data_1YJT
# 
_entry.id   1YJT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.392 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1YJT         pdb_00001yjt 10.2210/pdb1yjt/pdb 
RCSB  RCSB031594   ?            ?                   
WWPDB D_1000031594 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-01-03 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-11-10 
5 'Structure model' 1 4 2024-05-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
6 5 'Structure model' 'Data collection'           
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' database_2            
2  4 'Structure model' pdbx_nmr_software     
3  4 'Structure model' pdbx_nmr_spectrometer 
4  4 'Structure model' pdbx_struct_assembly  
5  4 'Structure model' pdbx_struct_oper_list 
6  4 'Structure model' struct_conn           
7  4 'Structure model' struct_ref_seq_dif    
8  4 'Structure model' struct_site           
9  5 'Structure model' chem_comp_atom        
10 5 'Structure model' chem_comp_bond        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_database_2.pdbx_DOI'                
2  4 'Structure model' '_database_2.pdbx_database_accession' 
3  4 'Structure model' '_pdbx_nmr_software.name'             
4  4 'Structure model' '_pdbx_nmr_spectrometer.model'        
5  4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'     
6  4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'      
7  4 'Structure model' '_struct_conn.ptnr1_label_asym_id'    
8  4 'Structure model' '_struct_conn.ptnr1_label_atom_id'    
9  4 'Structure model' '_struct_conn.ptnr1_label_comp_id'    
10 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'     
11 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'     
12 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'      
13 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'    
14 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'    
15 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'    
16 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'     
17 4 'Structure model' '_struct_ref_seq_dif.details'         
18 4 'Structure model' '_struct_site.pdbx_auth_asym_id'      
19 4 'Structure model' '_struct_site.pdbx_auth_comp_id'      
20 4 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1YJT 
_pdbx_database_status.recvd_initial_deposition_date   2005-01-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1YJR 'the apo form of the same protein, A69P mutant' unspecified 
PDB 1YJU 'the apo form of the same protein'              unspecified 
PDB 1YJV 'the Cu(I) form of the same protein'            unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Banci, L.'     1 
'Bertini, I.'   2 
'Cantini, F.'   3 
'Migliardi, M.' 4 
'Rosato, A.'    5 
'Wang, S.'      6 
# 
_citation.id                        primary 
_citation.title                     
'An atomic-level investigation of the disease-causing A629P mutant of the Menkes protein, ATP7A' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            352 
_citation.page_first                409 
_citation.page_last                 417 
_citation.year                      2005 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16083905 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2005.07.034 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Banci, L.'     1 ? 
primary 'Bertini, I.'   2 ? 
primary 'Cantini, F.'   3 ? 
primary 'Migliardi, M.' 4 ? 
primary 'Rosato, A.'    5 ? 
primary 'Wang, S.'      6 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Copper-transporting ATPase 1' 8217.630 1 3.6.3.4 A69P 'Sixth soluble domain' ? 
2 non-polymer syn 'COPPER (I) ION'               63.546   1 ?       ?    ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Copper pump 1, Menkes disease-associated protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MGDGVLELVVRGMTCASCVHKIESSLTKHRGILYCSVALATNKAHIKYDPEIIGPRDIIHTIESLGFEPSLVKIE 
_entity_poly.pdbx_seq_one_letter_code_can   MGDGVLELVVRGMTCASCVHKIESSLTKHRGILYCSVALATNKAHIKYDPEIIGPRDIIHTIESLGFEPSLVKIE 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        'COPPER (I) ION' 
_pdbx_entity_nonpoly.comp_id     CU1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  GLY n 
1 3  ASP n 
1 4  GLY n 
1 5  VAL n 
1 6  LEU n 
1 7  GLU n 
1 8  LEU n 
1 9  VAL n 
1 10 VAL n 
1 11 ARG n 
1 12 GLY n 
1 13 MET n 
1 14 THR n 
1 15 CYS n 
1 16 ALA n 
1 17 SER n 
1 18 CYS n 
1 19 VAL n 
1 20 HIS n 
1 21 LYS n 
1 22 ILE n 
1 23 GLU n 
1 24 SER n 
1 25 SER n 
1 26 LEU n 
1 27 THR n 
1 28 LYS n 
1 29 HIS n 
1 30 ARG n 
1 31 GLY n 
1 32 ILE n 
1 33 LEU n 
1 34 TYR n 
1 35 CYS n 
1 36 SER n 
1 37 VAL n 
1 38 ALA n 
1 39 LEU n 
1 40 ALA n 
1 41 THR n 
1 42 ASN n 
1 43 LYS n 
1 44 ALA n 
1 45 HIS n 
1 46 ILE n 
1 47 LYS n 
1 48 TYR n 
1 49 ASP n 
1 50 PRO n 
1 51 GLU n 
1 52 ILE n 
1 53 ILE n 
1 54 GLY n 
1 55 PRO n 
1 56 ARG n 
1 57 ASP n 
1 58 ILE n 
1 59 ILE n 
1 60 HIS n 
1 61 THR n 
1 62 ILE n 
1 63 GLU n 
1 64 SER n 
1 65 LEU n 
1 66 GLY n 
1 67 PHE n 
1 68 GLU n 
1 69 PRO n 
1 70 SER n 
1 71 LEU n 
1 72 VAL n 
1 73 LYS n 
1 74 ILE n 
1 75 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ATP7A 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET20b+ 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ? 'C4 H7 N O4'     133.103 
CU1 non-polymer         . 'COPPER (I) ION' ? 'Cu 1'           63.546  
CYS 'L-peptide linking' y CYSTEINE         ? 'C3 H7 N O2 S'   121.158 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  1  1  MET MET A . n 
A 1 2  GLY 2  2  2  GLY GLY A . n 
A 1 3  ASP 3  3  3  ASP ASP A . n 
A 1 4  GLY 4  4  4  GLY GLY A . n 
A 1 5  VAL 5  5  5  VAL VAL A . n 
A 1 6  LEU 6  6  6  LEU LEU A . n 
A 1 7  GLU 7  7  7  GLU GLU A . n 
A 1 8  LEU 8  8  8  LEU LEU A . n 
A 1 9  VAL 9  9  9  VAL VAL A . n 
A 1 10 VAL 10 10 10 VAL VAL A . n 
A 1 11 ARG 11 11 11 ARG ARG A . n 
A 1 12 GLY 12 12 12 GLY GLY A . n 
A 1 13 MET 13 13 13 MET MET A . n 
A 1 14 THR 14 14 14 THR THR A . n 
A 1 15 CYS 15 15 15 CYS CYS A . n 
A 1 16 ALA 16 16 16 ALA ALA A . n 
A 1 17 SER 17 17 17 SER SER A . n 
A 1 18 CYS 18 18 18 CYS CYS A . n 
A 1 19 VAL 19 19 19 VAL VAL A . n 
A 1 20 HIS 20 20 20 HIS HIS A . n 
A 1 21 LYS 21 21 21 LYS LYS A . n 
A 1 22 ILE 22 22 22 ILE ILE A . n 
A 1 23 GLU 23 23 23 GLU GLU A . n 
A 1 24 SER 24 24 24 SER SER A . n 
A 1 25 SER 25 25 25 SER SER A . n 
