data_1ZWF # _entry.id 1ZWF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1ZWF pdb_00001zwf 10.2210/pdb1zwf/pdb WWPDB D_1000177544 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ZWF _pdbx_database_status.recvd_initial_deposition_date 1996-06-17 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Roesch, P.' 1 'Marx, U.C.' 2 # _citation.id primary _citation.title ? _citation.journal_abbrev 'Strukturen Verschiedener Parathormonfragmente in Loesung' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year 1996 _citation.journal_id_ASTM ? _citation.country GW _citation.journal_id_ISSN ? _citation.journal_id_CSD 2123 _citation.book_publisher 'Bayreuth : University of Bayreuth (Thesis)' _citation.pdbx_database_id_PubMed -1 _citation.pdbx_database_id_DOI ? # _citation_author.citation_id primary _citation_author.name 'Marx, U.C.' _citation_author.ordinal 1 _citation_author.identifier_ORCID ? # _cell.entry_id 1ZWF _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1ZWF _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'PARATHYROID HORMONE' _entity.formula_weight 4161.896 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'N-TERMINAL ACETYLATED' _entity.pdbx_fragment '4 - 37' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'N-ACETYL-HPTH(4-37)' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code '(ACE)EIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL' _entity_poly.pdbx_seq_one_letter_code_can XEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ACE n 1 2 GLU n 1 3 ILE n 1 4 GLN n 1 5 LEU n 1 6 MET n 1 7 HIS n 1 8 ASN n 1 9 LEU n 1 10 GLY n 1 11 LYS n 1 12 HIS n 1 13 LEU n 1 14 ASN n 1 15 SER n 1 16 MET n 1 17 GLU n 1 18 ARG n 1 19 VAL n 1 20 GLU n 1 21 TRP n 1 22 LEU n 1 23 ARG n 1 24 LYS n 1 25 LYS n 1 26 LEU n 1 27 GLN n 1 28 ASP n 1 29 VAL n 1 30 HIS n 1 31 ASN n 1 32 PHE n 1 33 VAL n 1 34 ALA n 1 35 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene POTENTIAL _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PTHY_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P01270 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQ RPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1ZWF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 35 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01270 _struct_ref_seq.db_align_beg 35 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 68 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 35 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 1ZWF _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version 3.1 _pdbx_nmr_software.authors BRUNGER _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1ZWF _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1ZWF _struct.title 'STRUCTURE OF N-TERMINAL ACETYLATED HUMAN PARATHYROID HORMONE, NMR, 10 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ZWF _struct_keywords.pdbx_keywords HORMONE _struct_keywords.text 'HORMONE, DISEASE MUTATION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 4 ? HIS A 7 ? GLN A 4 HIS A 7 1 ? 4 HELX_P HELX_P2 2 SER A 15 ? ASP A 28 ? SER A 15 ASP A 28 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag both _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id ACE _struct_conn.ptnr1_label_seq_id 1 _struct_conn.ptnr1_label_atom_id C _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id GLU _struct_conn.ptnr2_label_seq_id 2 _struct_conn.ptnr2_label_atom_id N _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id ACE _struct_conn.ptnr1_auth_seq_id 1 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id GLU _struct_conn.ptnr2_auth_seq_id 2 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.333 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 1ZWF _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1ZWF _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ACE 1 1 1 ACE ACE A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 MET 6 6 6 MET MET A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 HIS 12 12 12 HIS HIS A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 MET 16 16 16 MET MET A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 TRP 21 21 21 TRP TRP A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 LEU 35 35 35 LEU LEU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-06-16 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 X-PLOR phasing 3.1 ? 