data_21IK # _entry.id 21IK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.409 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 21IK pdb_000021ik 10.2210/pdb21ik/pdb WWPDB D_1300067279 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-02-04 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 21IK _pdbx_database_status.recvd_initial_deposition_date 2025-12-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBC _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email jpding@sibcb.ac.cn _pdbx_contact_author.name_first jianping _pdbx_contact_author.name_last Ding _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7029-7346 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ding, J.' 1 ? 'Chen, Z.' 2 ? 'Zhong, Y.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'The MIDN Catch-IRF4 (V2T) fusion protein' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ding, J.' 1 ? primary 'Chen, Z.' 2 ? primary 'Zhong, Y.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Midnolin,Interferon regulatory factor 4' 7451.407 1 ? V216T ? ? 2 polymer man Midnolin 7722.657 1 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'Midbrain nucleolar protein,IRF-4,Lymphocyte-specific interferon regulatory factor,LSIRF,Multiple myeloma oncogene 1,NF-EM5' 2 'Midbrain nucleolar protein' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no SRPEQSVMQALESLTETQVSDFLSGRSPLTLALRVGDHMMFVQLQLAWPACENGCQTTGTFYACAPPE SRPEQSVMQALESLTETQVSDFLSGRSPLTLALRVGDHMMFVQLQLAWPACENGCQTTGTFYACAPPE A ? 2 'polypeptide(L)' no no PGAVIESFVNHAPGVFSGTFSGTLHPNCQDSSGRPRRDIGTILQILNDLLSATRHYQGMPPSLAQLRCHAGSG PGAVIESFVNHAPGVFSGTFSGTLHPNCQDSSGRPRRDIGTILQILNDLLSATRHYQGMPPSLAQLRCHAGSG B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ARG n 1 3 PRO n 1 4 GLU n 1 5 GLN n 1 6 SER n 1 7 VAL n 1 8 MET n 1 9 GLN n 1 10 ALA n 1 11 LEU n 1 12 GLU n 1 13 SER n 1 14 LEU n 1 15 THR n 1 16 GLU n 1 17 THR n 1 18 GLN n 1 19 VAL n 1 20 SER n 1 21 ASP n 1 22 PHE n 1 23 LEU n 1 24 SER n 1 25 GLY n 1 26 ARG n 1 27 SER n 1 28 PRO n 1 29 LEU n 1 30 THR n 1 31 LEU n 1 32 ALA n 1 33 LEU n 1 34 ARG n 1 35 VAL n 1 36 GLY n 1 37 ASP n 1 38 HIS n 1 39 MET n 1 40 MET n 1 41 PHE n 1 42 VAL n 1 43 GLN n 1 44 LEU n 1 45 GLN n 1 46 LEU n 1 47 ALA n 1 48 TRP n 1 49 PRO n 1 50 ALA n 1 51 CYS n 1 52 GLU n 1 53 ASN n 1 54 GLY n 1 55 CYS n 1 56 GLN n 1 57 THR n 1 58 THR n 1 59 GLY n 1 60 THR n 1 61 PHE n 1 62 TYR n 1 63 ALA n 1 64 CYS n 1 65 ALA n 1 66 PRO n 1 67 PRO n 1 68 GLU n 2 1 PRO n 2 2 GLY n 2 3 ALA n 2 4 VAL n 2 5 ILE n 2 6 GLU n 2 7 SER n 2 8 PHE n 2 9 VAL n 2 10 ASN n 2 11 HIS n 2 12 ALA n 2 13 PRO n 2 14 GLY n 2 15 VAL n 2 16 PHE n 2 17 SER n 2 18 GLY n 2 19 THR n 2 20 PHE n 2 21 SER n 2 22 GLY n 2 23 THR n 2 24 LEU n 2 25 HIS n 2 26 PRO n 2 27 ASN n 2 28 CYS n 2 29 GLN n 2 30 ASP n 2 31 SER n 2 32 SER n 2 33 GLY n 2 34 ARG n 2 35 PRO n 2 36 ARG n 2 37 ARG n 2 38 ASP n 2 39 ILE n 2 40 GLY n 2 41 THR n 2 42 ILE n 2 43 LEU n 2 44 GLN n 2 45 ILE n 2 46 LEU n 2 47 ASN n 2 48 ASP n 2 49 LEU n 2 50 LEU n 2 51 SER n 2 52 ALA n 2 53 THR n 2 54 ARG n 2 55 HIS n 2 56 TYR n 2 57 GLN n 2 58 GLY n 2 59 MET n 2 60 PRO n 2 61 PRO n 2 62 SER n 2 63 LEU n 2 64 ALA n 2 65 GLN n 2 66 LEU n 2 67 ARG n 2 68 CYS n 2 69 HIS n 2 70 ALA n 2 71 GLY n 2 72 SER n 2 73 GLY n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 47 human ? MIDN ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 48 68 human ? 