A 1 26 LEU 26 26 26 LEU LEU A . n 
A 1 27 THR 27 27 27 THR THR A . n 
A 1 28 LYS 28 28 28 LYS LYS A . n 
A 1 29 HIS 29 29 29 HIS HIS A . n 
A 1 30 ARG 30 30 30 ARG ARG A . n 
A 1 31 GLY 31 31 31 GLY GLY A . n 
A 1 32 ILE 32 32 32 ILE ILE A . n 
A 1 33 LEU 33 33 33 LEU LEU A . n 
A 1 34 TYR 34 34 34 TYR TYR A . n 
A 1 35 CYS 35 35 35 CYS CYS A . n 
A 1 36 SER 36 36 36 SER SER A . n 
A 1 37 VAL 37 37 37 VAL VAL A . n 
A 1 38 ALA 38 38 38 ALA ALA A . n 
A 1 39 LEU 39 39 39 LEU LEU A . n 
A 1 40 ALA 40 40 40 ALA ALA A . n 
A 1 41 THR 41 41 41 THR THR A . n 
A 1 42 ASN 42 42 42 ASN ASN A . n 
A 1 43 LYS 43 43 43 LYS LYS A . n 
A 1 44 ALA 44 44 44 ALA ALA A . n 
A 1 45 HIS 45 45 45 HIS HIS A . n 
A 1 46 ILE 46 46 46 ILE ILE A . n 
A 1 47 LYS 47 47 47 LYS LYS A . n 
A 1 48 TYR 48 48 48 TYR TYR A . n 
A 1 49 ASP 49 49 49 ASP ASP A . n 
A 1 50 PRO 50 50 50 PRO PRO A . n 
A 1 51 GLU 51 51 51 GLU GLU A . n 
A 1 52 ILE 52 52 52 ILE ILE A . n 
A 1 53 ILE 53 53 53 ILE ILE A . n 
A 1 54 GLY 54 54 54 GLY GLY A . n 
A 1 55 PRO 55 55 55 PRO PRO A . n 
A 1 56 ARG 56 56 56 ARG ARG A . n 
A 1 57 ASP 57 57 57 ASP ASP A . n 
A 1 58 ILE 58 58 58 ILE ILE A . n 
A 1 59 ILE 59 59 59 ILE ILE A . n 
A 1 60 HIS 60 60 60 HIS HIS A . n 
A 1 61 THR 61 61 61 THR THR A . n 
A 1 62 ILE 62 62 62 ILE ILE A . n 
A 1 63 GLU 63 63 63 GLU GLU A . n 
A 1 64 SER 64 64 64 SER SER A . n 
A 1 65 LEU 65 65 65 LEU LEU A . n 
A 1 66 GLY 66 66 66 GLY GLY A . n 
A 1 67 PHE 67 67 67 PHE PHE A . n 
A 1 68 GLU 68 68 68 GLU GLU A . n 
A 1 69 PRO 69 69 69 PRO PRO A . n 
A 1 70 SER 70 70 70 SER SER A . n 
A 1 71 LEU 71 71 71 LEU LEU A . n 
A 1 72 VAL 72 72 72 VAL VAL A . n 
A 1 73 LYS 73 73 73 LYS LYS A . n 
A 1 74 ILE 74 74 74 ILE ILE A . n 
A 1 75 GLU 75 75 75 GLU GLU A . n 
# 
_pdbx_nonpoly_scheme.asym_id         B 
_pdbx_nonpoly_scheme.entity_id       2 
_pdbx_nonpoly_scheme.mon_id          CU1 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     76 
_pdbx_nonpoly_scheme.auth_seq_num    76 
_pdbx_nonpoly_scheme.pdb_mon_id      CU1 
_pdbx_nonpoly_scheme.auth_mon_id     CU 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
_exptl.entry_id          1YJT 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_database_PDB_matrix.entry_id          1YJT 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  1YJT 
_struct.title                     'Solution structure of the Cu(I) form of the sixth soluble domain A69P mutant of Menkes protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1YJT 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'metallochaperone, protein-protein interaction, copper(I), metal homeostasis, hydrolase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ATP7A_HUMAN 
_struct_ref.pdbx_db_accession          Q04656 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   GDGVLELVVRGMTCASCVHKIESSLTKHRGILYCSVALATNKAHIKYDPEIIGPRDIIHTIESLGFEASLVK 
_struct_ref.pdbx_align_begin           562 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1YJT 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 73 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q04656 
_struct_ref_seq.db_align_beg                  562 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  633 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       73 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1YJT MET A 1  ? UNP Q04656 ?   ?   'cloning artifact'    1  1 
1 1YJT PRO A 69 ? UNP Q04656 ALA 629 'engineered mutation' 69 2 
1 1YJT ILE A 74 ? UNP Q04656 ?   ?   'cloning artifact'    74 3 
1 1YJT GLU A 75 ? UNP Q04656 ?   ?   'cloning artifact'    75 4 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 CYS A 15 ? THR A 27 ? CYS A 15 THR A 27 1 ? 13 
HELX_P HELX_P2 2 GLY A 54 ? SER A 64 ? GLY A 54 SER A 64 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? A CYS 15 SG ? ? ? 1_555 B CU1 . CU ? ? A CYS 15 A CU1 76 1_555 ? ? ? ? ? ? ? 2.151 ? ? 
metalc2 metalc ? ? A CYS 18 SG ? ? ? 1_555 B CU1 . CU ? ? A CYS 18 A CU1 76 1_555 ? ? ? ? ? ? ? 2.151 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_pdbx_struct_conn_angle.id                    1 
_pdbx_struct_conn_angle.ptnr1_label_atom_id   SG 
_pdbx_struct_conn_angle.ptnr1_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr1_label_asym_id   A 
_pdbx_struct_conn_angle.ptnr1_label_comp_id   CYS 
_pdbx_struct_conn_angle.ptnr1_label_seq_id    15 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id    CYS 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id     15 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr1_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr2_label_atom_id   CU 
_pdbx_struct_conn_angle.ptnr2_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr2_label_asym_id   B 
_pdbx_struct_conn_angle.ptnr2_label_comp_id   CU1 
_pdbx_struct_conn_angle.ptnr2_label_seq_id    . 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id    CU1 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id     76 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr2_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr3_label_atom_id   SG 
_pdbx_struct_conn_angle.ptnr3_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr3_label_asym_id   A 
_pdbx_struct_conn_angle.ptnr3_label_comp_id   CYS 
_pdbx_struct_conn_angle.ptnr3_label_seq_id    18 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id    CYS 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id     18 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr3_symmetry        1_555 
_pdbx_struct_conn_angle.value                 156.7 
_pdbx_struct_conn_angle.value_esd             ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 32 ? ALA A 38 ? ILE A 32 ALA A 38 
A 2 LYS A 43 ? TYR A 48 ? LYS A 43 TYR A 48 
A 3 LEU A 6  ? ARG A 11 ? LEU A 6  ARG A 11 
A 4 GLU A 68 ? LEU A 71 ? GLU A 68 LEU A 71 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR A 34 ? N TYR A 34 O LYS A 47 ? O LYS A 47 
A 2 3 O ALA A 44 ? O ALA A 44 N LEU A 8  ? N LEU A 8  
A 3 4 N VAL A 9  ? N VAL A 9  O SER A 70 ? O SER A 70 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    CU1 
_struct_site.pdbx_auth_seq_id     76 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    2 
_struct_site.details              'BINDING SITE FOR RESIDUE CU1 A 76' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 2 CYS A 15 ? CYS A 15 . ? 1_555 ? 
