data_1Z5F # _entry.id 1Z5F # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1Z5F pdb_00001z5f 10.2210/pdb1z5f/pdb RCSB RCSB032320 ? ? WWPDB D_1000032320 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-02-28 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 2 0 2019-12-25 5 'Structure model' 2 1 2024-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Polymer sequence' 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' 9 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' citation 2 4 'Structure model' citation_author 3 4 'Structure model' entity_poly 4 4 'Structure model' pdbx_nmr_software 5 4 'Structure model' pdbx_struct_assembly 6 4 'Structure model' pdbx_struct_assembly_prop 7 4 'Structure model' pdbx_struct_mod_residue 8 4 'Structure model' pdbx_struct_oper_list 9 4 'Structure model' struct_conn 10 4 'Structure model' struct_ref_seq_dif 11 5 'Structure model' chem_comp_atom 12 5 'Structure model' chem_comp_bond 13 5 'Structure model' database_2 14 5 'Structure model' pdbx_entry_details 15 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation.pdbx_database_id_DOI' 2 4 'Structure model' '_citation.pdbx_database_id_PubMed' 3 4 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_pdbx_struct_mod_residue.parent_comp_id' 6 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 7 5 'Structure model' '_database_2.pdbx_DOI' 8 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1Z5F _pdbx_database_status.recvd_initial_deposition_date 2005-03-18 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1KVZ _pdbx_database_related.details 'Solution Structure Of Cytotoxic Rc-Rnase4' _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lou, Y.C.' 1 ? 'Huang, Y.C.' 2 ? 'Pan, Y.R.' 3 ? 'Chen, C.' 4 ? 'Liao, Y.D.' 5 ? # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Roles of N-terminal pyroglutamate in maintaining structural integrity and pKa values of catalytic histidine residues in bullfrog ribonuclease 3 ; J.Mol.Biol. 355 409 421 2006 JMOBAK UK 0022-2836 0070 ? 16309702 10.1016/j.jmb.2005.10.069 1 'Solution Structure of the Cytotoxic RNase 4 from OOcytes of Bullfrog Rana catesbeiana' J.Mol.Biol. 326 1189 1201 2003 JMOBAK UK 0022-2836 0070 ? 12589762 '10.1016/s0022-2836(02)01472-9' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lou, Y.C.' 1 ? primary 'Huang, Y.C.' 2 ? primary 'Pan, Y.R.' 3 ? primary 'Chen, C.' 4 ? primary 'Liao, Y.D.' 5 ? 1 'Hsu, C.H.' 6 ? 1 'Liao, Y.D.' 7 ? 1 'Chen, L.W.' 8 ? 1 'Wu, S.H.' 9 ? 1 'Leu, Y.J.' 10 ? 1 'Chen, C.' 11 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'RC-RNase 3' _entity.formula_weight 11894.911 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RC-RNase3 ribonuclease' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(PCA)DWETFQKKHLTDTKKVKCDVEMAKALFDCKKTNTFIYALPGRVKALCKNIRDNTDVLSRDAFLLPQCDRIKLPCH YKLSSSTNTICITCVNQLPIHFAGVGSCP ; _entity_poly.pdbx_seq_one_letter_code_can ;QDWETFQKKHLTDTKKVKCDVEMAKALFDCKKTNTFIYALPGRVKALCKNIRDNTDVLSRDAFLLPQCDRIKLPCHYKLS SSTNTICITCVNQLPIHFAGVGSCP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PCA n 1 2 ASP n 1 3 TRP n 1 4 GLU n 1 5 THR n 1 6 PHE n 1 7 GLN n 1 8 LYS n 1 9 LYS n 1 10 HIS n 1 11 LEU n 1 12 THR n 1 13 ASP n 1 14 THR n 1 15 LYS n 1 16 LYS n 1 17 VAL n 1 18 LYS n 1 19 CYS n 1 20 ASP n 1 21 VAL n 1 22 GLU n 1 23 MET n 1 24 ALA n 1 25 LYS n 1 26 ALA n 1 27 LEU n 1 28 PHE n 1 29 ASP n 1 30 CYS n 1 31 LYS n 1 32 LYS n 1 33 THR n 1 34 ASN n 1 35 THR n 1 36 PHE n 1 37 ILE n 1 38 TYR n 1 39 ALA n 1 40 LEU n 1 41 PRO n 1 42 GLY n 1 43 ARG n 1 44 VAL n 1 45 LYS n 1 46 ALA n 1 47 LEU n 1 48 CYS n 1 49 LYS n 1 50 ASN n 1 51 ILE n 1 52 ARG n 1 53 ASP n 1 54 ASN n 1 55 THR n 1 56 ASP n 1 57 VAL n 1 