_struct_conn_angle.ptnr2_label_seq_id . _pdbx_struct_conn_angle.ptnr2_auth_atom_id ? _pdbx_struct_conn_angle.ptnr2_auth_asym_id A _pdbx_struct_conn_angle.ptnr2_auth_comp_id CU1 _pdbx_struct_conn_angle.ptnr2_auth_seq_id 76 _pdbx_struct_conn_angle.ptnr2_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr2_symmetry 1_555 _pdbx_struct_conn_angle.ptnr3_label_atom_id SG _pdbx_struct_conn_angle.ptnr3_label_alt_id ? _pdbx_struct_conn_angle.ptnr3_label_asym_id A _pdbx_struct_conn_angle.ptnr3_label_comp_id CYS _pdbx_struct_conn_angle.ptnr3_label_seq_id 18 _pdbx_struct_conn_angle.ptnr3_auth_atom_id ? _pdbx_struct_conn_angle.ptnr3_auth_asym_id A _pdbx_struct_conn_angle.ptnr3_auth_comp_id CYS _pdbx_struct_conn_angle.ptnr3_auth_seq_id 18 _pdbx_struct_conn_angle.ptnr3_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr3_symmetry 1_555 _pdbx_struct_conn_angle.value 156.7 _pdbx_struct_conn_angle.value_esd ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-01-03 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 10 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 12 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 16 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 17 4 'Structure model' '_struct_ref_seq_dif.details' 18 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 19 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 20 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 21 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 GLU _pdbx_validate_rmsd_angle.auth_seq_id_1 75 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 C _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 GLU _pdbx_validate_rmsd_angle.auth_seq_id_2 75 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 O _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 GLU _pdbx_validate_rmsd_angle.auth_seq_id_3 75 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 80.72 _pdbx_validate_rmsd_angle.angle_target_value 120.10 _pdbx_validate_rmsd_angle.angle_deviation -39.38 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.10 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 14 ? ? -157.84 25.46 2 1 THR A 27 ? ? -68.06 72.75 3 1 LYS A 28 ? ? -171.83 -38.88 4 1 ASN A 42 ? ? 35.06 54.99 5 1 PRO A 50 ? ? -81.48 48.70 6 1 GLU A 51 ? ? -137.29 -63.09 7 1 VAL A 72 ? ? -140.40 -52.97 8 1 LYS A 73 ? ? 57.42 81.17 9 1 ILE A 74 ? ? -73.84 -84.62 10 2 ASP A 3 ? ? 61.64 170.71 11 2 THR A 14 ? ? -153.34 22.30 12 2 THR A 27 ? ? -65.49 72.12 13 2 LYS A 28 ? ? -150.52 -43.58 14 2 ARG A 30 ? ? 131.36 -82.12 15 2 ASN A 42 ? ? 33.73 54.99 16 2 PRO A 50 ? ? -77.84 41.26 17 2 ILE A 52 ? ? -132.12 -54.46 18 2 PRO A 69 ? ? -68.82 80.79 19 2 LEU A 71 ? ? -68.50 64.16 20 2 LYS A 73 ? ? 