2 AC1 2 CYS A 18 ? CYS A 18 . ? 1_555 ? 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              21 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             GLU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              75 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             C 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             GLU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              75 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             O 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             GLU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              75 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                80.72 
_pdbx_validate_rmsd_angle.angle_target_value         120.10 
_pdbx_validate_rmsd_angle.angle_deviation            -39.38 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.10 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  THR A 14 ? ? -157.84 25.46   
2   1  THR A 27 ? ? -68.06  72.75   
3   1  LYS A 28 ? ? -171.83 -38.88  
4   1  ASN A 42 ? ? 35.06   54.99   
5   1  PRO A 50 ? ? -81.48  48.70   
6   1  GLU A 51 ? ? -137.29 -63.09  
7   1  VAL A 72 ? ? -140.40 -52.97  
8   1  LYS A 73 ? ? 57.42   81.17   
9   1  ILE A 74 ? ? -73.84  -84.62  
10  2  ASP A 3  ? ? 61.64   170.71  
11  2  THR A 14 ? ? -153.34 22.30   
12  2  THR A 27 ? ? -65.49  72.12   
13  2  LYS A 28 ? ? -150.52 -43.58  
14  2  ARG A 30 ? ? 131.36  -82.12  
15  2  ASN A 42 ? ? 33.73   54.99   
16  2  PRO A 50 ? ? -77.84  41.26   
17  2  ILE A 52 ? ? -132.12 -54.46  
18  2  PRO A 69 ? ? -68.82  80.79   
19  2  LEU A 71 ? ? -68.50  64.16   
20  2  LYS A 73 ? ? 68.27   136.07  
21  3  ASP A 3  ? ? 52.78   -143.20 
22  3  GLU A 51 ? ? -135.16 -68.63  
23  3  VAL A 72 ? ? -102.71 57.73   
24  3  LYS A 73 ? ? 45.55   -137.33 
25  4  THR A 14 ? ? -152.81 41.91   
26  4  HIS A 29 ? ? -68.48  87.08   
27  4  ARG A 30 ? ? 23.27   -66.21  
28  4  PRO A 50 ? ? -80.63  47.56   
29  4  GLU A 51 ? ? -134.16 -63.90  
30  4  VAL A 72 ? ? -81.28  -76.70  
31  4  LYS A 73 ? ? 67.62   150.31  
32  5  ASP A 3  ? ? 35.01   75.16   
33  5  THR A 14 ? ? -155.22 11.62   
34  5  LYS A 28 ? ? -169.91 -38.03  
35  5  ASN A 42 ? ? 79.24   41.81   
36  5  GLU A 51 ? ? -159.99 25.66   
37  5  ILE A 52 ? ? -167.17 -50.70  
38  5  VAL A 72 ? ? -141.81 -43.36  
39  5  LYS A 73 ? ? 42.83   -123.90 
40  5  ILE A 74 ? ? -91.49  -71.20  
41  6  ASP A 3  ? ? 63.00   162.89  
42  6  VAL A 5  ? ? -153.98 61.86   
43  6  THR A 14 ? ? -155.10 10.85   
44  6  THR A 27 ? ? -66.81  75.84   
45  6  LYS A 28 ? ? 179.64  -40.02  
46  6  ASN A 42 ? ? 34.78   47.02   
47  6  LYS A 73 ? ? 57.67   -160.43 
48  7  ASP A 3  ? ? 174.80  173.73  
49  7  LYS A 28 ? ? -162.69 -30.83  
50  7  ARG A 30 ? ? 139.59  -85.60  
51  7  ILE A 52 ? ? -123.62 -59.33  
52  7  LEU A 71 ? ? -67.22  59.72   
53  7  LYS A 73 ? ? -163.28 106.82  
54  7  ILE A 74 ? ? -86.74  -140.75 
55  8  THR A 14 ? ? -156.53 12.80   
56  8  LYS A 28 ? ? -156.00 -49.53  
57  8  CYS A 35 ? ? -144.22 56.80   
58  8  PRO A 50 ? ? -81.86  48.29   
59  8  GLU A 51 ? ? -138.15 -64.11  
60  8  ILE A 74 ? ? 68.42   -72.05  
61  9  THR A 27 ? ? -69.65  72.18   
62  9  LYS A 28 ? ? -176.17 -35.07  
63  9  ASN A 42 ? ? 37.31   51.21   
64  9  GLU A 51 ? ? -151.60 -92.88  
65  9  LEU A 71 ? ? -48.87  102.74  
66  9  LYS A 73 ? ? 61.44   -163.59 
67  9  ILE A 74 ? ? -164.11 74.65   
68  10 MET A 13 ? ? -65.79  94.68   
69  10 LYS A 28 ? ? -165.93 -36.22  
70  10 LEU A 71 ? ? -68.06  70.97   
71  10 VAL A 72 ? ? -71.15  -135.09 
72  10 LYS A 73 ? ? -138.99 -60.06  
73  10 ILE A 74 ? ? -146.38 -50.92  
74  11 ASP A 3  ? ? -48.50  107.07  
75  11 THR A 14 ? ? -152.19 -45.54  
76  11 THR A 27 ? ? -69.64  67.98   
77  11 LYS A 28 ? ? 178.16  -35.12  
78  11 ASN A 42 ? ? 27.00   62.04   
79  11 ILE A 52 ? ? -129.82 -60.08  
80  11 VAL A 72 ? ? -101.63 55.53   
81  11 LYS A 73 ? ? -39.46  110.96  
82  11 ILE A 74 ? ? 73.26   108.92  
83  12 ASP A 3  ? ? 71.68   161.22  
84  12 LYS A 28 ? ? -147.90 -51.78  
85  12 THR A 41 ? ? -141.62 36.47   
86  12 ASN A 42 ? ? 33.90   56.71   
87  12 GLU A 51 ? ? -138.39 -72.47  
