data_1Z0R # _entry.id 1Z0R # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1Z0R pdb_00001z0r 10.2210/pdb1z0r/pdb RCSB RCSB032152 ? ? WWPDB D_1000032152 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-03-15 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2005-03-15 _pdbx_database_PDB_obs_spr.pdb_id 1Z0R _pdbx_database_PDB_obs_spr.replace_pdb_id 1EKT _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1Z0R _pdbx_database_status.recvd_initial_deposition_date 2005-03-02 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1MVF 'Maze Addiction Antidote' unspecified PDB 1N0F ;Crystal Structure Of A Cell Division and Cell Wall Biosynthesis Protein Upf0040 From Mycoplasma Pneumoniae: Indication Of A Novel Fold With A Possible New Conserved Sequence Motif ; unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bobay, B.G.' 1 'Andreeva, A.' 2 'Mueller, G.A.' 3 'Cavanagh, J.' 4 'Murzin, A.G.' 5 # _citation.id primary _citation.title 'Revised structure of the AbrB N-terminal domain unifies a diverse superfamily of putative DNA-binding proteins.' _citation.journal_abbrev 'Febs Lett.' _citation.journal_volume 579 _citation.page_first 5669 _citation.page_last 5674 _citation.year 2005 _citation.journal_id_ASTM FEBLAL _citation.country NE _citation.journal_id_ISSN 0014-5793 _citation.journal_id_CSD 0165 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16223496 _citation.pdbx_database_id_DOI 10.1016/j.febslet.2005.09.045 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bobay, B.G.' 1 ? primary 'Andreeva, A.' 2 ? primary 'Mueller, G.A.' 3 ? primary 'Cavanagh, J.' 4 ? primary 'Murzin, A.G.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Transition state regulatory protein abrB' _entity.formula_weight 6111.287 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-Terminal Dimer from Residues 1-53 (of 94)' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMT _entity_poly.pdbx_seq_one_letter_code_can MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMT _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 SER n 1 4 THR n 1 5 GLY n 1 6 ILE n 1 7 VAL n 1 8 ARG n 1 9 LYS n 1 10 VAL n 1 11 ASP n 1 12 GLU n 1 13 LEU n 1 14 GLY n 1 15 ARG n 1 16 VAL n 1 17 VAL n 1 18 ILE n 1 19 PRO n 1 20 ILE n 1 21 GLU n 1 22 LEU n 1 23 ARG n 1 24 ARG n 1 25 THR n 1 26 LEU n 1 27 GLY n 1 28 ILE n 1 29 ALA n 1 30 GLU n 1 31 LYS n 1 32 ASP n 1 33 ALA n 1 34 LEU n 1 35 GLU n 1 36 ILE n 1 37 TYR n 1 38 VAL n 1 39 ASP n 1 40 ASP n 1 41 GLU n 1 42 LYS n 1 43 ILE n 1 44 ILE n 1 45 LEU n 1 46 LYS n 1 47 LYS n 1 48 TYR n 1 49 LYS n 1 50 PRO n 1 51 ASN n 1 52 MET n 1 53 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Bacillus _entity_src_gen.pdbx_gene_src_gene abrB _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1423 