58 LEU n 1 59 SER n 1 60 ARG n 1 61 ASP n 1 62 ALA n 1 63 PHE n 1 64 LEU n 1 65 LEU n 1 66 PRO n 1 67 GLN n 1 68 CYS n 1 69 ASP n 1 70 ARG n 1 71 ILE n 1 72 LYS n 1 73 LEU n 1 74 PRO n 1 75 CYS n 1 76 HIS n 1 77 TYR n 1 78 LYS n 1 79 LEU n 1 80 SER n 1 81 SER n 1 82 SER n 1 83 THR n 1 84 ASN n 1 85 THR n 1 86 ILE n 1 87 CYS n 1 88 ILE n 1 89 THR n 1 90 CYS n 1 91 VAL n 1 92 ASN n 1 93 GLN n 1 94 LEU n 1 95 PRO n 1 96 ILE n 1 97 HIS n 1 98 PHE n 1 99 ALA n 1 100 GLY n 1 101 VAL n 1 102 GLY n 1 103 SER n 1 104 CYS n 1 105 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name bullfrog _entity_src_gen.gene_src_genus Rana _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rana catesbeiana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 8400 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue Oocyte _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET11d _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PCA 'L-peptide linking' n 'PYROGLUTAMIC ACID' ? 'C5 H7 N O3' 129.114 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PCA 1 1 1 PCA PCA A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 TRP 3 3 3 TRP TRP A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 MET 23 23 23 MET MET A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 CYS 68 68 68 CYS CYS A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 CYS 75 75 75 CYS CYS A . n A 1 76 HIS 76 76 76 HIS HIS A . n A 1 77 TYR 77 77 77 TYR TYR A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 CYS 87 87 87 CYS CYS A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 CYS 90 90 90 CYS CYS A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 HIS 97 97 97 HIS HIS A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 CYS 104 104 104 CYS CYS A . n A 1 105 PRO 105 105 105 PRO PRO A . n # _exptl.entry_id 1Z5F _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1Z5F _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1Z5F _struct.title 'Solution Structure of the Cytotoxic RC-RNase 3 with a Pyroglutamate Residue at the N-terminus' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1Z5F _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'ribonuclease, pyroglutamate, cytotoxicity, bullfrog, Hydrolase' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name GB _struct_ref.db_code AAG31440 _struct_ref.pdbx_db_accession 15111749 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QDWETFQKKHLTDTKKVKCDVEMAKALFDCKKTNTFIYALPGRVKALCKNIRDNTDVLSRDAFLLPQCDRIKLPCHYKLS SSTNTICITCVNQLPIHFAGVGSCP ; _struct_ref.pdbx_align_begin 24 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1Z5F _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 105 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 15111749 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 128 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 105 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 6630 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 2 ? LYS A 9 ? ASP A 2 LYS A 9 1 ? 8 HELX_P HELX_P2 2 LYS A 18 ? LYS A 25 ? LYS A 18 LYS A 25 1 ? 8 HELX_P HELX_P3 3 LEU A 40 ? LEU A 47 ? LEU A 40 LEU A 47 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 19 SG ? ? ? 1_555 A CYS 68 SG ? ? A CYS 19 A CYS 68 1_555 ? ? ? ? ? ? ? 2.007 ? ? disulf2 disulf ? ? A CYS 30 SG ? ? ? 1_555 A CYS 75 SG ? ? A CYS 30 A CYS 75 1_555 ? ? ? ? ? ? ? 2.034 ? ? disulf3 disulf ? ? A CYS 48 SG ? ? ? 1_555 A CYS 90 SG ? ? A CYS 48 A CYS 90 1_555 ? ? ? ? ? ? ? 2.022 ? ? disulf4 disulf ? ? A CYS 87 SG ? ? ? 1_555 A CYS 104 SG ? ? A CYS 87 A CYS 104 1_555 ? ? ? ? ? ? ? 2.020 ? ? covale1 covale both ? A PCA 1 C ? ? ? 1_555 A ASP 2 N ? ? A PCA 1 A ASP 2 1_555 ? ? ? ? ? ? ? 