88  12 LYS A 73 ? ? 65.98   147.07  
89  13 ASP A 3  ? ? -80.84  -123.28 
90  13 THR A 27 ? ? -62.63  80.47   
91  13 LYS A 28 ? ? 176.70  -34.57  
92  13 ALA A 40 ? ? -37.25  -39.69  
93  13 THR A 41 ? ? -143.29 34.96   
94  13 ASP A 49 ? ? -59.64  107.32  
95  13 PRO A 50 ? ? -82.44  45.57   
96  13 GLU A 51 ? ? -139.31 -60.29  
97  13 VAL A 72 ? ? -118.82 60.95   
98  14 THR A 14 ? ? -140.65 -34.97  
99  14 ARG A 30 ? ? -61.23  82.87   
100 14 PRO A 50 ? ? -78.62  49.43   
101 14 GLU A 51 ? ? -127.70 -63.52  
102 14 LYS A 73 ? ? 64.69   -177.21 
103 14 ILE A 74 ? ? -160.21 -43.53  
104 15 THR A 14 ? ? -136.09 -65.64  
105 15 LYS A 28 ? ? -164.58 -44.30  
106 15 ARG A 30 ? ? -66.82  0.51    
107 15 ASN A 42 ? ? 35.99   46.78   
108 15 GLU A 51 ? ? -144.93 -83.72  
109 15 LEU A 71 ? ? -69.40  65.18   
110 15 LYS A 73 ? ? 66.92   97.96   
111 16 THR A 14 ? ? -139.97 -37.60  
112 16 ASN A 42 ? ? 79.55   43.12   
113 16 GLU A 51 ? ? -125.34 -71.92  
114 17 ASP A 3  ? ? 72.35   166.06  
115 17 LYS A 28 ? ? -175.38 -35.08  
116 17 ASN A 42 ? ? 35.68   48.28   
117 17 LEU A 71 ? ? -59.98  107.34  
118 17 ILE A 74 ? ? 63.06   -73.62  
119 18 VAL A 10 ? ? -106.59 74.81   
120 18 THR A 14 ? ? -148.16 -1.60   
121 18 ILE A 22 ? ? -71.82  -80.42  
122 18 THR A 27 ? ? -67.13  64.01   
123 18 LYS A 28 ? ? -160.05 -50.02  
124 18 ASP A 49 ? ? -59.20  106.50  
125 18 GLU A 51 ? ? -163.98 -60.47  
126 18 VAL A 72 ? ? -131.89 -33.89  
127 18 ILE A 74 ? ? 73.67   128.88  
128 19 ASP A 3  ? ? -179.83 -162.34 
129 19 THR A 14 ? ? -139.33 -39.21  
130 19 HIS A 29 ? ? -69.84  96.67   
131 19 THR A 41 ? ? -140.83 37.87   
132 19 ASN A 42 ? ? 35.45   58.84   
133 19 GLU A 51 ? ? -139.68 -92.66  
134 20 THR A 14 ? ? -157.28 14.80   
135 20 THR A 41 ? ? -140.96 35.68   
136 20 ASN A 42 ? ? 36.06   57.36   
137 20 GLU A 51 ? ? -143.13 -63.75  
138 20 VAL A 72 ? ? -106.56 51.96   
139 21 THR A 14 ? ? -145.09 -37.41  
140 21 GLU A 51 ? ? -78.07  37.27   
141 21 ILE A 52 ? ? -132.63 -52.63  
142 22 ASP A 3  ? ? 175.46  172.74  
143 22 THR A 14 ? ? -154.84 25.08   
144 22 ILE A 52 ? ? -120.07 -54.52  
145 22 LEU A 71 ? ? -66.10  57.44   
146 23 THR A 14 ? ? -154.31 35.82   
147 23 LEU A 33 ? ? -135.87 -30.04  
148 23 GLU A 51 ? ? -142.52 -64.31  
149 23 LYS A 73 ? ? 58.39   -94.13  
150 24 THR A 14 ? ? -150.75 -10.93  
151 24 ASN A 42 ? ? 76.20   30.91   
152 24 PRO A 50 ? ? -79.25  49.68   
153 24 GLU A 51 ? ? -152.96 27.24   
154 24 ILE A 52 ? ? -153.78 -51.46  
155 24 VAL A 72 ? ? -93.30  -66.95  
156 24 LYS A 73 ? ? -175.52 132.09  
157 25 ASP A 3  ? ? 178.38  163.94  
158 25 THR A 14 ? ? -140.54 -2.76   
159 25 ILE A 22 ? ? -70.39  -71.46  
160 25 THR A 27 ? ? -65.25  71.48   
161 25 LYS A 28 ? ? -169.83 -31.09  
162 25 ASN A 42 ? ? 37.13   55.64   
163 25 PRO A 50 ? ? -79.41  40.21   
164 25 ILE A 52 ? ? -133.63 -51.09  
165 26 LYS A 28 ? ? -146.81 -49.81  
166 26 ARG A 30 ? ? -61.78  90.43   
167 26 ASN A 42 ? ? 34.10   46.21   
168 26 PRO A 50 ? ? -75.19  27.26   
169 26 GLU A 51 ? ? -135.55 -34.75  
170 26 LYS A 73 ? ? 57.35   -122.01 
171 26 ILE A 74 ? ? -141.61 -59.71  
172 27 ASP A 3  ? ? 65.27   -112.93 
173 27 THR A 14 ? ? -154.38 17.87   
174 27 LYS A 28 ? ? -169.90 -30.89  
175 28 THR A 14 ? ? -140.47 -6.54   
176 28 THR A 27 ? ? -66.89  78.28   
177 28 LYS A 28 ? ? 174.76  -37.08  
178 28 ILE A 52 ? ? -137.06 -46.15  
179 28 ILE A 74 ? ? 59.15   174.61  
180 29 THR A 14 ? ? -152.34 1.15    
181 29 LYS A 28 ? ? -153.78 -50.33  
182 29 ASN A 42 ? ? 31.22   64.19   
183 29 GLU A 51 ? ? -156.74 -74.35  
184 29 LYS A 73 ? ? -162.94 -165.65 
185 29 ILE A 74 ? ? 76.18   -55.72  
186 30 VAL A 10 ? ? -106.31 67.53   
187 30 THR A 14 ? ? -156.75 19.05   
188 30 THR A 27 ? ? -64.13  74.65   
189 30 LYS A 28 ? ? -174.88 -40.13  
190 30 GLU A 51 ? ? -162.18 -79.07  
191 30 VAL A 72 ? ? -131.75 -51.12  
192 30 LYS A 73 ? ? 56.73   -138.68 
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1  1  CYS A 35 ? ? SER A 36 ? ? 140.33  
2  2  MET A 1  ? ? GLY A 2  ? ? -136.35 
3  3  CYS A 35 ? ? SER A 36 ? ? 144.76  
4  4  HIS A 29 ? ? ARG A 30 ? ? 145.39  
5  5  CYS A 35 ? ? SER A 36 ? ? 142.04  
6  8  LYS A 43 ? ? ALA A 44 ? ? 147.94  