'IRF4, MUM1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 73 human ? MIDN ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 111 ? ? ? A . n A 1 2 ARG 2 112 112 ARG ARG A . n A 1 3 PRO 3 113 113 PRO PRO A . n A 1 4 GLU 4 114 114 GLU GLU A . n A 1 5 GLN 5 115 115 GLN GLN A . n A 1 6 SER 6 116 116 SER SER A . n A 1 7 VAL 7 117 117 VAL VAL A . n A 1 8 MET 8 118 118 MET MET A . n A 1 9 GLN 9 119 119 GLN GLN A . n A 1 10 ALA 10 120 120 ALA ALA A . n A 1 11 LEU 11 121 121 LEU LEU A . n A 1 12 GLU 12 122 122 GLU GLU A . n A 1 13 SER 13 123 123 SER SER A . n A 1 14 LEU 14 124 124 LEU LEU A . n A 1 15 THR 15 125 125 THR THR A . n A 1 16 GLU 16 126 126 GLU GLU A . n A 1 17 THR 17 127 127 THR THR A . n A 1 18 GLN 18 128 128 GLN GLN A . n A 1 19 VAL 19 129 129 VAL VAL A . n A 1 20 SER 20 130 130 SER SER A . n A 1 21 ASP 21 131 131 ASP ASP A . n A 1 22 PHE 22 132 132 PHE PHE A . n A 1 23 LEU 23 133 133 LEU LEU A . n A 1 24 SER 24 134 134 SER SER A . n A 1 25 GLY 25 135 135 GLY GLY A . n A 1 26 ARG 26 136 136 ARG ARG A . n A 1 27 SER 27 137 137 SER SER A . n A 1 28 PRO 28 138 138 PRO PRO A . n A 1 29 LEU 29 139 139 LEU LEU A . n A 1 30 THR 30 140 140 THR THR A . n A 1 31 LEU 31 141 141 LEU LEU A . n A 1 32 ALA 32 142 142 ALA ALA A . n A 1 33 LEU 33 143 143 LEU LEU A . n A 1 34 ARG 34 144 144 ARG ARG A . n A 1 35 VAL 35 145 145 VAL VAL A . n A 1 36 GLY 36 146 146 GLY GLY A . n A 1 37 ASP 37 147 147 ASP ASP A . n A 1 38 HIS 38 148 148 HIS HIS A . n A 1 39 MET 39 149 149 MET MET A . n A 1 40 MET 40 150 150 MET MET A . n A 1 41 PHE 41 151 151 PHE PHE A . n A 1 42 VAL 42 152 152 VAL VAL A . n A 1 43 GLN 43 153 153 GLN GLN A . n A 1 44 LEU 44 154 154 LEU LEU A . n A 1 45 GLN 45 155 155 GLN GLN A . n A 1 46 LEU 46 156 156 LEU LEU A . n A 1 47 ALA 47 157 157 ALA ALA A . n A 1 48 TRP 48 158 158 TRP TRP A . n A 1 49 PRO 49 159 159 PRO PRO A . n A 1 50 ALA 50 160 160 ALA ALA A . n A 1 51 CYS 51 161 ? ? ? A . n A 1 52 GLU 52 162 ? ? ? A . n A 1 53 ASN 53 163 ? ? ? A . n A 1 54 GLY 54 164 164 GLY GLY A . n A 1 55 CYS 55 165 165 CYS CYS A . n A 1 56 GLN 56 166 166 GLN GLN A . n A 1 57 THR 57 167 167 THR THR A . n A 1 58 THR 58 168 168 THR THR A . n A 1 59 GLY 59 169 169 GLY GLY A . n A 1 60 THR 60 170 170 THR THR A . n A 1 61 PHE 61 171 171 PHE PHE A . n A 1 62 TYR 62 172 172 TYR TYR A . n A 1 63 ALA 63 173 173 ALA ALA A . n A 1 64 CYS 64 174 174 CYS CYS A . n A 1 65 ALA 65 175 175 ALA ALA A . n A 1 66 PRO 66 176 176 PRO PRO A . n A 1 67 PRO 67 177 177 PRO PRO A . n A 1 68 GLU 68 178 ? ? ? A . n B 2 1 PRO 1 265 ? ? ? B . n B 2 2 GLY 2 266 266 GLY GLY B . n B 2 3 ALA 3 267 267 ALA ALA B . n B 2 4 VAL 4 268 268 VAL VAL B . n B 2 5 ILE 5 269 269 ILE ILE B . n B 2 6 GLU 6 270 270 GLU GLU B . n B 2 7 SER 7 271 271 SER SER B . n B 2 8 PHE 8 272 272 PHE PHE B . n B 2 9 VAL 9 273 273 VAL VAL B . n B 2 10 ASN 10 274 274 ASN ASN B . n B 2 11 HIS 11 275 275 HIS HIS B . n B 2 12 ALA 12 276 276 ALA ALA B . n B 2 13 PRO 13 277 277 PRO PRO B . n B 2 14 GLY 14 278 278 GLY GLY B . n B 2 15 VAL 15 279 279 VAL VAL B . n B 2 16 PHE 16 280 280 PHE PHE B . n B 2 17 SER 17 281 281 SER SER B . n B 2 18 GLY 18 282 282 GLY GLY B . n B 2 19 THR 19 283 283 THR THR B . n B 2 20 PHE 20 284 284 PHE PHE B . n B 2 21 SER 21 285 285 SER SER B . n B 2 22 GLY 22 286 286 GLY GLY B . n B 2 23 THR 23 287 287 THR THR B . n B 2 24 LEU 24 288 288 LEU LEU B . n B 2 25 HIS 25 289 289 HIS HIS B . n B 2 26 PRO 26 290 ? ? ? B . n B 2 27 ASN 27 291 ? ? ? B . n B 2 28 CYS 28 292 ? ? ? B . n B 2 29 GLN 29 293 ? ? ? B . n B 2 30 ASP 30 294 ? ? ? B . n B 2 31 SER 31 295 ? ? ? B . n B 2 32 SER 32 296 ? ? ? B . n B 2 33 GLY 33 297 ? ? ? B . n B 2 34 ARG 34 298 ? ? ? B . n B 2 35 PRO 35 299 ? ? ? B . n B 2 36 ARG 36 300 ? ? ? B . n B 2 37 ARG 37 301 301 ARG ARG B . n B 2 38 ASP 38 302 302 ASP ASP B . n B 2 39 ILE 39 303 303 ILE ILE B . n B 2 40 GLY 40 304 304 GLY GLY B . n B 2 41 THR 41 305 305 THR THR B . n B 2 42 ILE 42 306 306 ILE ILE B . n B 2 43 LEU 43 307 307 LEU LEU B . n B 2 44 GLN 44 308 308 GLN GLN B . n B 2 45 ILE 45 309 309 ILE ILE B . n B 2 46 LEU 46 310 310 LEU LEU B . n B 2 47 ASN 47 311 311 ASN ASN B . n B 2 48 ASP 48 312 312 ASP ASP B . n B 2 49 LEU 49 313 313 LEU LEU B . n B 2 50 LEU 50 314 314 LEU LEU B . n B 2 51 SER 51 315 315 SER SER B . n B 2 52 ALA 52 316 316 ALA ALA B . n B 2 53 THR 53 317 317 THR THR B . n B 2 54 ARG 54 318 318 ARG ARG B . n B 2 55 HIS 55 319 319 HIS HIS B . n B 2 56 TYR 56 320 320 TYR TYR B . n B 2 57 GLN 57 321 321 GLN GLN B . n B 2 58 GLY 58 322 322 GLY GLY B . n B 2 59 MET 59 323 323 MET MET B . n B 2 60 PRO 60 324 324 PRO PRO B . n B 2 61 PRO 61 325 325 PRO PRO B . n B 2 62 SER 62 326 326 SER SER B . n B 2 63 LEU 63 327 327 LEU LEU B . n B 2 64 ALA 64 328 328 ALA ALA B . n B 2 65 GLN 65 329 ? ? ? B . n B 2 66 LEU 66 330 ? ? ? B . n B 2 67 ARG 67 331 ? ? ? B . n B 2 68 CYS 68 332 ? ? ? B . n B 2 69 HIS 69 333 ? ? ? B . n B 2 70 ALA 70 334 ? ? ? B . n B 2 71 GLY 71 335 ? ? ? B . n B 2 72 SER 72 336 ? ? ? B . n B 2 73 GLY 73 337 ? ? ? B . n # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 112 ? CG ? A ARG 2 CG 2 1 Y 1 A ARG 112 ? CD ? A ARG 2 CD 3 1 Y 1 A ARG 112 ? NE ? A ARG 2 NE 4 1 Y 1 A ARG 112 ? CZ ? A ARG 2 CZ 5 1 Y 1 A ARG 112 ? NH1 ? A ARG 2 NH1 6 1 Y 1 A ARG 112 ? NH2 ? A ARG 2 NH2 7 1 Y 1 A ARG 144 ? CG ? A ARG 34 CG 8 1 Y 1 A ARG 144 ? CD ? A ARG 34 CD 9 1 Y 1 A ARG 144 ? NE ? A ARG 34 NE 10 1 Y 1 A ARG 144 ? CZ ? A ARG 34 CZ 11 1 Y 1 A ARG 144 ? NH1 ? A ARG 34 NH1 12 1 Y 1 A ARG 144 ? NH2 ? A ARG 34 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.21.2_5419 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 3 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 