1.303 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 PCA A 1 ? . . . . PCA A 1 ? 1_555 . . . . . . . GLN 1 PCA 'Pyrrolidone carboxylic acid' 'Named protein modification' 2 CYS A 19 ? CYS A 68 ? CYS A 19 ? 1_555 CYS A 68 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 30 ? CYS A 75 ? CYS A 30 ? 1_555 CYS A 75 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 48 ? CYS A 90 ? CYS A 48 ? 1_555 CYS A 90 ? 1_555 SG SG . . . None 'Disulfide bridge' 5 CYS A 87 ? CYS A 104 ? CYS A 87 ? 1_555 CYS A 104 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 33 ? THR A 35 ? THR A 33 THR A 35 A 2 PHE A 63 ? ASP A 69 ? PHE A 63 ASP A 69 A 3 LYS A 78 ? ASN A 84 ? LYS A 78 ASN A 84 B 1 THR A 55 ? LEU A 58 ? THR A 55 LEU A 58 B 2 CYS A 87 ? CYS A 90 ? CYS A 87 CYS A 90 B 3 PRO A 95 ? GLY A 100 ? PRO A 95 GLY A 100 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ASN A 34 ? N ASN A 34 O CYS A 68 ? O CYS A 68 A 2 3 N GLN A 67 ? N GLN A 67 O SER A 80 ? O SER A 80 B 1 2 N VAL A 57 ? N VAL A 57 O ILE A 88 ? O ILE A 88 B 2 3 N THR A 89 ? N THR A 89 O HIS A 97 ? O HIS A 97 # _pdbx_entry_details.entry_id 1Z5F _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 HD21 A ASN 34 ? ? H A THR 35 ? ? 1.27 2 2 OD1 A ASP 61 ? ? H A ALA 62 ? ? 1.56 3 6 OD1 A ASP 2 ? ? H A GLU 4 ? ? 1.49 4 7 HG A SER 59 ? ? H A ASP 61 ? ? 1.24 5 7 OG1 A THR 5 ? ? HZ1 A LYS 9 ? ? 1.54 6 11 O A ASP 61 ? ? HG1 A THR 85 ? ? 1.54 7 13 HZ2 A LYS 9 ? ? HE2 A HIS 10 ? ? 1.35 8 16 OG1 A THR 5 ? ? HZ1 A LYS 9 ? ? 1.52 9 18 O A LEU 65 ? ? HG A SER 81 ? ? 1.54 10 19 O A LYS 31 ? ? HH21 A ARG 70 ? ? 1.53 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 4 ? ? -62.29 -79.17 2 1 LYS A 16 ? ? -116.17 64.36 3 1 LYS A 25 ? ? -60.68 -131.72 4 1 ASP A 29 ? ? 86.11 37.89 5 1 CYS A 30 ? ? 54.40 70.53 6 1 LYS A 31 ? ? -77.55 -129.72 7 1 LYS A 32 ? ? -142.51 -32.61 8 1 LEU A 47 ? ? -69.95 0.01 9 1 ASN A 50 ? ? 75.21 -10.91 10 1 ASP A 53 ? ? -60.51 -148.68 11 1 ASP A 61 ? ? -160.48 -94.91 12 1 LEU A 73 ? ? 52.90 174.95 13 1 VAL A 91 ? ? -91.40 -147.27 14 1 GLN A 93 ? ? 179.79 42.58 15 1 ILE A 96 ? ? -142.62 -7.31 16 1 ALA A 99 ? ? -57.96 -74.66 17 2 GLU A 4 ? ? -62.54 -79.31 18 2 VAL A 17 ? ? -51.99 173.98 19 2 CYS A 19 ? ? -29.57 -43.42 20 2 GLU A 22 ? ? -55.40 -6.46 21 2 LYS A 25 ? ? -51.44 -171.01 22 2 ASP A 29 ? ? 71.22 35.71 23 2 LYS A 31 ? ? -68.54 -139.45 24 2 LYS A 32 ? ? -133.76 -33.62 25 2 ASN A 50 ? ? 59.80 -1.73 26 2 ASP A 53 ? ? -59.81 -147.75 27 2 ASP A 61 ? ? -151.92 -69.25 28 2 LEU A 73 ? ? 61.00 174.69 29 2 VAL A 91 ? ? -84.14 -148.58 30 2 GLN A 93 ? ? -179.99 48.21 31 2 ILE A 96 ? ? -142.38 -7.16 32 2 ALA A 99 ? ? -62.12 -72.86 33 2 SER A 103 ? ? -171.13 144.61 34 3 GLU A 4 ? ? -60.25 -76.27 35 3 VAL A 17 ? ? -51.93 170.37 36 3 GLU A 22 ? ? -55.19 -3.47 37 3 LYS A 25 ? ? -55.46 -163.71 38 3 ASP A 29 ? ? 84.67 36.12 39 3 LYS A 31 ? ? -70.06 -142.76 40 3 LYS A 32 ? ? -137.67 -32.44 41 3 ASN A 50 ? ? 73.98 -12.39 42 3 ARG A 52 ? ? -100.19 -162.65 43 3 ASP A 53 ? ? -58.89 -151.68 44 3 ASP A 61 ? ? -118.28 -74.71 45 3 ILE A 71 ? ? -138.60 -35.90 46 3 LEU A 73 ? ? 53.17 174.27 47 3 VAL A 91 ? ? -83.03 -152.32 48 3 GLN A 93 ? ? -177.50 47.36 49 3 ILE A 96 ? ? -143.66 -25.32 50 3 ALA A 99 ? ? -63.51 -72.25 51 4 GLU A 4 ? ? -62.87 -79.73 52 4 THR A 12 ? ? -126.99 -166.96 53 4 VAL A 17 ? ? -52.02 172.23 54 4 LYS A 18 ? ? -100.84 66.74 55 4 GLU A 22 ? ? -55.77 -7.06 56 4 ALA A 24 ? ? -68.51 4.89 57 4 LYS A 25 ? ? -53.39 -165.74 58 4 ASP A 29 ? ? 79.94 41.98 59 4 LYS A 31 ? ? -63.59 -142.06 60 4 LYS A 32 ? ? -137.46 -32.36 61 4 ASN A 50 ? ? 74.39 -4.06 62 4 ASP A 53 ? ? -65.33 -144.98 63 4 ASP A 61 ? ? -162.21 -91.35 64 4 ILE A 71 ? ? -165.78 -37.88 65 4 LEU A 73 ? ? 