data_1ZA8 # _entry.id 1ZA8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1ZA8 pdb_00001za8 10.2210/pdb1za8/pdb RCSB RCSB032493 ? ? WWPDB D_1000032493 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-04-12 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond 9 5 'Structure model' pdbx_entry_details 10 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ZA8 _pdbx_database_status.recvd_initial_deposition_date 2005-04-05 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chen, B.' 1 'Colgrave, M.L.' 2 'Daly, N.L.' 3 'Rosengren, K.J.' 4 'Gustafson, K.R.' 5 'Craik, D.J.' 6 # _citation.id primary _citation.title ;Isolation and characterization of novel cyclotides from Viola hederaceae: solution structure and anti-HIV activity of vhl-1, a leaf-specific expressed cyclotide. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 280 _citation.page_first 22395 _citation.page_last 22405 _citation.year 2005 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15824119 _citation.pdbx_database_id_DOI 10.1074/jbc.M501737200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chen, B.' 1 ? primary 'Colgrave, M.L.' 2 ? primary 'Daly, N.L.' 3 ? primary 'Rosengren, K.J.' 4 ? primary 'Gustafson, K.R.' 5 ? primary 'Craik, D.J.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description vhl-1 _entity.formula_weight 3342.949 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code CGESCAMISFCFTEVIGCSCKNKVCYLNSIS _entity_poly.pdbx_seq_one_letter_code_can CGESCAMISFCFTEVIGCSCKNKVCYLNSIS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 CYS n 1 2 GLY n 1 3 GLU n 1 4 SER n 1 5 CYS n 1 6 ALA n 1 7 MET n 1 8 ILE n 1 9 SER n 1 10 PHE n 1 11 CYS n 1 12 PHE n 1 13 THR n 1 14 GLU n 1 15 VAL n 1 16 ILE n 1 17 GLY n 1 18 CYS n 1 19 SER n 1 20 CYS n 1 21 LYS n 1 22 ASN n 1 23 LYS n 1 24 VAL n 1 25 CYS n 1 26 TYR n 1 27 LEU n 1 28 ASN n 1 29 SER n 1 30 ILE n 1 31 SER n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Viola hederacea' _entity_src_nat.pdbx_ncbi_taxonomy_id 180952 _entity_src_nat.genus Viola _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 CYS 1 1 1 CYS CYS A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 MET 7 7 7 MET MET A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 SER 31 31 31 SER SER A . n # _exptl.entry_id 1ZA8 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1ZA8 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1ZA8 _struct.title 'NMR solution structure of a leaf-specific-expressed cyclotide vhl-1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ZA8 _struct_keywords.pdbx_keywords 'ANTIVIRAL PROTEIN' _struct_keywords.text 'circular protein, cyclic cystine knot motif, ANTIVIRAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name UNP _struct_ref.db_code VHL1_VIOHE _struct_ref.pdbx_db_accession P84522 