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE)3' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pet-24 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 MET 52 52 52 MET MET A . n A 1 53 THR 53 53 53 THR THR A . n B 1 1 MET 1 1 1 MET MET B . n B 1 2 LYS 2 2 2 LYS LYS B . n B 1 3 SER 3 3 3 SER SER B . n B 1 4 THR 4 4 4 THR THR B . n B 1 5 GLY 5 5 5 GLY GLY B . n B 1 6 ILE 6 6 6 ILE ILE B . n B 1 7 VAL 7 7 7 VAL VAL B . n B 1 8 ARG 8 8 8 ARG ARG B . n B 1 9 LYS 9 9 9 LYS LYS B . n B 1 10 VAL 10 10 10 VAL VAL B . n B 1 11 ASP 11 11 11 ASP ASP B . n B 1 12 GLU 12 12 12 GLU GLU B . n B 1 13 LEU 13 13 13 LEU LEU B . n B 1 14 GLY 14 14 14 GLY GLY B . n B 1 15 ARG 15 15 15 ARG ARG B . n B 1 16 VAL 16 16 16 VAL VAL B . n B 1 17 VAL 17 17 17 VAL VAL B . n B 1 18 ILE 18 18 18 ILE ILE B . n B 1 19 PRO 19 19 19 PRO PRO B . n B 1 20 ILE 20 20 20 ILE ILE B . n B 1 21 GLU 21 21 21 GLU GLU B . n B 1 22 LEU 22 22 22 LEU LEU B . n B 1 23 ARG 23 23 23 ARG ARG B . n B 1 24 ARG 24 24 24 ARG ARG B . n B 1 25 THR 25 25 25 THR THR B . n B 1 26 LEU 26 26 26 LEU LEU B . n B 1 27 GLY 27 27 27 GLY GLY B . n B 1 28 ILE 28 28 28 ILE ILE B . n B 1 29 ALA 29 29 29 ALA ALA B . n B 1 30 GLU 30 30 30 GLU GLU B . n B 1 31 LYS 31 31 31 LYS LYS B . n B 1 32 ASP 32 32 32 ASP ASP B . n B 1 33 ALA 33 33 33 ALA ALA B . n B 1 34 LEU 34 34 34 LEU LEU B . n B 1 35 GLU 35 35 35 GLU GLU B . n B 1 36 ILE 36 36 36 ILE ILE B . n B 1 37 TYR 37 37 37 TYR TYR B . n B 1 38 VAL 38 38 38 VAL VAL B . n B 1 39 ASP 39 39 39 ASP ASP B . n B 1 40 ASP 40 40 40 ASP ASP B . n B 1 41 GLU 41 41 41 GLU GLU B . n B 1 42 LYS 42 42 42 LYS LYS B . n B 1 43 ILE 43 43 43 ILE ILE B . n B 1 44 ILE 44 44 44 ILE ILE B . n B 1 45 LEU 45 45 45 LEU LEU B . n B 1 46 LYS 46 46 46 LYS LYS B . n B 1 47 LYS 47 47 47 LYS LYS B . n B 1 48 TYR 48 48 48 TYR TYR B . n B 1 49 LYS 49 49 49 LYS LYS B . n B 1 50 PRO 50 50 50 PRO PRO B . n B 1 51 ASN 51 51 51 ASN ASN B . n B 1 52 MET 52 52 52 MET MET B . n B 1 53 THR 53 53 53 THR THR B . n # _exptl.entry_id 1Z0R _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.density_Matthews ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1Z0R _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1Z0R _struct.title 'Solution Structure of the N-terminal DNA Recognition Domain of the Bacillus subtilis Transcription-State Regulator AbrB' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1Z0R _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'SCOP database, N-terminal DNA-binding domain, transition state regulator, TRANSCRIPTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ABRB_BACSU _struct_ref.pdbx_db_accession P08874 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMT _struct_ref.pdbx_align_begin 3 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1Z0R A 1 ? 