52.81 174.24 66 4 VAL A 91 ? ? -98.47 -143.79 67 4 GLN A 93 ? ? -179.37 42.30 68 4 ILE A 96 ? ? -142.84 -4.68 69 5 ASP A 2 ? ? -170.93 128.39 70 5 GLU A 4 ? ? -61.99 -78.69 71 5 LYS A 16 ? ? -116.02 65.83 72 5 VAL A 17 ? ? -52.00 170.91 73 5 GLU A 22 ? ? -56.52 -5.84 74 5 ALA A 24 ? ? -69.01 4.78 75 5 LYS A 25 ? ? -52.17 -170.41 76 5 ASP A 29 ? ? 75.31 36.20 77 5 LYS A 31 ? ? -69.89 -139.10 78 5 ILE A 51 ? ? -108.87 -107.11 79 5 ASP A 53 ? ? -89.48 -151.07 80 5 ASP A 61 ? ? -170.55 -88.53 81 5 LEU A 73 ? ? 58.11 174.57 82 5 VAL A 91 ? ? -99.76 -144.83 83 5 GLN A 93 ? ? -173.91 44.11 84 5 ILE A 96 ? ? -145.11 -5.55 85 5 ALA A 99 ? ? -63.38 -78.86 86 6 ASP A 2 ? ? -173.74 123.84 87 6 GLU A 4 ? ? -63.25 -79.67 88 6 LYS A 16 ? ? -114.87 59.87 89 6 GLU A 22 ? ? -56.48 -4.35 90 6 MET A 23 ? ? -135.87 -45.65 91 6 LYS A 25 ? ? -60.64 -132.04 92 6 PHE A 28 ? ? -120.59 -50.97 93 6 ASP A 29 ? ? 87.16 37.43 94 6 CYS A 30 ? ? 55.84 72.24 95 6 LYS A 31 ? ? -79.63 -135.55 96 6 LYS A 32 ? ? -137.74 -30.53 97 6 ASN A 50 ? ? 77.12 -6.60 98 6 ASP A 53 ? ? -66.28 -145.70 99 6 ASP A 61 ? ? -160.50 -90.44 100 6 ILE A 71 ? ? -146.68 -37.97 101 6 LEU A 73 ? ? 50.72 174.87 102 6 VAL A 91 ? ? -94.61 -143.84 103 6 GLN A 93 ? ? -179.06 42.71 104 6 ILE A 96 ? ? -149.40 -2.97 105 6 ALA A 99 ? ? -58.57 -70.95 106 7 GLU A 4 ? ? -61.34 -77.20 107 7 LYS A 16 ? ? -112.41 68.62 108 7 GLU A 22 ? ? -55.47 -7.01 109 7 ALA A 24 ? ? -67.56 4.69 110 7 LYS A 25 ? ? -51.06 -171.70 111 7 ASP A 29 ? ? 72.44 41.76 112 7 LYS A 31 ? ? -68.76 -134.48 113 7 LYS A 32 ? ? -134.73 -31.09 114 7 ASN A 50 ? ? 78.50 32.80 115 7 ARG A 52 ? ? -109.65 -78.49 116 7 ASP A 53 ? ? -144.22 -150.69 117 7 ASP A 61 ? ? -165.08 -92.51 118 7 ILE A 71 ? ? -168.18 -28.97 119 7 LEU A 73 ? ? 60.75 174.51 120 7 CYS A 75 ? ? -163.96 74.89 121 7 VAL A 91 ? ? -138.80 -116.49 122 7 ASN A 92 ? ? -69.60 41.19 123 7 GLN A 93 ? ? 81.45 44.60 124 7 ILE A 96 ? ? -140.62 -19.17 125 7 ALA A 99 ? ? -68.59 -71.81 126 8 GLU A 4 ? ? -61.80 -78.24 127 8 LYS A 16 ? ? -116.15 68.69 128 8 CYS A 19 ? ? -28.76 -39.01 129 8 GLU A 22 ? ? -55.57 -6.65 130 8 LYS A 25 ? ? -53.89 -168.31 131 8 ASP A 29 ? ? 80.15 37.81 132 8 LYS A 31 ? ? -62.20 -140.46 133 8 LYS A 32 ? ? -139.63 -38.98 134 8 LEU A 47 ? ? -58.50 -8.61 135 8 ASN A 50 ? ? 73.57 -4.48 136 8 ARG A 52 ? ? -97.36 -147.25 137 8 ASP A 53 ? ? -77.67 -147.18 138 8 ASP A 61 ? ? -152.16 -92.79 139 8 ILE A 71 ? ? -169.70 -30.89 140 8 LEU A 73 ? ? 54.41 174.96 141 8 VAL A 91 ? ? -86.54 -144.71 142 8 GLN A 93 ? ? -178.41 49.48 143 8 ILE A 96 ? ? -141.76 -9.76 144 8 CYS A 104 ? ? -48.34 154.13 145 9 ASP A 2 ? ? -176.36 120.63 146 9 GLU A 4 ? ? -63.66 -77.89 147 9 LYS A 16 ? ? -116.43 61.75 148 9 GLU A 22 ? ? -56.67 -7.31 149 9 MET A 23 ? ? -131.69 -48.24 150 9 LYS A 25 ? ? -60.00 -138.37 151 9 ASP A 29 ? ? 90.94 37.98 152 9 LYS A 31 ? ? -78.42 -132.99 153 9 LYS A 32 ? ? -140.75 -31.28 154 9 LEU A 47 ? ? -53.97 -4.66 155 9 ILE A 51 ? ? -98.56 -103.83 156 9 ARG A 52 ? ? -143.40 -78.43 157 9 ASP A 53 ? ? -170.13 -153.73 158 9 ASP A 61 ? ? -168.55 -83.74 159 9 ILE A 71 ? ? -160.46 -34.74 160 9 LEU A 73 ? ? 53.54 174.16 161 9 VAL A 91 ? ? -123.76 -141.01 162 9 GLN A 93 ? ? 179.54 50.64 163 9 ILE A 96 ? ? -141.94 -7.73 164 9 ALA A 99 ? ? -64.93 -70.22 165 10 ASP A 2 ? ? -170.38 127.32 166 10 GLU A 4 ? ? -63.78 -79.07 167 10 LYS A 16 ? ? -119.84 65.11 168 10 GLU A 22 ? ? -53.13 -7.59 169 10 MET A 23 ? ? -135.47 -46.94 170 10 LYS A 25 ? ? -60.92 -130.80 171 10 PHE A 28 ? ? -122.45 -53.74 172 10 ASP A 29 ? ? 87.94 42.12 173 10 CYS A 30 ? ? 53.71 70.96 174 10 LYS A 31 ? ? -78.23 -130.31 175 10 LYS A 32 ? ? -142.98 -33.21 176 10 ASN A 50 ? ? 