7  8  ALA A 44 ? ? HIS A 45 ? ? 148.79  
8  10 ILE A 74 ? ? GLU A 75 ? ? 137.40  
9  16 CYS A 35 ? ? SER A 36 ? ? 144.34  
10 17 MET A 1  ? ? GLY A 2  ? ? 136.37  
11 17 CYS A 35 ? ? SER A 36 ? ? 142.87  
12 20 CYS A 35 ? ? SER A 36 ? ? 139.42  
13 22 MET A 1  ? ? GLY A 2  ? ? 131.59  
14 24 MET A 1  ? ? GLY A 2  ? ? 141.00  
15 26 ILE A 74 ? ? GLU A 75 ? ? 135.79  
16 29 CYS A 35 ? ? SER A 36 ? ? 141.83  
17 30 ALA A 44 ? ? HIS A 45 ? ? 149.47  
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1  2  ARG A 11 ? ? 0.109 'SIDE CHAIN' 
2  2  TYR A 34 ? ? 0.147 'SIDE CHAIN' 
3  2  TYR A 48 ? ? 0.096 'SIDE CHAIN' 
4  3  ARG A 11 ? ? 0.083 'SIDE CHAIN' 
5  3  HIS A 29 ? ? 0.089 'SIDE CHAIN' 
6  3  TYR A 48 ? ? 0.095 'SIDE CHAIN' 
7  4  ARG A 30 ? ? 0.118 'SIDE CHAIN' 
8  5  ARG A 11 ? ? 0.137 'SIDE CHAIN' 
9  5  TYR A 48 ? ? 0.080 'SIDE CHAIN' 
10 6  HIS A 45 ? ? 0.081 'SIDE CHAIN' 
11 6  TYR A 48 ? ? 0.070 'SIDE CHAIN' 
12 7  TYR A 48 ? ? 0.132 'SIDE CHAIN' 
13 8  ARG A 11 ? ? 0.098 'SIDE CHAIN' 
14 8  ARG A 56 ? ? 0.101 'SIDE CHAIN' 
15 11 ARG A 56 ? ? 0.094 'SIDE CHAIN' 
16 12 TYR A 34 ? ? 0.069 'SIDE CHAIN' 
17 13 HIS A 29 ? ? 0.089 'SIDE CHAIN' 
18 14 HIS A 45 ? ? 0.103 'SIDE CHAIN' 
19 14 TYR A 48 ? ? 0.124 'SIDE CHAIN' 
20 15 HIS A 45 ? ? 0.107 'SIDE CHAIN' 
21 15 ARG A 56 ? ? 0.123 'SIDE CHAIN' 
22 17 TYR A 48 ? ? 0.172 'SIDE CHAIN' 
23 17 ARG A 56 ? ? 0.127 'SIDE CHAIN' 
24 18 ARG A 11 ? ? 0.104 'SIDE CHAIN' 
25 19 HIS A 45 ? ? 0.092 'SIDE CHAIN' 
26 19 TYR A 48 ? ? 0.096 'SIDE CHAIN' 
27 20 HIS A 45 ? ? 0.103 'SIDE CHAIN' 
28 20 TYR A 48 ? ? 0.065 'SIDE CHAIN' 
29 21 ARG A 11 ? ? 0.079 'SIDE CHAIN' 
30 21 TYR A 48 ? ? 0.085 'SIDE CHAIN' 
31 22 ARG A 56 ? ? 0.153 'SIDE CHAIN' 
32 23 ARG A 30 ? ? 0.080 'SIDE CHAIN' 
33 23 TYR A 48 ? ? 0.197 'SIDE CHAIN' 
34 24 HIS A 29 ? ? 0.089 'SIDE CHAIN' 
35 24 TYR A 34 ? ? 0.122 'SIDE CHAIN' 
36 24 HIS A 45 ? ? 0.102 'SIDE CHAIN' 
37 27 TYR A 48 ? ? 0.077 'SIDE CHAIN' 
38 28 TYR A 48 ? ? 0.089 'SIDE CHAIN' 
39 29 ARG A 56 ? ? 0.105 'SIDE CHAIN' 
40 30 TYR A 34 ? ? 0.079 'SIDE CHAIN' 
41 30 TYR A 48 ? ? 0.065 'SIDE CHAIN' 
# 
_pdbx_nmr_ensemble.entry_id                                      1YJT 
_pdbx_nmr_ensemble.conformers_calculated_total_number            300 
_pdbx_nmr_ensemble.conformers_submitted_total_number             30 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1YJT 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '0.8mM 15N labeled sample; 5mM DTT; 100mM phosphate buffer'     '90% H2O/10% D2O' 
2 '0.8mM 15N 13C labeled sample; 5mM DTT; 100mM phosphate buffer' '90% H2O/10% D2O' 
3 '1.0mM unlabeled sample; 5mM DTT; 100mM phosphate buffer'       '90% H2O/10% D2O' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '100mM phosphate buffer' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY           1 
2 2 'CBCANH; CBCACONH; HNCO; HNCACO' 2 
3 3 '2D NOESY'                       3 
4 3 '2D TOCSY'                       3 
5 1 HNHA                             1 
# 
_pdbx_nmr_refine.entry_id           1YJT 
_pdbx_nmr_refine.method             
'torsion angle dynamics coupled with simulated annealing followed by restrained energy minimization' 
_pdbx_nmr_refine.details            
'the structures were based on a total of 1901 meaningful distance constraints, 81 dihedral angle restraints' 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XwinNMR ?   ? 1 
'data analysis'      CARA    1.2 ? 2 
'structure solution' DYANA   1.5 ? 3 
refinement           Amber   5.0 ? 4 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASN N    N  N N 41  
ASN CA   C  N S 42  
ASN C    C  N N 43  
ASN O    O  N N 44  
ASN CB   C  N N 45  
ASN CG   C  N N 46  
ASN OD1  O  N N 47  
ASN ND2  N  N N 48  
ASN OXT  O  N N 49  
ASN H    H  N N 50  
ASN H2   H  N N 51  
ASN HA   H  N N 52  
ASN HB2  H  N N 53  
ASN HB3  H  N N 54  
ASN HD21 H  N N 55  
ASN HD22 H  N N 56  
ASN HXT  H  N N 57  
ASP N    N  N N 58  
ASP CA   C  N S 59  
ASP C    C  N N 60  
ASP O    O  N N 61  
ASP CB   C  N N 62  
ASP CG   C  N N 63  
ASP OD1  O  N N 64  
ASP OD2  O  N N 65  
ASP OXT  O  N N 66  
ASP H    H  N N 67  
ASP H2   H  N N 68  
ASP HA   H  N N 69  
ASP HB2  H  N N 70  