53 ? P08874 3 ? 55 ? 1 53 2 1 1Z0R B 1 ? 53 ? P08874 3 ? 55 ? 1 53 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 19 ? LEU A 26 ? PRO A 19 LEU A 26 1 ? 8 HELX_P HELX_P2 2 PRO B 19 ? LEU B 26 ? PRO B 19 LEU B 26 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 6 ? LYS A 9 ? ILE A 6 LYS A 9 A 2 ALA B 33 ? ASP B 39 ? ALA B 33 ASP B 39 A 3 LYS B 42 ? LYS B 47 ? LYS B 42 LYS B 47 A 4 LYS A 42 ? LYS A 47 ? LYS A 42 LYS A 47 A 5 ALA A 33 ? ASP A 39 ? ALA A 33 ASP A 39 A 6 ILE B 6 ? LYS B 9 ? ILE B 6 LYS B 9 B 1 ARG A 15 ? VAL A 17 ? ARG A 15 VAL A 17 B 2 ARG B 15 ? VAL B 17 ? ARG B 15 VAL B 17 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 6 ? N ILE A 6 O ILE B 36 ? O ILE B 36 A 2 3 N TYR B 37 ? N TYR B 37 O ILE B 44 ? O ILE B 44 A 3 4 O LEU B 45 ? O LEU B 45 N ILE A 43 ? N ILE A 43 A 4 5 O ILE A 44 ? O ILE A 44 N TYR A 37 ? N TYR A 37 A 5 6 N ILE A 36 ? N ILE A 36 O ILE B 6 ? O ILE B 6 B 1 2 N VAL A 16 ? N VAL A 16 O VAL B 16 ? O VAL B 16 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HD13 A ILE 28 ? ? HD23 A LEU 34 ? ? 1.22 2 1 HD13 B ILE 28 ? ? HD23 B LEU 34 ? ? 1.32 3 1 OE1 B GLU 35 ? ? HZ2 B LYS 46 ? ? 1.56 4 3 HG2 A LYS 2 ? ? H A SER 3 ? ? 1.33 5 3 OE2 B GLU 35 ? ? HH B TYR 37 ? ? 1.57 6 4 HG2 B LYS 2 ? ? H B SER 3 ? ? 1.25 7 5 OE1 A GLU 35 ? ? HZ3 A LYS 46 ? ? 1.59 8 7 HE2 A TYR 37 ? ? HE2 A LYS 46 ? ? 1.11 9 7 HA A GLU 30 ? ? HB B VAL 10 ? ? 1.34 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 2 ? ? -163.30 -124.51 2 1 ASP A 11 ? ? 73.32 -91.81 3 1 GLU A 12 ? ? -161.12 -54.24 4 1 ASP A 40 ? ? 61.46 -67.42 5 1 PRO A 50 ? ? -75.74 41.25 6 1 LYS B 2 ? ? -168.98 -120.35 7 1 ASP B 11 ? ? 71.65 -109.84 8 1 GLU B 12 ? ? -151.63 -42.23 9 1 ASP B 40 ? ? 62.72 -70.46 10 2 LYS A 2 ? ? -146.60 -133.77 11 2 ASP A 11 ? ? 66.29 -147.28 12 2 ILE A 28 ? ? -88.12 -157.66 13 2 ASP A 40 ? ? 60.79 -79.37 14 2 GLU A 41 ? ? -141.25 20.82 15 2 LYS B 2 ? ? -136.91 -104.25 16 2 ASP B 11 ? ? 70.17 -148.43 17 2 ILE B 28 ? ? -78.34 -153.45 18 2 ALA B 29 ? ? -153.44 -105.92 19 2 GLU B 30 ? ? -154.70 -39.34 20 2 ASP B 40 ? ? 67.04 -13.31 21 2 GLU B 41 ? ? -179.91 -15.46 22 3 LYS A 2 ? ? 63.22 -151.08 23 3 ASP A 11 ? ? 66.94 -133.34 24 3 GLU A 12 ? ? -131.19 -37.13 25 3 ILE A 28 ? ? -83.11 -153.75 26 3 ALA A 29 ? ? -162.47 -168.61 27 3 ASP A 40 ? ? 67.87 -73.82 28 3 GLU A 41 ? ? -155.50 17.88 29 3 LYS B 2 ? ? 62.93 -148.00 30 3 ASP B 11 ? ? 64.69 -145.14 31 3 ILE B 28 ? ? -88.81 -157.95 32 3 ASP B 40 ? ? 69.73 -69.47 33 3 GLU B 41 ? ? -158.81 20.82 34 4 LYS A 2 ? ? 64.68 -151.01 35 4 THR A 4 ? ? -135.77 -34.51 36 4 ASP A 11 ? ? 66.35 -135.62 37 4 GLU A 12 ? ? -130.25 -47.96 38 4 ILE A 28 ? ? -81.10 -156.29 39 4 ASP A 40 ? ? 