74.99 -4.20 177 10 ARG A 52 ? ? -99.66 -159.70 178 10 ASP A 53 ? ? -62.88 -146.96 179 10 ASP A 61 ? ? -162.40 -88.71 180 10 ILE A 71 ? ? -147.35 -37.54 181 10 LEU A 73 ? ? 51.45 174.93 182 10 VAL A 91 ? ? -79.89 -151.22 183 10 GLN A 93 ? ? 179.63 47.11 184 10 ALA A 99 ? ? -66.23 -71.52 185 11 ASP A 2 ? ? -172.50 117.44 186 11 GLU A 4 ? ? -63.31 -80.33 187 11 LYS A 16 ? ? -115.87 64.61 188 11 CYS A 19 ? ? -33.15 -39.33 189 11 GLU A 22 ? ? -56.90 -4.91 190 11 LYS A 25 ? ? -51.94 -168.29 191 11 ASP A 29 ? ? 74.16 37.83 192 11 LYS A 31 ? ? -70.59 -147.15 193 11 CYS A 48 ? ? -142.38 48.87 194 11 ARG A 52 ? ? -98.18 -117.59 195 11 ASP A 53 ? ? -101.46 -145.52 196 11 ASP A 61 ? ? -142.39 -65.23 197 11 ILE A 71 ? ? -171.66 -40.48 198 11 LEU A 73 ? ? 46.67 174.47 199 11 VAL A 91 ? ? -137.21 -110.93 200 11 ASN A 92 ? ? -70.49 40.41 201 11 GLN A 93 ? ? 76.66 51.20 202 11 ILE A 96 ? ? -143.87 -6.05 203 11 ALA A 99 ? ? -57.93 -77.02 204 12 ASP A 2 ? ? -171.27 117.83 205 12 GLU A 4 ? ? -66.89 -83.52 206 12 LYS A 16 ? ? -118.35 66.09 207 12 VAL A 17 ? ? -51.97 171.23 208 12 CYS A 19 ? ? -33.89 -37.49 209 12 GLU A 22 ? ? -55.91 -6.43 210 12 ALA A 24 ? ? -68.80 5.49 211 12 LYS A 25 ? ? -53.39 -165.76 212 12 ASP A 29 ? ? 79.20 41.72 213 12 LYS A 31 ? ? -63.46 -142.99 214 12 CYS A 48 ? ? -96.60 43.45 215 12 ASN A 50 ? ? 51.96 13.87 216 12 ARG A 52 ? ? -118.60 -166.78 217 12 ASP A 53 ? ? -57.72 -149.83 218 12 ASP A 61 ? ? -175.17 -89.33 219 12 ILE A 71 ? ? -147.02 -36.01 220 12 LEU A 73 ? ? 59.13 174.66 221 12 VAL A 91 ? ? -95.41 -140.09 222 12 GLN A 93 ? ? -178.31 52.66 223 12 ILE A 96 ? ? -144.10 -7.79 224 12 ALA A 99 ? ? -58.07 -77.82 225 13 ASP A 2 ? ? -173.17 127.62 226 13 GLU A 4 ? ? -64.26 -80.70 227 13 CYS A 19 ? ? -32.97 -39.31 228 13 GLU A 22 ? ? -55.39 -6.23 229 13 MET A 23 ? ? -130.40 -43.87 230 13 LYS A 25 ? ? -56.88 -162.21 231 13 ASP A 29 ? ? 78.05 38.53 232 13 LYS A 31 ? ? -68.05 -139.13 233 13 LYS A 32 ? ? -140.82 -32.74 234 13 ASN A 50 ? ? 68.54 -9.28 235 13 ARG A 52 ? ? -94.88 -154.49 236 13 ASP A 53 ? ? -71.73 -149.82 237 13 ASP A 61 ? ? -170.57 -90.00 238 13 LEU A 73 ? ? 64.30 174.69 239 13 PRO A 74 ? ? -80.09 -74.18 240 13 CYS A 75 ? ? -111.50 51.61 241 13 VAL A 91 ? ? -93.35 -144.89 242 13 GLN A 93 ? ? -174.95 48.21 243 14 ASP A 2 ? ? 179.88 130.73 244 14 GLU A 4 ? ? -61.61 -76.83 245 14 LYS A 16 ? ? -116.47 67.47 246 14 CYS A 19 ? ? -31.34 -34.16 247 14 ALA A 24 ? ? -66.34 2.21 248 14 LYS A 25 ? ? -57.31 -160.35 249 14 ASP A 29 ? ? 79.87 46.33 250 14 LYS A 31 ? ? -63.27 -145.08 251 14 LYS A 32 ? ? -135.17 -31.24 252 14 ASN A 50 ? ? 73.73 -23.95 253 14 ILE A 51 ? ? -55.45 178.02 254 14 ASP A 53 ? ? -170.06 -159.13 255 14 ASP A 61 ? ? -166.65 -90.39 256 14 LEU A 73 ? ? 58.64 174.30 257 14 VAL A 91 ? ? -84.30 -143.60 258 14 GLN A 93 ? ? -173.67 47.82 259 14 ILE A 96 ? ? -145.28 -14.72 260 14 ALA A 99 ? ? -60.91 -74.56 261 15 ASP A 2 ? ? -178.00 110.65 262 15 GLU A 4 ? ? -62.86 -79.61 263 15 THR A 12 ? ? -126.71 -164.27 264 15 LYS A 18 ? ? -100.02 67.27 265 15 CYS A 19 ? ? -29.51 -41.36 266 15 MET A 23 ? ? -131.24 -46.25 267 15 LYS A 25 ? ? -56.31 -163.61 268 15 ASP A 29 ? ? 86.25 32.98 269 15 LYS A 31 ? ? -67.10 -136.62 270 15 LYS A 32 ? ? -142.29 -33.22 271 15 LEU A 47 ? ? -59.51 -0.03 272 15 ASN A 50 ? ? 75.79 -4.48 273 15 ARG A 52 ? ? -101.58 -161.36 274 15 ASP A 53 ? ? -58.65 -150.02 275 15 ASP A 61 ? ? -148.06 -64.66 276 15 ILE A 71 ? ? -141.26 -36.25 277 15 LEU A 73 ? ? 60.26 174.67 278 15 VAL A 91 ? ? -70.30 -152.73 279 15 GLN A 93 ? ? -178.62 47.89 280 15 ILE A 96 ? ? -146.54 -6.11 281 15 ALA A 99 ? ? -57.96 -74.74 282 16 ASP A 2 ? ? -178.70 114.80 283 16 GLU A 4 ? ? -64.02 -78.28 284 16 LYS A 16 ? ? -119.69 66.43 285 16 VAL A 17 ? ? -51.90 170.05 286 16 CYS A 19 ? ? -34.04 -32.29 287 16 GLU A 22 ? ? -57.41 -7.39 288 16 LYS A 25 ? ? -55.50 -164.91 289 16 ASP A 29 ? ? 