ASP HB3  H  N N 71  
ASP HD2  H  N N 72  
ASP HXT  H  N N 73  
CU1 CU   CU N N 74  
CYS N    N  N N 75  
CYS CA   C  N R 76  
CYS C    C  N N 77  
CYS O    O  N N 78  
CYS CB   C  N N 79  
CYS SG   S  N N 80  
CYS OXT  O  N N 81  
CYS H    H  N N 82  
CYS H2   H  N N 83  
CYS HA   H  N N 84  
CYS HB2  H  N N 85  
CYS HB3  H  N N 86  
CYS HG   H  N N 87  
CYS HXT  H  N N 88  
GLU N    N  N N 89  
GLU CA   C  N S 90  
GLU C    C  N N 91  
GLU O    O  N N 92  
GLU CB   C  N N 93  
GLU CG   C  N N 94  
GLU CD   C  N N 95  
GLU OE1  O  N N 96  
GLU OE2  O  N N 97  
GLU OXT  O  N N 98  
GLU H    H  N N 99  
GLU H2   H  N N 100 
GLU HA   H  N N 101 
GLU HB2  H  N N 102 
GLU HB3  H  N N 103 
GLU HG2  H  N N 104 
GLU HG3  H  N N 105 
GLU HE2  H  N N 106 
GLU HXT  H  N N 107 
GLY N    N  N N 108 
GLY CA   C  N N 109 
GLY C    C  N N 110 
GLY O    O  N N 111 
GLY OXT  O  N N 112 
GLY H    H  N N 113 
GLY H2   H  N N 114 
GLY HA2  H  N N 115 
GLY HA3  H  N N 116 
GLY HXT  H  N N 117 
HIS N    N  N N 118 
HIS CA   C  N S 119 
HIS C    C  N N 120 
HIS O    O  N N 121 
HIS CB   C  N N 122 
HIS CG   C  Y N 123 
HIS ND1  N  Y N 124 
HIS CD2  C  Y N 125 
HIS CE1  C  Y N 126 
HIS NE2  N  Y N 127 
HIS OXT  O  N N 128 
HIS H    H  N N 129 
HIS H2   H  N N 130 
HIS HA   H  N N 131 
HIS HB2  H  N N 132 
HIS HB3  H  N N 133 
HIS HD1  H  N N 134 
HIS HD2  H  N N 135 
HIS HE1  H  N N 136 
HIS HE2  H  N N 137 
HIS HXT  H  N N 138 
ILE N    N  N N 139 
ILE CA   C  N S 140 
ILE C    C  N N 141 
ILE O    O  N N 142 
ILE CB   C  N S 143 
ILE CG1  C  N N 144 
ILE CG2  C  N N 145 
ILE CD1  C  N N 146 
ILE OXT  O  N N 147 
ILE H    H  N N 148 
ILE H2   H  N N 149 
ILE HA   H  N N 150 
ILE HB   H  N N 151 
ILE HG12 H  N N 152 
ILE HG13 H  N N 153 
ILE HG21 H  N N 154 
ILE HG22 H  N N 155 
ILE HG23 H  N N 156 
ILE HD11 H  N N 157 
ILE HD12 H  N N 158 
ILE HD13 H  N N 159 
ILE HXT  H  N N 160 
LEU N    N  N N 161 
LEU CA   C  N S 162 
LEU C    C  N N 163 
LEU O    O  N N 164 
LEU CB   C  N N 165 
LEU CG   C  N N 166 
LEU CD1  C  N N 167 
LEU CD2  C  N N 168 
LEU OXT  O  N N 169 
LEU H    H  N N 170 
LEU H2   H  N N 171 
LEU HA   H  N N 172 
LEU HB2  H  N N 173 
LEU HB3  H  N N 174 
LEU HG   H  N N 175 
LEU HD11 H  N N 176 
LEU HD12 H  N N 177 
LEU HD13 H  N N 178 
LEU HD21 H  N N 179 
LEU HD22 H  N N 180 
LEU HD23 H  N N 181 
LEU HXT  H  N N 182 
LYS N    N  N N 183 
LYS CA   C  N S 184 
LYS C    C  N N 185 
LYS O    O  N N 186 
LYS CB   C  N N 187 
LYS CG   C  N N 188 
LYS CD   C  N N 189 
LYS CE   C  N N 190 
LYS NZ   N  N N 191 
LYS OXT  O  N N 192 
LYS H    H  N N 193 
LYS H2   H  N N 194 
LYS HA   H  N N 195 
LYS HB2  H  N N 196 
LYS HB3  H  N N 197 
LYS HG2  H  N N 198 
LYS HG3  H  N N 199 
LYS HD2  H  N N 200 
LYS HD3  H  N N 201 
LYS HE2  H  N N 202 
LYS HE3  H  N N 203 
LYS HZ1  H  N N 204 
LYS HZ2  H  N N 205 
LYS HZ3  H  N N 206 
LYS HXT  H  N N 207 
MET N    N  N N 208 
MET CA   C  N S 209 
MET C    C  N N 210 
MET O    O  N N 211 
MET CB   C  N N 212 
MET CG   C  N N 213 
MET SD   S  N N 214 
MET CE   C  N N 215 
MET OXT  O  N N 216 
MET H    H  N N 217 
MET H2   H  N N 218 
MET HA   H  N N 219 
MET HB2  H  N N 220 
MET HB3  H  N N 221 
MET HG2  H  N N 222 
MET HG3  H  N N 223 
MET HE1  H  N N 224 
MET HE2  H  N N 225 
MET HE3  H  N N 226 
MET HXT  H  N N 227 
PHE N    N  N N 228 
PHE CA   C  N S 229 
PHE C    C  N N 230 
PHE O    O  N N 231 
PHE CB   C  N N 232 
PHE CG   C  Y N 233 
PHE CD1  C  Y N 234 
PHE CD2  C  Y N 235 
PHE CE1  C  Y N 236 
PHE CE2  C  Y N 237 
PHE CZ   C  Y N 238 
PHE OXT  O  N N 239 
PHE H    H  N N 240 
PHE H2   H  N N 241 
PHE HA   H  N N 242 
PHE HB2  H  N N 243 
PHE HB3  H  N N 244 
PHE HD1  H  N N 245 
PHE HD2  H  N N 246 
PHE HE1  H  N N 247 
PHE HE2  H  N N 248 
PHE HZ   H  N N 249 
PHE HXT  H  N N 250 
PRO N    N  N N 251 
PRO CA   C  N S 252 
PRO C    C  N N 253 
PRO O    O  N N 254 
PRO CB   C  N N 255 
PRO CG   C  N N 256 
PRO CD   C  N N 257 
PRO OXT  O  N N 258 
PRO H    H  N N 259 
PRO HA   H  N N 260 
PRO HB2  H  N N 261 
PRO HB3  H  N N 262 
PRO HG2  H  N N 263 
PRO HG3  H  N N 264 
PRO HD2  H  N N 265 
PRO HD3  H  N N 266 
PRO HXT  H  N N 267 
SER N    N  N N 268 
SER CA   C  N S 269 