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1ZA8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 28 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P84522 _struct_ref_seq.db_align_beg 4 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 31 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 28 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id CYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 11 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id VAL _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 15 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id CYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 11 _struct_conf.end_auth_comp_id VAL _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 15 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 1 SG ? ? ? 1_555 A CYS 18 SG ? ? A CYS 1 A CYS 18 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf2 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 20 SG ? ? A CYS 5 A CYS 20 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf3 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 25 SG ? ? A CYS 11 A CYS 25 1_555 ? ? ? ? ? ? ? 2.024 ? ? covale1 covale both ? A CYS 1 N ? ? ? 1_555 A SER 31 C ? ? A CYS 1 A SER 31 1_555 ? ? ? ? ? ? ? 1.327 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 1 ? CYS A 18 ? CYS A 1 ? 1_555 CYS A 18 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 5 ? CYS A 20 ? CYS A 5 ? 1_555 CYS A 20 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 11 ? CYS A 25 ? CYS A 11 ? 1_555 CYS A 25 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 1 ? SER A 31 ? CYS A 1 ? 1_555 SER A 31 ? 1_555 N C . . . None 'Non-standard linkage' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 3 ? SER A 4 ? GLU A 3 SER A 4 A 2 VAL A 24 ? TYR A 26 ? VAL A 24 TYR A 26 A 3 SER A 19 ? LYS A 21 ? SER A 19 LYS A 21 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLU A 3 ? N GLU A 3 O CYS A 25 ? O CYS A 25 A 2 3 O TYR A 26 ? O TYR A 26 N SER A 19 ? N SER A 19 # _pdbx_entry_details.entry_id 1ZA8 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 5 ? ? -94.59 37.34 2 1 SER A 9 ? ? -75.79 48.60 3 1 LYS A 23 ? ? 78.12 -12.97 4 2 CYS A 5 ? ? -92.44 34.11 5 2 LYS A 23 ? ? 81.77 -15.20 6 3 CYS A 5 ? ? -92.78 39.59 7 3 LYS A 23 ? ? 78.54 -13.38 8 3 SER A 29 ? ? 72.33 -4.30 9 4 CYS A 5 ? ? -91.26 35.83 10 4 SER A 9 ? ? -75.41 48.03 11 4 LYS A 23 ? ? 87.06 -15.80 12 4 SER A 29 ? ? 75.41 -1.61 13 5 CYS A 5 ? ? -96.19 37.11 14 5 SER A 9 ? ? -76.45 49.86 15 5 LYS A 23 ? ? 81.42 -19.18 16 5 SER A 29 ? ? 71.74 -2.73 17 6 CYS A 5 ? ? -98.05 36.52 18 6 SER A 9 ? ? -77.43 49.69 19 6 LYS A 23 ? ? 76.40 -10.92 20 6 SER A 29 ? ? 72.49 -4.83 21 7 SER A 9 ? ? -77.43 49.04 22 7 LYS A 23 ? ? 79.85 -11.70 23 8 CYS A 5 ? ? -92.33 37.56 24 8 SER A 9 ? ? -76.38 48.69 25 8 LYS A 23 ? ? 