73.60 43.87 290 16 LYS A 31 ? ? -65.94 -141.34 291 16 LEU A 47 ? ? -64.61 0.00 292 16 ILE A 51 ? ? -57.38 175.74 293 16 ARG A 52 ? ? -103.79 -60.10 294 16 ASP A 53 ? ? -170.07 -148.06 295 16 ASN A 54 ? ? -64.32 95.89 296 16 ASP A 61 ? ? -167.05 -91.20 297 16 ILE A 71 ? ? -171.67 -29.74 298 16 LEU A 73 ? ? 62.19 174.65 299 16 CYS A 75 ? ? -118.17 56.83 300 16 VAL A 91 ? ? -119.05 -137.60 301 16 GLN A 93 ? ? 178.37 51.18 302 16 ILE A 96 ? ? -149.49 -7.99 303 16 ALA A 99 ? ? -58.60 -79.37 304 17 ASP A 2 ? ? -171.40 126.98 305 17 GLU A 4 ? ? -63.21 -80.29 306 17 THR A 12 ? ? -127.74 -167.57 307 17 CYS A 19 ? ? -31.60 -33.84 308 17 LYS A 25 ? ? -61.29 -131.37 309 17 ASP A 29 ? ? 87.63 44.47 310 17 LYS A 31 ? ? -74.32 -136.49 311 17 LYS A 32 ? ? -143.64 -32.40 312 17 ASN A 50 ? ? 76.14 -5.98 313 17 ARG A 52 ? ? -98.47 -156.23 314 17 ASP A 53 ? ? -64.65 -149.08 315 17 ASP A 61 ? ? -170.35 -90.81 316 17 ILE A 71 ? ? -146.99 -36.44 317 17 LEU A 73 ? ? 56.11 177.49 318 17 PRO A 74 ? ? -89.18 -102.05 319 17 CYS A 75 ? ? -64.87 30.56 320 17 VAL A 91 ? ? -83.79 -146.90 321 17 GLN A 93 ? ? -172.23 45.51 322 17 ILE A 96 ? ? -144.05 -6.14 323 17 ALA A 99 ? ? -57.96 -74.51 324 18 ASP A 2 ? ? -172.92 122.79 325 18 GLU A 4 ? ? -60.70 -77.32 326 18 LYS A 16 ? ? -118.66 64.62 327 18 CYS A 19 ? ? -31.17 -35.05 328 18 GLU A 22 ? ? -58.01 -3.29 329 18 MET A 23 ? ? -137.13 -45.91 330 18 LYS A 25 ? ? -60.26 -134.67 331 18 ASP A 29 ? ? 75.78 32.92 332 18 CYS A 30 ? ? 57.96 73.10 333 18 LYS A 31 ? ? -75.27 -124.16 334 18 LYS A 32 ? ? -150.43 -32.50 335 18 LEU A 47 ? ? -57.56 -7.81 336 18 CYS A 48 ? ? -140.70 47.67 337 18 ARG A 52 ? ? -99.27 -121.35 338 18 ASP A 53 ? ? -100.29 -147.73 339 18 ASP A 61 ? ? -168.38 -93.37 340 18 ILE A 71 ? ? -171.23 -37.05 341 18 LEU A 73 ? ? 52.50 174.24 342 18 VAL A 91 ? ? -138.82 -113.61 343 18 ASN A 92 ? ? -69.87 39.04 344 18 GLN A 93 ? ? 75.33 51.36 345 18 ALA A 99 ? ? -57.93 -72.89 346 19 ASP A 2 ? ? 178.69 136.14 347 19 GLU A 4 ? ? -63.30 -74.65 348 19 LYS A 16 ? ? -119.09 65.49 349 19 CYS A 19 ? ? -35.64 -30.67 350 19 LYS A 25 ? ? -56.24 -162.60 351 19 ASP A 29 ? ? 75.76 40.30 352 19 LYS A 31 ? ? -65.04 -142.31 353 19 LYS A 32 ? ? -132.35 -32.99 354 19 ARG A 52 ? ? -107.27 -155.88 355 19 ASP A 53 ? ? -58.04 -151.77 356 19 ASP A 61 ? ? -145.24 -71.77 357 19 ILE A 71 ? ? -172.48 -40.87 358 19 LEU A 73 ? ? 51.74 174.41 359 19 VAL A 91 ? ? -89.43 -150.84 360 19 GLN A 93 ? ? 175.83 38.33 361 19 ILE A 96 ? ? -141.77 -21.97 362 19 ALA A 99 ? ? -63.23 -76.91 363 20 GLU A 4 ? ? -61.40 -79.39 364 20 VAL A 17 ? ? -52.18 171.78 365 20 LYS A 18 ? ? -100.04 66.61 366 20 CYS A 19 ? ? -33.59 -37.35 367 20 GLU A 22 ? ? -53.80 -9.43 368 20 ALA A 24 ? ? -66.59 4.37 369 20 LYS A 25 ? ? -53.78 -166.93 370 20 ASP A 29 ? ? 82.20 37.23 371 20 LYS A 31 ? ? -68.36 -140.61 372 20 LYS A 32 ? ? -135.68 -32.90 373 20 ASN A 50 ? ? 80.49 13.00 374 20 ILE A 51 ? ? -56.03 175.38 375 20 ASP A 53 ? ? -170.13 -155.75 376 20 ASP A 61 ? ? -148.00 -75.18 377 20 ILE A 71 ? ? -136.90 -43.50 378 20 LEU A 73 ? ? 50.11 177.94 379 20 PRO A 74 ? ? -90.55 -89.61 380 20 CYS A 75 ? ? -43.55 -13.94 381 20 VAL A 91 ? ? -151.92 -99.45 382 20 ASN A 92 ? ? -72.94 47.01 383 20 ALA A 99 ? ? -57.89 -72.55 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id PCA _pdbx_struct_mod_residue.label_seq_id 1 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id PCA _pdbx_struct_mod_residue.auth_seq_id 1 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id GLN _pdbx_struct_mod_residue.details 'PYROGLUTAMIC ACID' # _pdbx_nmr_ensemble.entry_id 1Z5F _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1Z5F _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '2mM RC-RNase 3, U-15N,13C; 20mM phosphate buffer; 90% H2O, 10% D2O' '90% H2O/10% D2O' 2 '2mM RC-RNase 3, U-15N,13C; 20mM phosphate buffer; 90% H2O, 10% D2O' '90% H2O, 10% D2O, 5mg/ml phage pf1' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 3.