64.83 -83.73 40 4 GLU A 41 ? ? -143.97 18.15 41 4 LYS B 2 ? ? 66.01 -155.37 42 4 THR B 4 ? ? -137.86 -39.66 43 4 ASP B 11 ? ? 67.18 -136.74 44 4 GLU B 12 ? ? -131.56 -42.33 45 4 ILE B 28 ? ? -80.90 -156.36 46 4 ASP B 40 ? ? 60.85 -87.11 47 4 GLU B 41 ? ? -144.43 29.81 48 5 LYS A 2 ? ? -151.92 -140.28 49 5 ASP A 11 ? ? 68.51 -124.45 50 5 GLU A 12 ? ? -142.90 -40.40 51 5 ILE A 28 ? ? -77.85 -160.25 52 5 ASP A 40 ? ? 68.47 -71.16 53 5 PRO A 50 ? ? -75.97 34.19 54 5 LYS B 2 ? ? -170.76 -144.97 55 5 ASP B 11 ? ? 65.43 -139.12 56 5 ILE B 28 ? ? -100.18 -163.06 57 5 ASP B 40 ? ? 64.47 -69.06 58 5 GLU B 41 ? ? -144.84 12.07 59 6 LYS A 2 ? ? -170.72 -157.82 60 6 ASP A 11 ? ? 73.85 -108.34 61 6 GLU A 12 ? ? -156.97 -42.17 62 6 ILE A 28 ? ? -83.67 -158.63 63 6 ASP A 40 ? ? 66.30 -74.23 64 6 GLU A 41 ? ? -149.51 22.46 65 6 LYS B 2 ? ? -177.31 -159.03 66 6 ASP B 11 ? ? 74.77 -101.67 67 6 GLU B 12 ? ? -160.12 -45.87 68 6 ILE B 28 ? ? -99.72 -159.29 69 6 ASP B 40 ? ? 65.09 -65.56 70 6 GLU B 41 ? ? -150.35 19.39 71 7 LYS A 2 ? ? -160.92 -123.35 72 7 ASP A 11 ? ? 66.20 -149.65 73 7 ILE A 28 ? ? -83.91 -158.69 74 7 ASP A 40 ? ? 65.52 -66.05 75 7 PRO A 50 ? ? -83.61 35.99 76 7 LYS B 2 ? ? 42.59 -145.17 77 7 ASP B 11 ? ? 68.19 -146.88 78 7 ILE B 28 ? ? -83.39 -158.70 79 7 ASP B 40 ? ? 61.15 -75.42 80 7 GLU B 41 ? ? -141.62 14.99 # _pdbx_nmr_ensemble.entry_id 1Z0R _pdbx_nmr_ensemble.conformers_calculated_total_number 10 _pdbx_nmr_ensemble.conformers_submitted_total_number 7 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1Z0R _pdbx_nmr_representative.conformer_id 2 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1-2mM AbrB; 95% pure; 20mM Phosphate, 15mM KCl, 1mM EDTA, 1mM DTT' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 305 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 5.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength '15mM KCl' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 3 1 '3-D 13C/15N Sequential Assignment Protocols' 1 # _pdbx_nmr_details.entry_id 1Z0R _pdbx_nmr_details.text ;New relationships found in process of updating the SCOP database resulted in revision of the structure of the N-terminal, DNA-binding domain of the transition state regulator AbrB. ; # _pdbx_nmr_refine.entry_id 1Z0R _pdbx_nmr_refine.method 'distance geometry, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal processing NMRPipe 'july 15th 2004' 'Delaglio, F.' 1 'data analysis' NMRView 5.0 'Johnson, B.' 2 'structure solution' ARIA 1.2 'Nilges, M.' 3 refinement ARIA 1.2 'Nilges, M.' 