3 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 6 _pdbx_validate_rmsd_angle.auth_atom_id_1 CG _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 TRP _pdbx_validate_rmsd_angle.auth_seq_id_1 21 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CD2 _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 TRP _pdbx_validate_rmsd_angle.auth_seq_id_2 21 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CE3 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 TRP _pdbx_validate_rmsd_angle.auth_seq_id_3 21 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 128.26 _pdbx_validate_rmsd_angle.angle_target_value 133.90 _pdbx_validate_rmsd_angle.angle_deviation -5.64 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.90 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 9 ? ? 72.94 -77.60 2 1 HIS A 30 ? ? 46.47 -97.00 3 1 PHE A 32 ? ? 38.88 29.48 4 1 VAL A 33 ? ? 56.49 18.94 5 2 HIS A 12 ? ? -164.65 98.27 6 2 LEU A 13 ? ? -146.70 -121.50 7 2 ASN A 14 ? ? -145.89 -79.62 8 2 SER A 15 ? ? -107.70 -89.02 9 2 HIS A 30 ? ? 41.29 -96.57 10 2 PHE A 32 ? ? -77.53 -153.61 11 2 VAL A 33 ? ? -62.58 88.79 12 2 ALA A 34 ? ? 171.65 -49.08 13 3 LEU A 9 ? ? -128.44 -61.34 14 3 HIS A 12 ? ? 69.38 -97.69 15 3 SER A 15 ? ? -179.45 -48.79 16 3 VAL A 29 ? ? -131.03 -56.16 17 3 ASN A 31 ? ? -96.13 48.45 18 3 PHE A 32 ? ? -95.64 -150.48 19 3 ALA A 34 ? ? -139.50 -56.78 20 4 ILE A 3 ? ? 77.69 -60.04 21 4 HIS A 12 ? ? -154.38 61.28 22 4 LEU A 13 ? ? -129.36 -58.02 23 4 ASN A 14 ? ? 69.17 -54.63 24 4 SER A 15 ? ? -154.18 -38.68 25 4 HIS A 30 ? ? 76.12 -64.54 26 4 ASN A 31 ? ? -104.41 73.00 27 4 PHE A 32 ? ? -107.12 -114.80 28 4 VAL A 33 ? ? -91.31 35.86 29 4 ALA A 34 ? ? -140.71 35.36 30 5 GLN A 4 ? ? -56.84 96.93 31 5 ASN A 8 ? ? -94.06 45.13 32 5 LEU A 9 ? ? -128.81 -53.72 33 5 LEU A 13 ? ? -168.99 -126.11 34 5 ASN A 14 ? ? -139.66 -57.07 35 5 SER A 15 ? ? -174.02 -60.94 36 5 ARG A 18 ? ? -90.82 -91.27 37 5 VAL A 19 ? ? 47.68 -68.14 38 5 HIS A 30 ? ? 46.43 -91.13 39 5 PHE A 32 ? ? 26.77 37.94 40 5 VAL A 33 ? ? 46.96 27.16 41 6 GLN A 4 ? ? -133.19 -69.48 42 6 MET A 6 ? ? -102.97 44.14 43 6 ASN A 8 ? ? -161.08 96.48 44 6 LEU A 9 ? ? -111.45 70.17 45 6 HIS A 12 ? ? 78.05 -23.71 46 6 LEU A 13 ? ? 43.30 -97.67 47 6 ASN A 14 ? ? -142.03 30.64 48 6 SER A 15 ? ? 66.63 -56.87 49 6 ASN A 31 ? ? -98.09 36.32 50 6 PHE A 32 ? ? -100.84 -147.99 51 6 ALA A 34 ? ? -134.93 -55.29 52 7 ILE A 3 ? ? -130.65 -74.25 53 7 MET A 6 ? ? 37.84 48.49 54 7 ASN A 8 ? ? 56.77 -143.53 55 7 LEU A 9 ? ? 67.08 176.68 56 7 LEU A 13 ? ? -172.00 -119.12 57 7 HIS A 30 ? ? 76.22 -56.94 58 7 ASN A 31 ? ? -87.85 -72.86 59 7 PHE A 32 ? ? 38.77 33.89 60 7 VAL A 33 ? ? 49.71 25.11 61 8 LYS A 11 ? ? 70.42 -50.54 62 8 HIS A 12 ? ? -175.40 112.81 63 8 LEU A 13 ? ? -160.22 -140.41 64 8 ASN A 14 ? ? -118.47 -96.27 65 8 MET A 16 ? ? 79.66 -42.75 66 8 ARG A 18 ? ? -97.60 -92.58 67 8 VAL A 19 ? ? 43.81 -66.67 68 8 VAL A 29 ? ? -123.45 -66.62 69 8 HIS A 30 ? ? 44.06 -92.19 70 8 ASN A 31 ? ? -96.75 50.94 71 8 PHE A 32 ? ? -95.71 -153.04 72 8 ALA A 34 ? ? -135.66 -55.97 73 9 GLN A 4 ? ? 72.80 -60.06 74 9 HIS A 12 ? ? 85.24 -17.39 75 9 LEU A 13 ? ? 39.31 -108.57 76 9 ASN A 14 ? ? -128.12 -83.03 77 9 SER A 15 ? ? -167.70 -51.06 78 9 ARG A 18 ? ? -92.41 -84.48 79 9 VAL A 19 ? ? 35.13 -71.55 80 9 VAL A 29 ? ? -120.78 -67.63 81 9 HIS A 30 ? ? 35.70 69.57 82 10 ILE A 3 ? ? -145.16 44.36 83 10 LEU A 5 ? ? 61.12 64.17 84 10 MET A 6 ? ? 39.05 51.73 85 10 HIS A 12 ? ? 87.21 -33.60 86 10 LEU A 13 ? ? 43.52 -102.37 87 10 ASN A 14 ? ? -154.85 -96.49 88 10 MET A 16 ? ? 76.98 -34.62 89 10 PHE A 32 ? ? -105.91 -148.83 90 10 VAL A 33 ? ? -66.58 90.43 91 10 ALA A 34 ? ? 177.24 -47.68 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 18 ? ? 0.296 'SIDE CHAIN' 2 1 ARG A 23 ? ? 0.307 'SIDE CHAIN' 3 2 ARG A 18 ? ? 0.134 'SIDE CHAIN' 4 2 ARG A 23 ? ? 0.316 'SIDE CHAIN' 5 3 ARG A 18 ? ? 0.317 'SIDE CHAIN' 6 3 ARG A 23 ? ? 0.309 'SIDE CHAIN' 7 4 ARG A 18 ? ? 0.307 'SIDE CHAIN' 8 4 ARG A 23 ? ? 0.295 'SIDE CHAIN' 9 5 ARG A 18 ? ? 0.315 'SIDE CHAIN' 10 5 ARG A 23 ? ? 0.284 'SIDE CHAIN' 11 6 ARG A 18 ? ? 0.299 'SIDE CHAIN' 12 6 ARG A 23 ? ? 0.293 'SIDE CHAIN' 13 7 ARG A 18 ? ? 0.309 'SIDE CHAIN' 14 7 ARG A 23 ? ? 0.300 'SIDE CHAIN' 15 8 ARG A 18 ? ? 0.299 'SIDE CHAIN' 16 8 ARG A 23 ? ? 0.295 'SIDE CHAIN' 17 9 ARG A 18 ? ? 0.316 'SIDE CHAIN' 18 9 ARG A 23 ? ? 0.284 'SIDE CHAIN' 19 10 ARG A 18 ? ? 0.315 'SIDE CHAIN' 20 10 ARG A 23 ? ? 0.282 'SIDE CHAIN' #