84.95 -19.35 26 8 SER A 29 ? ? 72.92 -6.59 27 9 CYS A 5 ? ? -95.11 36.90 28 9 LYS A 23 ? ? 79.51 -16.79 29 9 SER A 29 ? ? 73.63 -8.52 30 10 CYS A 5 ? ? -94.07 37.97 31 10 SER A 9 ? ? -76.26 47.99 32 10 LYS A 23 ? ? 80.30 -15.83 33 10 SER A 29 ? ? 72.92 -0.07 34 11 CYS A 5 ? ? -91.92 35.50 35 11 LYS A 23 ? ? 77.50 -12.10 36 11 SER A 29 ? ? 74.70 -1.98 37 12 CYS A 5 ? ? -90.26 37.02 38 12 SER A 9 ? ? -75.65 47.55 39 12 LYS A 23 ? ? 81.42 -16.32 40 13 CYS A 5 ? ? -89.99 37.26 41 13 LYS A 23 ? ? 76.89 -10.93 42 13 SER A 29 ? ? 73.79 -6.14 43 14 CYS A 5 ? ? -91.74 36.10 44 14 LYS A 23 ? ? 77.75 -11.67 45 14 SER A 29 ? ? 72.00 -7.95 46 15 CYS A 5 ? ? -94.00 37.58 47 15 SER A 9 ? ? -76.24 49.94 48 15 LYS A 23 ? ? 79.14 -12.26 49 15 SER A 29 ? ? 73.20 -5.70 50 16 CYS A 5 ? ? -98.34 38.46 51 16 LYS A 23 ? ? 82.58 -17.84 52 16 SER A 29 ? ? 72.96 -4.62 53 17 CYS A 5 ? ? -92.37 36.04 54 17 SER A 9 ? ? -74.89 46.79 55 17 LYS A 23 ? ? 78.89 -14.08 56 17 SER A 29 ? ? 73.96 -5.59 57 18 CYS A 5 ? ? -94.61 38.29 58 18 LYS A 23 ? ? 80.28 -18.01 59 19 CYS A 5 ? ? -94.00 41.57 60 19 LYS A 23 ? ? 80.67 -14.87 61 19 SER A 29 ? ? 73.67 -4.21 62 20 CYS A 5 ? ? -91.36 38.08 63 20 SER A 9 ? ? -75.25 48.71 64 20 LYS A 23 ? ? 79.13 -11.28 65 20 SER A 29 ? ? 73.31 -6.73 # _pdbx_nmr_ensemble.entry_id 1ZA8 _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1ZA8 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.4mM vhl-1' _pdbx_nmr_sample_details.solvent_system '70% H2O, 25% CD3CN, 5% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 3.3 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D NOESY' 1 2 1 '2D TOCSY' 1 3 1 DQF-COSY 1 4 1 E-COSY 1 # _pdbx_nmr_refine.entry_id 1ZA8 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 'data analysis' Sparky 3.110 'Goddard, T. D. and Kneller, D. G.' 2 'iterative matrix relaxation' DYANA 1.5 'Guntert, P., Mumenthaler, C and Wuthrich, K.' 3 refinement CNS 1.1 ? 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 CYS N N N N 31 CYS CA C N R 32 CYS C C N N 33 CYS O O N N 34 CYS CB C N N 35 CYS SG S N N 36 CYS OXT O N N 37 CYS H H N N 38 CYS H2 H N N 39 CYS HA H N N 40 CYS HB2 H N N 41 CYS HB3 H N N 42 CYS HG H N N 43 CYS HXT H N N 44 GLU N N N N 45 GLU CA C N S 46 GLU C C N N 47 GLU O O N N 48 GLU CB C N N 49 GLU CG C N N 50 GLU CD C N N 51 GLU OE1 O N N 52 GLU OE2 O N N 53 GLU OXT O N N 54 GLU H H N N 55 GLU H2 H N N 56 GLU HA H N N 57 GLU HB2 H N N 58 GLU HB3 H N N 59 GLU HG2 H N N 60 GLU HG3 H N N 61 GLU HE2 H N N 62 GLU HXT H N N 63 GLY N N N N 64 GLY CA C N N 65 GLY C C N N 66 GLY O O N N 67 GLY OXT O N N 68 GLY H H N N 69 GLY H2 H N N 70 GLY HA2 H N N 71 GLY HA3 H N N 72 GLY HXT H N N 73 ILE N N N N 74 ILE CA C N S 75 ILE C C N N 76 ILE O O N N 77 ILE CB C N S 78 ILE CG1 C N N 79 ILE CG2 C N N 