SER C    C  N N 270 
SER O    O  N N 271 
SER CB   C  N N 272 
SER OG   O  N N 273 
SER OXT  O  N N 274 
SER H    H  N N 275 
SER H2   H  N N 276 
SER HA   H  N N 277 
SER HB2  H  N N 278 
SER HB3  H  N N 279 
SER HG   H  N N 280 
SER HXT  H  N N 281 
THR N    N  N N 282 
THR CA   C  N S 283 
THR C    C  N N 284 
THR O    O  N N 285 
THR CB   C  N R 286 
THR OG1  O  N N 287 
THR CG2  C  N N 288 
THR OXT  O  N N 289 
THR H    H  N N 290 
THR H2   H  N N 291 
THR HA   H  N N 292 
THR HB   H  N N 293 
THR HG1  H  N N 294 
THR HG21 H  N N 295 
THR HG22 H  N N 296 
THR HG23 H  N N 297 
THR HXT  H  N N 298 
TYR N    N  N N 299 
TYR CA   C  N S 300 
TYR C    C  N N 301 
TYR O    O  N N 302 
TYR CB   C  N N 303 
TYR CG   C  Y N 304 
TYR CD1  C  Y N 305 
TYR CD2  C  Y N 306 
TYR CE1  C  Y N 307 
TYR CE2  C  Y N 308 
TYR CZ   C  Y N 309 
TYR OH   O  N N 310 
TYR OXT  O  N N 311 
TYR H    H  N N 312 
TYR H2   H  N N 313 
TYR HA   H  N N 314 
TYR HB2  H  N N 315 
TYR HB3  H  N N 316 
TYR HD1  H  N N 317 
TYR HD2  H  N N 318 
TYR HE1  H  N N 319 
TYR HE2  H  N N 320 
TYR HH   H  N N 321 
TYR HXT  H  N N 322 
VAL N    N  N N 323 
VAL CA   C  N S 324 
VAL C    C  N N 325 
VAL O    O  N N 326 
VAL CB   C  N N 327 
VAL CG1  C  N N 328 
VAL CG2  C  N N 329 
VAL OXT  O  N N 330 
VAL H    H  N N 331 
VAL H2   H  N N 332 
VAL HA   H  N N 333 
VAL HB   H  N N 334 
VAL HG11 H  N N 335 
VAL HG12 H  N N 336 
VAL HG13 H  N N 337 
VAL HG21 H  N N 338 
VAL HG22 H  N N 339 
VAL HG23 H  N N 340 
VAL HXT  H  N N 341 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLU N   CA   sing N N 83  
GLU N   H    sing N N 84  
GLU N   H2   sing N N 85  
GLU CA  C    sing N N 86  
GLU CA  CB   sing N N 87  
GLU CA  HA   sing N N 88  
GLU C   O    doub N N 89  
GLU C   OXT  sing N N 90  
GLU CB  CG   sing N N 91  
GLU CB  HB2  sing N N 92  
GLU CB  HB3  sing N N 93  
GLU CG  CD   sing N N 94  
GLU CG  HG2  sing N N 95  
GLU CG  HG3  sing N N 96  
GLU CD  OE1  doub N N 97  
GLU CD  OE2  sing N N 98  
GLU OE2 HE2  sing N N 99  
GLU OXT HXT  sing N N 100 
GLY N   CA   sing N N 101 
GLY N   H    sing N N 102 
GLY N   H2   sing N N 103 
GLY CA  C    sing N N 104 
GLY CA  HA2  sing N N 105 
GLY CA  HA3  sing N N 106 
GLY C   O    doub N N 107 
GLY C   OXT  sing N N 108 
GLY OXT HXT  sing N N 109 
HIS N   CA   sing N N 110 
HIS N   H    sing N N 111 
HIS N   H2   sing N N 112 
HIS CA  C    sing N N 113 
HIS CA  CB   sing N N 114 
HIS CA  HA   sing N N 115 
HIS C   O    doub N N 116 
HIS C   OXT  sing N N 117 
HIS CB  CG   sing N N 118 
HIS CB  HB2  sing N N 119 
HIS CB  HB3  sing N N 120 
HIS CG  ND1  sing Y N 121 
HIS CG  CD2  doub Y N 122 
HIS ND1 CE1  doub Y N 123 
HIS ND1 HD1  sing N N 124 
HIS CD2 NE2  sing Y N 125 
HIS CD2 HD2  sing N N 126 
HIS CE1 NE2  sing Y N 127 
HIS CE1 HE1  sing N N 128 
HIS NE2 HE2  sing N N 129 
HIS OXT HXT  sing N N 130 
ILE N   CA   sing N N 131 
ILE N   H    sing N N 132 
ILE N   H2   sing N N 133 
ILE CA  C    sing N N 134 
ILE CA  CB   sing N N 135 
ILE CA  HA   sing N N 136 
ILE C   O    doub N N 137 
ILE C   OXT  sing N N 138 
ILE CB  CG1  sing N N 139 
ILE CB  CG2  sing N N 140 
ILE CB  HB   sing N N 141 
ILE CG1 CD1  sing N N 142 
ILE CG1 HG12 sing N N 143 
ILE CG1 HG13 sing N N 144 
ILE CG2 HG21 sing N N 145 
ILE CG2 HG22 sing N N 146 
ILE CG2 HG23 sing N N 147 
ILE CD1 HD11 sing N N 148 
ILE CD1 HD12 sing N N 149 
ILE CD1 HD13 sing N N 150 
ILE OXT HXT  sing N N 151 
LEU N   CA   sing N N 152 
LEU N   H    sing N N 153 
LEU N   H2   sing N N 154 
LEU CA  C    sing N N 155 
LEU CA  CB   sing N N 156 
LEU CA  HA   sing N N 157 
LEU C   O    doub N N 158 
LEU C   OXT  sing N N 159 
LEU CB  CG   sing N N 160 
LEU CB  HB2  sing N N 161 
LEU CB  HB3  sing N N 162 
LEU CG  CD1  sing N N 163 
LEU CG  CD2  sing N N 164 
LEU CG  HG   sing N N 165 
LEU CD1 HD11 sing N N 166 
LEU CD1 HD12 sing N N 167 
LEU CD1 HD13 sing N N 168 
LEU CD2 HD21 sing N N 169 
LEU CD2 HD22 sing N N 170 
LEU CD2 HD23 sing N N 171 
LEU OXT HXT  sing N N 172 
LYS N   CA   sing N N 173 
LYS N   H    sing N N 174 
LYS N   H2   sing N N 175 
LYS CA  C    sing N N 176 
LYS CA  CB   sing N N 177 
LYS CA  HA   sing N N 178 
LYS C   O    doub N N 179 