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '20 mM' _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 3 1 'IPAP_1H, 15N_HSQC' 2 # _pdbx_nmr_refine.entry_id 1Z5F _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 ? 1 processing NMRPipe ? ? 2 'data analysis' NMRView 5.0 ? 3 'structure solution' X-PLOR 3.851 ? 4 refinement X-PLOR 3.851 ? 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PCA N N N N 247 PCA CA C N S 248 PCA CB C N N 249 PCA CG C N N 250 PCA CD C N N 251 PCA OE O N N 252 PCA C C N N 253 PCA O O N N 254 PCA OXT O N N 255 PCA H H N N 256 PCA HA H N N 257 PCA HB2 H N N 258 PCA HB3 H N N 259 PCA HG2 H N N 260 PCA HG3 H N N 261 PCA HXT H N N 262 PHE N N N N 263 PHE CA C N S 264 PHE C C N N 265 PHE O O N N 266 PHE CB C N N 267 PHE CG C Y N 268 PHE CD1 C Y N 269 PHE CD2 C Y N 270 PHE CE1 C Y N 271 PHE CE2 C Y N 272 PHE CZ C Y N 273 PHE OXT O N N 274 PHE H H N N 275 PHE H2 H N N 276 PHE HA H N N 277 PHE HB2 H N N 278 PHE HB3 H N N 279 PHE HD1 H N N 280 PHE HD2 H N N 281 PHE HE1 H N N 282 PHE HE2 H N N 283 PHE HZ H N N 284 PHE HXT H N N 285 PRO N N N N 286 PRO CA C N S 287 PRO C C N N 288 PRO O O N N 289 PRO CB C N N 290 PRO CG C N N 291 PRO CD C N N 292 PRO OXT O N N 293 PRO H H N N 294 PRO HA H N N 295 PRO HB2 H N N 296 PRO HB3 H N N 297 PRO HG2 H N N 298 PRO HG3 H N N 299 PRO HD2 H N N 300 PRO HD3 H N N 301 PRO HXT H N N 302 SER N N N N 303 SER CA C N S 304 SER C C N N 305 SER O O N N 306 SER CB C N N 307 SER OG O N N 308 SER OXT O N N 309 SER H H N N 310 SER H2 H N N 311 SER HA H N N 312 SER HB2 H N N 313 SER HB3 H N N 314 SER HG H N N 315 SER HXT H N N 316 THR N N N N 317 THR CA C N S 318 THR C C N N 319 THR O O N N 320 THR CB C N R 321 THR OG1 O N N 322 THR CG2 C N N 323 THR OXT O N N 324 THR H H N N 325 THR H2 H N N 326 THR HA H N N 327 THR HB H N N 328 THR HG1 H N N 329 THR HG21 H N N 330 THR HG22 H N N 331 THR HG23 H N N 332 THR HXT H N N 333 TRP N N N N 334 TRP CA C N S 335 TRP C C N N 336 TRP O O N N 337 TRP CB C N N 338 TRP CG C Y N 339 TRP CD1 C Y N 340 TRP CD2 C Y N 341 TRP NE1 N Y N 342 TRP CE2 C Y N 343 TRP CE3 C Y N 344 TRP CZ2 C Y N 345 TRP CZ3 C Y N 346 TRP CH2 C Y N 347 TRP OXT O N N 348 TRP H H N N 349 TRP H2 H N N 350 TRP HA H N N 351 TRP HB2 H N N 352 TRP HB3 H N N 353 TRP HD1 H N N 354 TRP HE1 H N N 355 TRP HE3 H N N 356 TRP HZ2 H N N 357 TRP HZ3 H N N 358 TRP HH2 H N N 359 TRP HXT H N N 360 TYR N N N N 361 TYR CA C N S 362 TYR C C N N 363 TYR O O N N 364 TYR CB C N N 365 TYR CG C Y N 366 TYR CD1 C Y N 367 TYR CD2 C Y N 368 TYR CE1 C Y N 369 TYR CE2 C Y N 370 TYR CZ C Y N 371 TYR OH O N N 372 TYR OXT O N N 373 TYR H H N N 374 TYR H2 H N N 375 TYR HA H N N 376 TYR HB2 H N N 377 TYR HB3 H N N 378 TYR HD1 H N N 379 TYR HD2 H N N 380 TYR HE1 H N N 381 TYR HE2 H N N 382 TYR HH H N N 383 TYR HXT H N N 384 VAL N N N N 385 VAL CA C N S 386 VAL C C N N 387 VAL O O N N 388 VAL CB C N N 389 VAL CG1 C N N 390 VAL CG2 C N N 391 VAL OXT O N N 392 VAL H H N N 393 VAL H2 H N N 394 VAL HA H N N 395 VAL HB H N N 396 VAL HG11 H N N 397 VAL HG12 H N N 398 VAL HG13 H N N 399 VAL HG21 H N N 400 VAL HG22 H N N 401 VAL HG23 H N N 402 VAL HXT H N N 403 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PCA N CA sing N N 235 PCA N CD sing N N 236 PCA N H sing N N 237 PCA CA CB sing