80 ILE CD1 C N N 81 ILE OXT O N N 82 ILE H H N N 83 ILE H2 H N N 84 ILE HA H N N 85 ILE HB H N N 86 ILE HG12 H N N 87 ILE HG13 H N N 88 ILE HG21 H N N 89 ILE HG22 H N N 90 ILE HG23 H N N 91 ILE HD11 H N N 92 ILE HD12 H N N 93 ILE HD13 H N N 94 ILE HXT H N N 95 LEU N N N N 96 LEU CA C N S 97 LEU C C N N 98 LEU O O N N 99 LEU CB C N N 100 LEU CG C N N 101 LEU CD1 C N N 102 LEU CD2 C N N 103 LEU OXT O N N 104 LEU H H N N 105 LEU H2 H N N 106 LEU HA H N N 107 LEU HB2 H N N 108 LEU HB3 H N N 109 LEU HG H N N 110 LEU HD11 H N N 111 LEU HD12 H N N 112 LEU HD13 H N N 113 LEU HD21 H N N 114 LEU HD22 H N N 115 LEU HD23 H N N 116 LEU HXT H N N 117 LYS N N N N 118 LYS CA C N S 119 LYS C C N N 120 LYS O O N N 121 LYS CB C N N 122 LYS CG C N N 123 LYS CD C N N 124 LYS CE C N N 125 LYS NZ N N N 126 LYS OXT O N N 127 LYS H H N N 128 LYS H2 H N N 129 LYS HA H N N 130 LYS HB2 H N N 131 LYS HB3 H N N 132 LYS HG2 H N N 133 LYS HG3 H N N 134 LYS HD2 H N N 135 LYS HD3 H N N 136 LYS HE2 H N N 137 LYS HE3 H N N 138 LYS HZ1 H N N 139 LYS HZ2 H N N 140 LYS HZ3 H N N 141 LYS HXT H N N 142 MET N N N N 143 MET CA C N S 144 MET C C N N 145 MET O O N N 146 MET CB C N N 147 MET CG C N N 148 MET SD S N N 149 MET CE C N N 150 MET OXT O N N 151 MET H H N N 152 MET H2 H N N 153 MET HA H N N 154 MET HB2 H N N 155 MET HB3 H N N 156 MET HG2 H N N 157 MET HG3 H N N 158 MET HE1 H N N 159 MET HE2 H N N 160 MET HE3 H N N 161 MET HXT H N N 162 PHE N N N N 163 PHE CA C N S 164 PHE C C N N 165 PHE O O N N 166 PHE CB C N N 167 PHE CG C Y N 168 PHE CD1 C Y N 169 PHE CD2 C Y N 170 PHE CE1 C Y N 171 PHE CE2 C Y N 172 PHE CZ C Y N 173 PHE OXT O N N 174 PHE H H N N 175 PHE H2 H N N 176 PHE HA H N N 177 PHE HB2 H N N 178 PHE HB3 H N N 179 PHE HD1 H N N 180 PHE HD2 H N N 181 PHE HE1 H N N 182 PHE HE2 H N N 183 PHE HZ H N N 184 PHE HXT H N N 185 SER N N N N 186 SER CA C N S 187 SER C C N N 188 SER O O N N 189 SER CB C N N 190 SER OG O N N 191 SER OXT O N N 192 SER H H N N 193 SER H2 H N N 194 SER HA H N N 195 SER HB2 H N N 196 SER HB3 H N N 197 SER HG H N N 198 SER HXT H N N 199 THR N N N N 200 THR CA C N S 201 THR C C N N 202 THR O O N N 203 THR CB C N R 204 THR OG1 O N N 205 THR CG2 C N N 206 THR OXT O N N 207 THR H H N N 208 THR H2 H N N 209 THR HA H N N 210 THR HB H N N 211 THR HG1 H N N 212 THR HG21 H N N 213 THR HG22 H N N 214 THR HG23 H N N 215 THR HXT H N N 216 TYR N N N N 217 TYR CA C N S 218 TYR C C N N 219 TYR O O N N 220 TYR CB C N N 221 TYR CG C Y N 222 TYR CD1 C Y N 223 TYR CD2 C Y N 224 TYR CE1 C Y N 225 TYR CE2 C Y N 226 TYR CZ C Y N 227 TYR OH O N N 228 TYR OXT O N N 229 TYR H H N N 230 TYR H2 H N N 231 TYR HA H N N 232 TYR HB2 H N N 233 TYR HB3 H N N 234 TYR HD1 H N N 235 TYR HD2 H N N 236 TYR HE1 H N N 237 TYR HE2 H N N 238 TYR HH H N N 239 TYR HXT H N N 240 VAL N N N N 241 VAL CA C N