68.27 136.07 21 3 ASP A 3 ? ? 52.78 -143.20 22 3 GLU A 51 ? ? -135.16 -68.63 23 3 VAL A 72 ? ? -102.71 57.73 24 3 LYS A 73 ? ? 45.55 -137.33 25 4 THR A 14 ? ? -152.81 41.91 26 4 HIS A 29 ? ? -68.48 87.08 27 4 ARG A 30 ? ? 23.27 -66.21 28 4 PRO A 50 ? ? -80.63 47.56 29 4 GLU A 51 ? ? -134.16 -63.90 30 4 VAL A 72 ? ? -81.28 -76.70 31 4 LYS A 73 ? ? 67.62 150.31 32 5 ASP A 3 ? ? 35.01 75.16 33 5 THR A 14 ? ? -155.22 11.62 34 5 LYS A 28 ? ? -169.91 -38.03 35 5 ASN A 42 ? ? 79.24 41.81 36 5 GLU A 51 ? ? -159.99 25.66 37 5 ILE A 52 ? ? -167.17 -50.70 38 5 VAL A 72 ? ? -141.81 -43.36 39 5 LYS A 73 ? ? 42.83 -123.90 40 5 ILE A 74 ? ? -91.49 -71.20 41 6 ASP A 3 ? ? 63.00 162.89 42 6 VAL A 5 ? ? -153.98 61.86 43 6 THR A 14 ? ? -155.10 10.85 44 6 THR A 27 ? ? -66.81 75.84 45 6 LYS A 28 ? ? 179.64 -40.02 46 6 ASN A 42 ? ? 34.78 47.02 47 6 LYS A 73 ? ? 57.67 -160.43 48 7 ASP A 3 ? ? 174.80 173.73 49 7 LYS A 28 ? ? -162.69 -30.83 50 7 ARG A 30 ? ? 139.59 -85.60 51 7 ILE A 52 ? ? -123.62 -59.33 52 7 LEU A 71 ? ? -67.22 59.72 53 7 LYS A 73 ? ? -163.28 106.82 54 7 ILE A 74 ? ? -86.74 -140.75 55 8 THR A 14 ? ? -156.53 12.80 56 8 LYS A 28 ? ? -156.00 -49.53 57 8 CYS A 35 ? ? -144.22 56.80 58 8 PRO A 50 ? ? -81.86 48.29 59 8 GLU A 51 ? ? -138.15 -64.11 60 8 ILE A 74 ? ? 68.42 -72.05 61 9 THR A 27 ? ? -69.65 72.18 62 9 LYS A 28 ? ? -176.17 -35.07 63 9 ASN A 42 ? ? 37.31 51.21 64 9 GLU A 51 ? ? -151.60 -92.88 65 9 LEU A 71 ? ? -48.87 102.74 66 9 LYS A 73 ? ? 61.44 -163.59 67 9 ILE A 74 ? ? -164.11 74.65 68 10 MET A 13 ? ? -65.79 94.68 69 10 LYS A 28 ? ? -165.93 -36.22 70 10 LEU A 71 ? ? -68.06 70.97 71 10 VAL A 72 ? ? -71.15 -135.09 72 10 LYS A 73 ? ? -138.99 -60.06 73 10 ILE A 74 ? ? -146.38 -50.92 74 11 ASP A 3 ? ? -48.50 107.07 75 11 THR A 14 ? ? -152.19 -45.54 76 11 THR A 27 ? ? -69.64 67.98 77 11 LYS A 28 ? ? 178.16 -35.12 78 11 ASN A 42 ? ? 27.00 62.04 79 11 ILE A 52 ? ? -129.82 -60.08 80 11 VAL A 72 ? ? -101.63 55.53 81 11 LYS A 73 ? ? -39.46 110.96 82 11 ILE A 74 ? ? 73.26 108.92 83 12 ASP A 3 ? ? 71.68 161.22 84 12 LYS A 28 ? ? -147.90 -51.78 85 12 THR A 41 ? ? -141.62 36.47 86 12 ASN A 42 ? ? 33.90 56.71 87 12 GLU A 51 ? ? -138.39 -72.47 88 12 LYS A 73 ? ? 65.98 147.07 89 13 ASP A 3 ? ? -80.84 -123.28 90 13 THR A 27 ? ? -62.63 80.47 91 13 LYS A 28 ? ? 176.70 -34.57 92 13 ALA A 40 ? ? -37.25 -39.69 93 13 THR A 41 ? ? -143.29 34.96 94 13 ASP A 49 ? ? -59.64 107.32 95 13 PRO A 50 ? ? -82.44 45.57 96 13 GLU A 51 ? ? -139.31 -60.29 97 13 VAL A 72 ? ? -118.82 60.95 98 14 THR A 14 ? ? -140.65 -34.97 99 14 ARG A 30 ? ? -61.23 82.87 100 14 PRO A 50 ? ? -78.62 49.43 101 14 GLU A 51 ? ? -127.70 -63.52 102 14 LYS A 73 ? ? 