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLU N N N N 74 GLU CA C N S 75 GLU C C N N 76 GLU O O N N 77 GLU CB C N N 78 GLU CG C N N 79 GLU CD C N N 80 GLU OE1 O N N 81 GLU OE2 O N N 82 GLU OXT O N N 83 GLU H H N N 84 GLU H2 H N N 85 GLU HA H N N 86 GLU HB2 H N N 87 GLU HB3 H N N 88 GLU HG2 H N N 89 GLU HG3 H N N 90 GLU HE2 H N N 91 GLU HXT H N N 92 GLY N N N N 93 GLY CA C N N 94 GLY C C N N 95 GLY O O N N 96 GLY OXT O N N 97 GLY H H N N 98 GLY H2 H N N 99 GLY HA2 H N N 100 GLY HA3 H N N 101 GLY HXT H N N 102 ILE N N N N 103 ILE CA C N S 104 ILE C C N N 105 ILE O O N N 106 ILE CB C N S 107 ILE CG1 C N N 108 ILE CG2 C N N 109 ILE CD1 C N N 110 ILE OXT O N N 111 ILE H H N N 112 ILE H2 H N N 113 ILE HA H N N 114 ILE HB H N N 115 ILE HG12 H N N 116 ILE HG13 H N N 117 ILE HG21 H N N 118 ILE HG22 H N N 119 ILE HG23 H N N 120 ILE HD11 H N N 121 ILE HD12 H N N 122 ILE HD13 H N N 123 ILE HXT H N N 124 LEU N N N N 125 LEU CA C N S 126 LEU C C N N 127 LEU O O N N 128 LEU CB C N N 129 LEU CG C N N 130 LEU CD1 C N N 131 LEU CD2 C N N 132 LEU OXT O N N 133 LEU H H N N 134 LEU H2 H N N 135 LEU HA H N N 136 LEU HB2 H N N 137 LEU HB3 H N N 138 LEU HG H N N 139 LEU HD11 H N N 140 LEU HD12 H N N 141 LEU HD13 H N N 142 LEU HD21 H N N 143 LEU HD22 H N N 144 LEU HD23 H N N 145 LEU HXT H N N 146 LYS N N N N 147 LYS CA C N S 148 LYS C C N N 149 LYS O O N N 150 LYS CB C N N 151 LYS CG C N N 152 LYS CD C N N 153 LYS CE C N N 154 LYS NZ N N N 155 LYS OXT O N N 156 LYS H H N N 157 LYS H2 H N N 158 LYS HA H N N 159 LYS HB2 H N N 160 LYS HB3 H N N 161 LYS HG2 H N N 162 LYS HG3 H N N 163 LYS HD2 H N N 164 LYS HD3 H N N 165 LYS HE2 H N N 166 LYS HE3 H N N 167 LYS HZ1 H N N 168 LYS HZ2 H N N 169 LYS HZ3 H N N 170 LYS HXT H N N 171 MET N N N N 172 MET CA C N S 173 MET C C N N 174 MET O O N N 175 MET CB C N N 176 MET CG C N N 177 MET SD S N N 178 MET CE C N N 179 MET OXT O N N 180 MET H H N N 181 MET H2 H N N 182 MET HA H N N 183 MET HB2 H N N 184 MET HB3 H N N 185 MET HG2 H N N 186 MET HG3 H N N 187 MET HE1 H N N 188 MET HE2 H N N 189 MET HE3 H N N 190 MET HXT H N N 191 PRO N N N N 192 PRO CA C N S 193 PRO C C N N 194 PRO O O N N 195 PRO CB C N N 196 PRO CG C N N 197 PRO CD C N N 198 PRO OXT O N N 199 PRO H H N N 200 PRO HA H N N 201 PRO HB2 H N N 202 PRO HB3 H N N 203 PRO HG2 H N N 204 PRO HG3 H N N 205 PRO HD2 H N N 206 PRO HD3 H N N 207 PRO HXT H N N 208 SER N N N N 209 SER CA C N S 210 SER C C N N 211 SER O O N N 212 SER CB C N N 213 SER OG O N N 214 SER OXT O N N 215 SER H H N N 216 SER H2 H N N 217 SER HA H N N 218 SER HB2 H N N 219 SER HB3 H N N 220 SER HG H N N 221 SER HXT H N N 222 THR N N N N 223 THR CA C N S 224 THR C C N N 225 THR O O N N 226 THR CB C N R 227 THR OG1 O N N 228 THR CG2 C N N 229 THR OXT O N N 230 THR H H N N 231 THR H2 H N N 232 THR HA H N N 233 THR HB H N N 234 THR HG1 H N N 235 THR HG21 H N N 236 THR HG22 H N N 237 THR HG23 H N N 238 THR HXT H N N 239 TYR N N N N 240 TYR CA C N S 241 TYR C C N N 242 TYR O O N N 243 TYR CB