S 242 VAL C C N N 243 VAL O O N N 244 VAL CB C N N 245 VAL CG1 C N N 246 VAL CG2 C N N 247 VAL OXT O N N 248 VAL H H N N 249 VAL H2 H N N 250 VAL HA H N N 251 VAL HB H N N 252 VAL HG11 H N N 253 VAL HG12 H N N 254 VAL HG13 H N N 255 VAL HG21 H N N 256 VAL HG22 H N N 257 VAL HG23 H N N 258 VAL HXT H N N 259 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 CYS N CA sing N N 29 CYS N H sing N N 30 CYS N H2 sing N N 31 CYS CA C sing N N 32 CYS CA CB sing N N 33 CYS CA HA sing N N 34 CYS C O doub N N 35 CYS C OXT sing N N 36 CYS CB SG sing N N 37 CYS CB HB2 sing N N 38 CYS CB HB3 sing N N 39 CYS SG HG sing N N 40 CYS OXT HXT sing N N 41 GLU N CA sing N N 42 GLU N H sing N N 43 GLU N H2 sing N N 44 GLU CA C sing N N 45 GLU CA CB sing N N 46 GLU CA HA sing N N 47 GLU C O doub N N 48 GLU C OXT sing N N 49 GLU CB CG sing N N 50 GLU CB HB2 sing N N 51 GLU CB HB3 sing N N 52 GLU CG CD sing N N 53 GLU CG HG2 sing N N 54 GLU CG HG3 sing N N 55 GLU CD OE1 doub N N 56 GLU CD OE2 sing N N 57 GLU OE2 HE2 sing N N 58 GLU OXT HXT sing N N 59 GLY N CA sing N N 60 GLY N H sing N N 61 GLY N H2 sing N N 62 GLY CA C sing N N 63 GLY CA HA2 sing N N 64 GLY CA HA3 sing N N 65 GLY C O doub N N 66 GLY C OXT sing N N 67 GLY OXT HXT sing N N 68 ILE N CA sing N N 69 ILE N H sing N N 70 ILE N H2 sing N N 71 ILE CA C sing N N 72 ILE CA CB sing N N 73 ILE CA HA sing N N 74 ILE C O doub N N 75 ILE C OXT sing N N 76 ILE CB CG1 sing N N 77 ILE CB CG2 sing N N 78 ILE CB HB sing N N 79 ILE CG1 CD1 sing N N 80 ILE CG1 HG12 sing N N 81 ILE CG1 HG13 sing N N 82 ILE CG2 HG21 sing N N 83 ILE CG2 HG22 sing N N 84 ILE CG2 HG23 sing N N 85 ILE CD1 HD11 sing N N 86 ILE CD1 HD12 sing N N 87 ILE CD1 HD13 sing N N 88 ILE OXT HXT sing N N 89 LEU N CA sing N N 90 LEU N H sing N N 91 LEU N H2 sing N N 92 LEU CA C sing N N 93 LEU CA CB sing N N 94 LEU CA HA sing N N 95 LEU C O doub N N 96 LEU C OXT sing N N 97 LEU CB CG sing N N 98 LEU CB HB2 sing N N 99 LEU CB HB3 sing N N 100 LEU CG CD1 sing N N 101 LEU CG CD2 sing N N 102 LEU CG HG sing N N 103 LEU CD1 HD11 sing N N 104 LEU CD1 HD12 sing N N 105 LEU CD1 HD13 sing N N 106 LEU CD2 HD21 sing N N 107 LEU CD2 HD22 sing N N 108 LEU CD2 HD23 sing N N 109 LEU OXT HXT sing N N 110 LYS N CA sing N N 111 LYS N H sing N N 112 LYS N H2 sing N N 113 LYS CA C sing N N 114 LYS CA CB sing N N 115 LYS CA HA sing N N 116 LYS C O doub N N 117 LYS C OXT sing N N 118 LYS CB CG sing N N 119 LYS CB HB2 sing N N 120 LYS CB HB3 sing N N 121 LYS CG CD sing N N 122 LYS CG HG2 sing N N 123 LYS CG HG3 sing N N 124 LYS CD CE sing N N 125 LYS CD HD2 sing N N 126 LYS CD HD3 sing N N 127 LYS CE NZ sing N N 128 LYS CE HE2 sing N N 129 LYS CE HE3 sing N N 130 LYS NZ HZ1 sing N N 131 LYS NZ HZ2 sing N N 132 LYS NZ HZ3 sing N N 133 LYS OXT HXT sing N N 134 MET N CA sing N N 135 MET