64.69 -177.21 103 14 ILE A 74 ? ? -160.21 -43.53 104 15 THR A 14 ? ? -136.09 -65.64 105 15 LYS A 28 ? ? -164.58 -44.30 106 15 ARG A 30 ? ? -66.82 0.51 107 15 ASN A 42 ? ? 35.99 46.78 108 15 GLU A 51 ? ? -144.93 -83.72 109 15 LEU A 71 ? ? -69.40 65.18 110 15 LYS A 73 ? ? 66.92 97.96 111 16 THR A 14 ? ? -139.97 -37.60 112 16 ASN A 42 ? ? 79.55 43.12 113 16 GLU A 51 ? ? -125.34 -71.92 114 17 ASP A 3 ? ? 72.35 166.06 115 17 LYS A 28 ? ? -175.38 -35.08 116 17 ASN A 42 ? ? 35.68 48.28 117 17 LEU A 71 ? ? -59.98 107.34 118 17 ILE A 74 ? ? 63.06 -73.62 119 18 VAL A 10 ? ? -106.59 74.81 120 18 THR A 14 ? ? -148.16 -1.60 121 18 ILE A 22 ? ? -71.82 -80.42 122 18 THR A 27 ? ? -67.13 64.01 123 18 LYS A 28 ? ? -160.05 -50.02 124 18 ASP A 49 ? ? -59.20 106.50 125 18 GLU A 51 ? ? -163.98 -60.47 126 18 VAL A 72 ? ? -131.89 -33.89 127 18 ILE A 74 ? ? 73.67 128.88 128 19 ASP A 3 ? ? -179.83 -162.34 129 19 THR A 14 ? ? -139.33 -39.21 130 19 HIS A 29 ? ? -69.84 96.67 131 19 THR A 41 ? ? -140.83 37.87 132 19 ASN A 42 ? ? 35.45 58.84 133 19 GLU A 51 ? ? -139.68 -92.66 134 20 THR A 14 ? ? -157.28 14.80 135 20 THR A 41 ? ? -140.96 35.68 136 20 ASN A 42 ? ? 36.06 57.36 137 20 GLU A 51 ? ? -143.13 -63.75 138 20 VAL A 72 ? ? -106.56 51.96 139 21 THR A 14 ? ? -145.09 -37.41 140 21 GLU A 51 ? ? -78.07 37.27 141 21 ILE A 52 ? ? -132.63 -52.63 142 22 ASP A 3 ? ? 175.46 172.74 143 22 THR A 14 ? ? -154.84 25.08 144 22 ILE A 52 ? ? -120.07 -54.52 145 22 LEU A 71 ? ? -66.10 57.44 146 23 THR A 14 ? ? -154.31 35.82 147 23 LEU A 33 ? ? -135.87 -30.04 148 23 GLU A 51 ? ? -142.52 -64.31 149 23 LYS A 73 ? ? 58.39 -94.13 150 24 THR A 14 ? ? -150.75 -10.93 151 24 ASN A 42 ? ? 76.20 30.91 152 24 PRO A 50 ? ? -79.25 49.68 153 24 GLU A 51 ? ? -152.96 27.24 154 24 ILE A 52 ? ? -153.78 -51.46 155 24 VAL A 72 ? ? -93.30 -66.95 156 24 LYS A 73 ? ? -175.52 132.09 157 25 ASP A 3 ? ? 178.38 163.94 158 25 THR A 14 ? ? -140.54 -2.76 159 25 ILE A 22 ? ? -70.39 -71.46 160 25 THR A 27 ? ? -65.25 71.48 161 25 LYS A 28 ? ? -169.83 -31.09 162 25 ASN A 42 ? ? 37.13 55.64 163 25 PRO A 50 ? ? -79.41 40.21 164 25 ILE A 52 ? ? -133.63 -51.09 165 26 LYS A 28 ? ? -146.81 -49.81 166 26 ARG A 30 ? ? -61.78 90.43 167 26 ASN A 42 ? ? 34.10 46.21 168 26 PRO A 50 ? ? -75.19 27.26 169 26 GLU A 51 ? ? -135.55 -34.75 170 26 LYS A 73 ? ? 57.35 -122.01 171 26 ILE A 74 ? ? -141.61 -59.71 172 27 ASP A 3 ? ? 65.27 -112.93 173 27 THR A 14 ? ? -154.38 17.87 174 27 LYS A 28 ? ? -169.90 -30.89 175 28 THR A 14 ? ? -140.47 -6.54 176 28 THR A 27 ? ? -66.89 78.28 177 28 LYS A 28 ? ? 174.76 -37.08 178 28 ILE A 52 ? ? -137.06 -46.15 179 28 ILE A 74 ? ? 59.15 174.61 180 29 THR A 14 ? ? -152.34 1.15 181 29 LYS A 28 ? ? -153.78 -50.33 182 29 ASN A 42 ? ? 