C N N 244 TYR CG C Y N 245 TYR CD1 C Y N 246 TYR CD2 C Y N 247 TYR CE1 C Y N 248 TYR CE2 C Y N 249 TYR CZ C Y N 250 TYR OH O N N 251 TYR OXT O N N 252 TYR H H N N 253 TYR H2 H N N 254 TYR HA H N N 255 TYR HB2 H N N 256 TYR HB3 H N N 257 TYR HD1 H N N 258 TYR HD2 H N N 259 TYR HE1 H N N 260 TYR HE2 H N N 261 TYR HH H N N 262 TYR HXT H N N 263 VAL N N N N 264 VAL CA C N S 265 VAL C C N N 266 VAL O O N N 267 VAL CB C N N 268 VAL CG1 C N N 269 VAL CG2 C N N 270 VAL OXT O N N 271 VAL H H N N 272 VAL H2 H N N 273 VAL HA H N N 274 VAL HB H N N 275 VAL HG11 H N N 276 VAL HG12 H N N 277 VAL HG13 H N N 278 VAL HG21 H N N 279 VAL HG22 H N N 280 VAL HG23 H N N 281 VAL HXT H N N 282 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLU N CA sing N N 70 GLU N H sing N N 71 GLU N H2 sing N N 72 GLU CA C sing N N 73 GLU CA CB sing N N 74 GLU CA HA sing N N 75 GLU C O doub N N 76 GLU C OXT sing N N 77 GLU CB CG sing N N 78 GLU CB HB2 sing N N 79 GLU CB HB3 sing N N 80 GLU CG CD sing N N 81 GLU CG HG2 sing N N 82 GLU CG HG3 sing N N 83 GLU CD OE1 doub N N 84 GLU CD OE2 sing N N 85 GLU OE2 HE2 sing N N 86 GLU OXT HXT sing N N 87 GLY N CA sing N N 88 GLY N H sing N N 89 GLY N H2 sing N N 90 GLY CA C sing N N 91 GLY CA HA2 sing N N 92 GLY CA HA3 sing N N 93 GLY C O doub N N 94 GLY C OXT sing N N 95 GLY OXT HXT sing N N 96 ILE N CA sing N N 97 ILE N H sing N N 98 ILE N H2 sing N N 99 ILE CA C sing N N 100 ILE CA CB sing N N 101 ILE CA HA sing N N 102 ILE C O doub N N 103 ILE C OXT sing N N 104 ILE CB CG1 sing N N 105 ILE CB CG2 sing N N 106 ILE CB HB sing N N 107 ILE CG1 CD1 sing N N 108 ILE CG1 HG12 sing N N 109 ILE CG1 HG13 sing N N 110 ILE CG2 HG21 sing N N 111 ILE CG2 HG22 sing N N 112 ILE CG2 HG23 sing N N 113 ILE CD1 HD11 sing N N 114 ILE CD1 HD12 sing N N 115 ILE CD1 HD13 sing N N 116 ILE OXT HXT sing N N 117 LEU N CA sing N N 118 LEU N H sing N N 119 LEU N H2 sing N N 120 LEU CA C sing N N 121 LEU CA CB sing N N 122 LEU CA HA sing N N 123 LEU C O doub N N 124 LEU C OXT sing N N 125 LEU CB CG sing N N 126 LEU CB HB2 sing N N 127 LEU CB HB3 sing N N 128 LEU CG CD1 sing N N 129 LEU CG CD2 sing N N 130 LEU CG HG sing N N 131 LEU CD1 HD11 sing N N 132 LEU CD1 HD12 sing N N 133 LEU CD1 HD13 sing N N 134 LEU CD2 HD21 sing N N 135 LEU CD2 HD22 sing N N 136 LEU CD2 HD23 sing N N 137 LEU OXT HXT sing N N 138 LYS N CA sing N N 139 LYS N H sing N N 140 LYS N H2 sing N N 141 LYS CA C sing N N 142 LYS CA CB sing N N 143 LYS CA HA sing N N 144 LYS C O doub N N 145 LYS C OXT sing N N 146 LYS CB CG sing N N 147 LYS CB HB2 sing N N 148 LYS CB HB3 sing N N 149 LYS CG CD sing N N 150 LYS CG HG2 sing N N 151 LYS CG HG3 sing N N 152 LYS CD CE sing N N 153 LYS CD HD2 sing N N 154 LYS CD HD3 sing N N 155 LYS CE NZ sing N N 156 LYS CE