N H sing N N 136 MET N H2 sing N N 137 MET CA C sing N N 138 MET CA CB sing N N 139 MET CA HA sing N N 140 MET C O doub N N 141 MET C OXT sing N N 142 MET CB CG sing N N 143 MET CB HB2 sing N N 144 MET CB HB3 sing N N 145 MET CG SD sing N N 146 MET CG HG2 sing N N 147 MET CG HG3 sing N N 148 MET SD CE sing N N 149 MET CE HE1 sing N N 150 MET CE HE2 sing N N 151 MET CE HE3 sing N N 152 MET OXT HXT sing N N 153 PHE N CA sing N N 154 PHE N H sing N N 155 PHE N H2 sing N N 156 PHE CA C sing N N 157 PHE CA CB sing N N 158 PHE CA HA sing N N 159 PHE C O doub N N 160 PHE C OXT sing N N 161 PHE CB CG sing N N 162 PHE CB HB2 sing N N 163 PHE CB HB3 sing N N 164 PHE CG CD1 doub Y N 165 PHE CG CD2 sing Y N 166 PHE CD1 CE1 sing Y N 167 PHE CD1 HD1 sing N N 168 PHE CD2 CE2 doub Y N 169 PHE CD2 HD2 sing N N 170 PHE CE1 CZ doub Y N 171 PHE CE1 HE1 sing N N 172 PHE CE2 CZ sing Y N 173 PHE CE2 HE2 sing N N 174 PHE CZ HZ sing N N 175 PHE OXT HXT sing N N 176 SER N CA sing N N 177 SER N H sing N N 178 SER N H2 sing N N 179 SER CA C sing N N 180 SER CA CB sing N N 181 SER CA HA sing N N 182 SER C O doub N N 183 SER C OXT sing N N 184 SER CB OG sing N N 185 SER CB HB2 sing N N 186 SER CB HB3 sing N N 187 SER OG HG sing N N 188 SER OXT HXT sing N N 189 THR N CA sing N N 190 THR N H sing N N 191 THR N H2 sing N N 192 THR CA C sing N N 193 THR CA CB sing N N 194 THR CA HA sing N N 195 THR C O doub N N 196 THR C OXT sing N N 197 THR CB OG1 sing N N 198 THR CB CG2 sing N N 199 THR CB HB sing N N 200 THR OG1 HG1 sing N N 201 THR CG2 HG21 sing N N 202 THR CG2 HG22 sing N N 203 THR CG2 HG23 sing N N 204 THR OXT HXT sing N N 205 TYR N CA sing N N 206 TYR N H sing N N 207 TYR N H2 sing N N 208 TYR CA C sing N N 209 TYR CA CB sing N N 210 TYR CA HA sing N N 211 TYR C O doub N N 212 TYR C OXT sing N N 213 TYR CB CG sing N N 214 TYR CB HB2 sing N N 215 TYR CB HB3 sing N N 216 TYR CG CD1 doub Y N 217 TYR CG CD2 sing Y N 218 TYR CD1 CE1 sing Y N 219 TYR CD1 HD1 sing N N 220 TYR CD2 CE2 doub Y N 221 TYR CD2 HD2 sing N N 222 TYR CE1 CZ doub Y N 223 TYR CE1 HE1 sing N N 224 TYR CE2 CZ sing Y N 225 TYR CE2 HE2 sing N N 226 TYR CZ OH sing N N 227 TYR OH HH sing N N 228 TYR OXT HXT sing N N 229 VAL N CA sing N N 230 VAL N H sing N N 231 VAL N H2 sing N N 232 VAL CA C sing N N 233 VAL CA CB sing N N 234 VAL CA HA sing N N 235 VAL C O doub N N 236 VAL C OXT sing N N 237 VAL CB CG1 sing N N 238 VAL CB CG2 sing N N 239 VAL CB HB sing N N 240 VAL CG1 HG11 sing N N 241 VAL CG1 HG12 sing N N 242 VAL CG1 HG13 sing N N 243 VAL CG2 HG21 sing N N 244 VAL CG2 HG22 sing N N 245 VAL CG2 HG23 sing N N 246 VAL OXT HXT sing N N 247 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AVANCE Bruker 500 ? 2 AVANCE Bruker 600 ? # _atom_sites.entry_id 1ZA8 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_