31.22 64.19 183 29 GLU A 51 ? ? -156.74 -74.35 184 29 LYS A 73 ? ? -162.94 -165.65 185 29 ILE A 74 ? ? 76.18 -55.72 186 30 VAL A 10 ? ? -106.31 67.53 187 30 THR A 14 ? ? -156.75 19.05 188 30 THR A 27 ? ? -64.13 74.65 189 30 LYS A 28 ? ? -174.88 -40.13 190 30 GLU A 51 ? ? -162.18 -79.07 191 30 VAL A 72 ? ? -131.75 -51.12 192 30 LYS A 73 ? ? 56.73 -138.68 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 CYS A 35 ? ? SER A 36 ? ? 140.33 2 2 MET A 1 ? ? GLY A 2 ? ? -136.35 3 3 CYS A 35 ? ? SER A 36 ? ? 144.76 4 4 HIS A 29 ? ? ARG A 30 ? ? 145.39 5 5 CYS A 35 ? ? SER A 36 ? ? 142.04 6 8 LYS A 43 ? ? ALA A 44 ? ? 147.94 7 8 ALA A 44 ? ? HIS A 45 ? ? 148.79 8 10 ILE A 74 ? ? GLU A 75 ? ? 137.40 9 16 CYS A 35 ? ? SER A 36 ? ? 144.34 10 17 MET A 1 ? ? GLY A 2 ? ? 136.37 11 17 CYS A 35 ? ? SER A 36 ? ? 142.87 12 20 CYS A 35 ? ? SER A 36 ? ? 139.42 13 22 MET A 1 ? ? GLY A 2 ? ? 131.59 14 24 MET A 1 ? ? GLY A 2 ? ? 141.00 15 26 ILE A 74 ? ? GLU A 75 ? ? 135.79 16 29 CYS A 35 ? ? SER A 36 ? ? 141.83 17 30 ALA A 44 ? ? HIS A 45 ? ? 149.47 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 2 ARG A 11 ? ? 0.109 'SIDE CHAIN' 2 2 TYR A 34 ? ? 0.147 'SIDE CHAIN' 3 2 TYR A 48 ? ? 0.096 'SIDE CHAIN' 4 3 ARG A 11 ? ? 0.083 'SIDE CHAIN' 5 3 HIS A 29 ? ? 0.089 'SIDE CHAIN' 6 3 TYR A 48 ? ? 0.095 'SIDE CHAIN' 7 4 ARG A 30 ? ? 0.118 'SIDE CHAIN' 8 5 ARG A 11 ? ? 0.137 'SIDE CHAIN' 9 5 TYR A 48 ? ? 0.080 'SIDE CHAIN' 10 6 HIS A 45 ? ? 0.081 'SIDE CHAIN' 11 6 TYR A 48 ? ? 0.070 'SIDE CHAIN' 12 7 TYR A 48 ? ? 0.132 'SIDE CHAIN' 13 8 ARG A 11 ? ? 0.098 'SIDE CHAIN' 14 8 ARG A 56 ? ? 0.101 'SIDE CHAIN' 15 11 ARG A 56 ? ? 0.094 'SIDE CHAIN' 16 12 TYR A 34 ? ? 0.069 'SIDE CHAIN' 17 13 HIS A 29 ? ? 0.089 'SIDE CHAIN' 18 14 HIS A 45 ? ? 0.103 'SIDE CHAIN' 19 14 TYR A 48 ? ? 0.124 'SIDE CHAIN' 20 15 HIS A 45 ? ? 0.107 'SIDE CHAIN' 21 15 ARG A 56 ? ? 0.123 'SIDE CHAIN' 22 17 TYR A 48 ? ? 0.172 'SIDE CHAIN' 23 17 ARG A 56 ? ? 0.127 'SIDE CHAIN' 24 18 ARG A 11 ? ? 0.104 'SIDE CHAIN' 25 19 HIS A 45 ? ? 0.092 'SIDE CHAIN' 26 19 TYR A 48 ? ? 0.096 'SIDE CHAIN' 27 20 HIS A 45 ? ? 0.103 'SIDE CHAIN' 28 20 TYR A 48 ? ? 0.065 'SIDE CHAIN' 29 21 ARG A 11 ? ? 0.079 'SIDE CHAIN' 30 21 TYR A 48 ? ? 0.085 'SIDE CHAIN' 31 22 ARG A 56 ? ? 0.153 'SIDE CHAIN' 32 23 ARG A 30 ? ? 0.080 'SIDE CHAIN' 33 23 TYR A 48 ? ? 0.197 'SIDE CHAIN' 34 24 HIS A 29 ? ? 0.089 'SIDE CHAIN' 35 24 TYR A 34 ? ? 0.122 'SIDE CHAIN' 36 24 HIS A 45 ? ? 0.102 'SIDE CHAIN' 37 27 TYR A 48 ? ? 0.077 'SIDE CHAIN' 38 28 TYR A 48 ? ? 0.089 'SIDE CHAIN' 39 29 ARG A 56 ? ? 0.105 'SIDE CHAIN' 40 30 TYR A 34 ? ? 0.079 'SIDE CHAIN' 41 30 TYR A 48 ? ? 0.065 'SIDE CHAIN' # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'COPPER (I) ION' _pdbx_entity_nonpoly.comp_id CU1 #