LYS C   OXT  sing N N 180 
LYS CB  CG   sing N N 181 
LYS CB  HB2  sing N N 182 
LYS CB  HB3  sing N N 183 
LYS CG  CD   sing N N 184 
LYS CG  HG2  sing N N 185 
LYS CG  HG3  sing N N 186 
LYS CD  CE   sing N N 187 
LYS CD  HD2  sing N N 188 
LYS CD  HD3  sing N N 189 
LYS CE  NZ   sing N N 190 
LYS CE  HE2  sing N N 191 
LYS CE  HE3  sing N N 192 
LYS NZ  HZ1  sing N N 193 
LYS NZ  HZ2  sing N N 194 
LYS NZ  HZ3  sing N N 195 
LYS OXT HXT  sing N N 196 
MET N   CA   sing N N 197 
MET N   H    sing N N 198 
MET N   H2   sing N N 199 
MET CA  C    sing N N 200 
MET CA  CB   sing N N 201 
MET CA  HA   sing N N 202 
MET C   O    doub N N 203 
MET C   OXT  sing N N 204 
MET CB  CG   sing N N 205 
MET CB  HB2  sing N N 206 
MET CB  HB3  sing N N 207 
MET CG  SD   sing N N 208 
MET CG  HG2  sing N N 209 
MET CG  HG3  sing N N 210 
MET SD  CE   sing N N 211 
MET CE  HE1  sing N N 212 
MET CE  HE2  sing N N 213 
MET CE  HE3  sing N N 214 
MET OXT HXT  sing N N 215 
PHE N   CA   sing N N 216 
PHE N   H    sing N N 217 
PHE N   H2   sing N N 218 
PHE CA  C    sing N N 219 
PHE CA  CB   sing N N 220 
PHE CA  HA   sing N N 221 
PHE C   O    doub N N 222 
PHE C   OXT  sing N N 223 
PHE CB  CG   sing N N 224 
PHE CB  HB2  sing N N 225 
PHE CB  HB3  sing N N 226 
PHE CG  CD1  doub Y N 227 
PHE CG  CD2  sing Y N 228 
PHE CD1 CE1  sing Y N 229 
PHE CD1 HD1  sing N N 230 
PHE CD2 CE2  doub Y N 231 
PHE CD2 HD2  sing N N 232 
PHE CE1 CZ   doub Y N 233 
PHE CE1 HE1  sing N N 234 
PHE CE2 CZ   sing Y N 235 
PHE CE2 HE2  sing N N 236 
PHE CZ  HZ   sing N N 237 
PHE OXT HXT  sing N N 238 
PRO N   CA   sing N N 239 
PRO N   CD   sing N N 240 
PRO N   H    sing N N 241 
PRO CA  C    sing N N 242 
PRO CA  CB   sing N N 243 
PRO CA  HA   sing N N 244 
PRO C   O    doub N N 245 
PRO C   OXT  sing N N 246 
PRO CB  CG   sing N N 247 
PRO CB  HB2  sing N N 248 
PRO CB  HB3  sing N N 249 
PRO CG  CD   sing N N 250 
PRO CG  HG2  sing N N 251 
PRO CG  HG3  sing N N 252 
PRO CD  HD2  sing N N 253 
PRO CD  HD3  sing N N 254 
PRO OXT HXT  sing N N 255 
SER N   CA   sing N N 256 
SER N   H    sing N N 257 
SER N   H2   sing N N 258 
SER CA  C    sing N N 259 
SER CA  CB   sing N N 260 
SER CA  HA   sing N N 261 
SER C   O    doub N N 262 
SER C   OXT  sing N N 263 
SER CB  OG   sing N N 264 
SER CB  HB2  sing N N 265 
SER CB  HB3  sing N N 266 
SER OG  HG   sing N N 267 
SER OXT HXT  sing N N 268 
THR N   CA   sing N N 269 
THR N   H    sing N N 270 
THR N   H2   sing N N 271 
THR CA  C    sing N N 272 
THR CA  CB   sing N N 273 
THR CA  HA   sing N N 274 
THR C   O    doub N N 275 
THR C   OXT  sing N N 276 
THR CB  OG1  sing N N 277 
THR CB  CG2  sing N N 278 
THR CB  HB   sing N N 279 
THR OG1 HG1  sing N N 280 
THR CG2 HG21 sing N N 281 
THR CG2 HG22 sing N N 282 
THR CG2 HG23 sing N N 283 
THR OXT HXT  sing N N 284 
TYR N   CA   sing N N 285 
TYR N   H    sing N N 286 
TYR N   H2   sing N N 287 
TYR CA  C    sing N N 288 
TYR CA  CB   sing N N 289 
TYR CA  HA   sing N N 290 
TYR C   O    doub N N 291 
TYR C   OXT  sing N N 292 
TYR CB  CG   sing N N 293 
TYR CB  HB2  sing N N 294 
TYR CB  HB3  sing N N 295 
TYR CG  CD1  doub Y N 296 
TYR CG  CD2  sing Y N 297 
TYR CD1 CE1  sing Y N 298 
TYR CD1 HD1  sing N N 299 
TYR CD2 CE2  doub Y N 300 
TYR CD2 HD2  sing N N 301 
TYR CE1 CZ   doub Y N 302 
TYR CE1 HE1  sing N N 303 
TYR CE2 CZ   sing Y N 304 
TYR CE2 HE2  sing N N 305 
TYR CZ  OH   sing N N 306 
TYR OH  HH   sing N N 307 
TYR OXT HXT  sing N N 308 
VAL N   CA   sing N N 309 
VAL N   H    sing N N 310 
VAL N   H2   sing N N 311 
VAL CA  C    sing N N 312 
VAL CA  CB   sing N N 313 
VAL CA  HA   sing N N 314 
VAL C   O    doub N N 315 
VAL C   OXT  sing N N 316 
VAL CB  CG1  sing N N 317 
VAL CB  CG2  sing N N 318 
VAL CB  HB   sing N N 319 
VAL CG1 HG11 sing N N 320 
VAL CG1 HG12 sing N N 321 
VAL CG1 HG13 sing N N 322 
VAL CG2 HG21 sing N N 323 
VAL CG2 HG22 sing N N 324 
VAL CG2 HG23 sing N N 325 
VAL OXT HXT  sing N N 326 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 AVANCE Bruker 900 ? 
2 AVANCE Bruker 500 ? 
# 
_atom_sites.entry_id                    1YJT 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CU 
H  
N  
O  
S  
# 
loop_