HE2 sing N N 157 LYS CE HE3 sing N N 158 LYS NZ HZ1 sing N N 159 LYS NZ HZ2 sing N N 160 LYS NZ HZ3 sing N N 161 LYS OXT HXT sing N N 162 MET N CA sing N N 163 MET N H sing N N 164 MET N H2 sing N N 165 MET CA C sing N N 166 MET CA CB sing N N 167 MET CA HA sing N N 168 MET C O doub N N 169 MET C OXT sing N N 170 MET CB CG sing N N 171 MET CB HB2 sing N N 172 MET CB HB3 sing N N 173 MET CG SD sing N N 174 MET CG HG2 sing N N 175 MET CG HG3 sing N N 176 MET SD CE sing N N 177 MET CE HE1 sing N N 178 MET CE HE2 sing N N 179 MET CE HE3 sing N N 180 MET OXT HXT sing N N 181 PRO N CA sing N N 182 PRO N CD sing N N 183 PRO N H sing N N 184 PRO CA C sing N N 185 PRO CA CB sing N N 186 PRO CA HA sing N N 187 PRO C O doub N N 188 PRO C OXT sing N N 189 PRO CB CG sing N N 190 PRO CB HB2 sing N N 191 PRO CB HB3 sing N N 192 PRO CG CD sing N N 193 PRO CG HG2 sing N N 194 PRO CG HG3 sing N N 195 PRO CD HD2 sing N N 196 PRO CD HD3 sing N N 197 PRO OXT HXT sing N N 198 SER N CA sing N N 199 SER N H sing N N 200 SER N H2 sing N N 201 SER CA C sing N N 202 SER CA CB sing N N 203 SER CA HA sing N N 204 SER C O doub N N 205 SER C OXT sing N N 206 SER CB OG sing N N 207 SER CB HB2 sing N N 208 SER CB HB3 sing N N 209 SER OG HG sing N N 210 SER OXT HXT sing N N 211 THR N CA sing N N 212 THR N H sing N N 213 THR N H2 sing N N 214 THR CA C sing N N 215 THR CA CB sing N N 216 THR CA HA sing N N 217 THR C O doub N N 218 THR C OXT sing N N 219 THR CB OG1 sing N N 220 THR CB CG2 sing N N 221 THR CB HB sing N N 222 THR OG1 HG1 sing N N 223 THR CG2 HG21 sing N N 224 THR CG2 HG22 sing N N 225 THR CG2 HG23 sing N N 226 THR OXT HXT sing N N 227 TYR N CA sing N N 228 TYR N H sing N N 229 TYR N H2 sing N N 230 TYR CA C sing N N 231 TYR CA CB sing N N 232 TYR CA HA sing N N 233 TYR C O doub N N 234 TYR C OXT sing N N 235 TYR CB CG sing N N 236 TYR CB HB2 sing N N 237 TYR CB HB3 sing N N 238 TYR CG CD1 doub Y N 239 TYR CG CD2 sing Y N 240 TYR CD1 CE1 sing Y N 241 TYR CD1 HD1 sing N N 242 TYR CD2 CE2 doub Y N 243 TYR CD2 HD2 sing N N 244 TYR CE1 CZ doub Y N 245 TYR CE1 HE1 sing N N 246 TYR CE2 CZ sing Y N 247 TYR CE2 HE2 sing N N 248 TYR CZ OH sing N N 249 TYR OH HH sing N N 250 TYR OXT HXT sing N N 251 VAL N CA sing N N 252 VAL N H sing N N 253 VAL N H2 sing N N 254 VAL CA C sing N N 255 VAL CA CB sing N N 256 VAL CA HA sing N N 257 VAL C O doub N N 258 VAL C OXT sing N N 259 VAL CB CG1 sing N N 260 VAL CB CG2 sing N N 261 VAL CB HB sing N N 262 VAL CG1 HG11 sing N N 263 VAL CG1 HG12 sing N N 264 VAL CG1 HG13 sing N N 265 VAL CG2 HG21 sing N N 266 VAL CG2 HG22 sing N N 267 VAL CG2 HG23 sing N N 268 VAL OXT HXT sing N N 269 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 1Z0R _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_