N N 238 PCA CA C sing N N 239 PCA CA HA sing N N 240 PCA CB CG sing N N 241 PCA CB HB2 sing N N 242 PCA CB HB3 sing N N 243 PCA CG CD sing N N 244 PCA CG HG2 sing N N 245 PCA CG HG3 sing N N 246 PCA CD OE doub N N 247 PCA C O doub N N 248 PCA C OXT sing N N 249 PCA OXT HXT sing N N 250 PHE N CA sing N N 251 PHE N H sing N N 252 PHE N H2 sing N N 253 PHE CA C sing N N 254 PHE CA CB sing N N 255 PHE CA HA sing N N 256 PHE C O doub N N 257 PHE C OXT sing N N 258 PHE CB CG sing N N 259 PHE CB HB2 sing N N 260 PHE CB HB3 sing N N 261 PHE CG CD1 doub Y N 262 PHE CG CD2 sing Y N 263 PHE CD1 CE1 sing Y N 264 PHE CD1 HD1 sing N N 265 PHE CD2 CE2 doub Y N 266 PHE CD2 HD2 sing N N 267 PHE CE1 CZ doub Y N 268 PHE CE1 HE1 sing N N 269 PHE CE2 CZ sing Y N 270 PHE CE2 HE2 sing N N 271 PHE CZ HZ sing N N 272 PHE OXT HXT sing N N 273 PRO N CA sing N N 274 PRO N CD sing N N 275 PRO N H sing N N 276 PRO CA C sing N N 277 PRO CA CB sing N N 278 PRO CA HA sing N N 279 PRO C O doub N N 280 PRO C OXT sing N N 281 PRO CB CG sing N N 282 PRO CB HB2 sing N N 283 PRO CB HB3 sing N N 284 PRO CG CD sing N N 285 PRO CG HG2 sing N N 286 PRO CG HG3 sing N N 287 PRO CD HD2 sing N N 288 PRO CD HD3 sing N N 289 PRO OXT HXT sing N N 290 SER N CA sing N N 291 SER N H sing N N 292 SER N H2 sing N N 293 SER CA C sing N N 294 SER CA CB sing N N 295 SER CA HA sing N N 296 SER C O doub N N 297 SER C OXT sing N N 298 SER CB OG sing N N 299 SER CB HB2 sing N N 300 SER CB HB3 sing N N 301 SER OG HG sing N N 302 SER OXT HXT sing N N 303 THR N CA sing N N 304 THR N H sing N N 305 THR N H2 sing N N 306 THR CA C sing N N 307 THR CA CB sing N N 308 THR CA HA sing N N 309 THR C O doub N N 310 THR C OXT sing N N 311 THR CB OG1 sing N N 312 THR CB CG2 sing N N 313 THR CB HB sing N N 314 THR OG1 HG1 sing N N 315 THR CG2 HG21 sing N N 316 THR CG2 HG22 sing N N 317 THR CG2 HG23 sing N N 318 THR OXT HXT sing N N 319 TRP N CA sing N N 320 TRP N H sing N N 321 TRP N H2 sing N N 322 TRP CA C sing N N 323 TRP CA CB sing N N 324 TRP CA HA sing N N 325 TRP C O doub N N 326 TRP C OXT sing N N 327 TRP CB CG sing N N 328 TRP CB HB2 sing N N 329 TRP CB HB3 sing N N 330 TRP CG CD1 doub Y N 331 TRP CG CD2 sing Y N 332 TRP CD1 NE1 sing Y N 333 TRP CD1 HD1 sing N N 334 TRP CD2 CE2 doub Y N 335 TRP CD2 CE3 sing Y N 336 TRP NE1 CE2 sing Y N 337 TRP NE1 HE1 sing N N 338 TRP CE2 CZ2 sing Y N 339 TRP CE3 CZ3 doub Y N 340 TRP CE3 HE3 sing N N 341 TRP CZ2 CH2 doub Y N 342 TRP CZ2 HZ2 sing N N 343 TRP CZ3 CH2 sing Y N 344 TRP CZ3 HZ3 sing N N 345 TRP CH2 HH2 sing N N 346 TRP OXT HXT sing N N 347 TYR N CA sing N N 348 TYR N H sing N N 349 TYR N H2 sing N N 350 TYR CA C sing N N 351 TYR CA CB sing N N 352 TYR CA HA sing N N 353 TYR C O doub N N 354 TYR C OXT sing N N 355 TYR CB CG sing N N 356 TYR CB HB2 sing N N 357 TYR CB HB3 sing N N 358 TYR CG CD1 doub Y N 359 TYR CG CD2 sing Y N 360 TYR CD1 CE1 sing Y N 361 TYR CD1 HD1 sing N N 362 TYR CD2 CE2 doub Y N 363 TYR CD2 HD2 sing N N 364 TYR CE1 CZ doub Y N 365 TYR CE1 HE1 sing N N 366 TYR CE2 CZ sing Y N 367 TYR CE2 HE2 sing N N 368 TYR CZ OH sing N N 369 TYR OH HH sing N N 370 TYR OXT HXT sing N N 371 VAL N CA sing N N 372 VAL N H sing N N 373 VAL N H2 sing N N 374 VAL CA C sing N N 375 VAL CA CB sing N N 376 VAL CA HA sing N N 377 VAL C O doub N N 378 VAL C OXT sing N N 379 VAL CB CG1 sing N N 380 VAL CB CG2 sing N N 381 VAL CB HB sing N N 382 VAL CG1 HG11 sing N N 383 VAL CG1 HG12 sing N N 384 VAL CG1 HG13 sing N N 385 VAL CG2 HG21 sing N N 386 VAL CG2 HG22 sing N N 387 VAL CG2 HG23 sing N N 388 VAL OXT HXT sing N N 389 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 1Z5F _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_