21IK _cell.details ? _cell.formula_units_Z ? _cell.length_a 88.289 _cell.length_a_esd ? _cell.length_b 88.289 _cell.length_b_esd ? _cell.length_c 71.777 _cell.length_c_esd ? _cell.volume 484539.437 _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 21IK _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall 'P 65 2 (x,y,z+1/12)' _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 21IK _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.66 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.78 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '4% (v/v) tacsimate (pH 4.0) and 20% (w/v) polyethylene glycol (PEG) 3,350.' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 289 # _diffrn.ambient_environment ? _diffrn.ambient_temp 193 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2025-12-08 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97918 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL10U2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97918 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL10U2 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 86.69 _reflns.entry_id 21IK _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.99 _reflns.d_resolution_low 44.14 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 3673 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 14.6 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 3.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.992 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.99 _reflns_shell.d_res_low 3.17 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 571 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.876 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 90.61 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 21IK _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.99 _refine.ls_d_res_low 33.74 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 3641 _refine.ls_number_reflns_R_free 364 _refine.ls_number_reflns_R_work 3277 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.73 _refine.ls_percent_reflns_R_free 10.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2383 _refine.ls_R_factor_R_free 0.2806 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2336 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.4464 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4856 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.99 _refine_hist.d_res_low 33.74 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 856 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 856 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0085 ? 874 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.9956 ? 1189 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0486 ? 140 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0061 ? 153 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 16.3069 ? 303 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.99 3.42 . . 127 1047 99.83 . . . . 0.3115 . . . . . . . . . . . . . . . 0.3660 'X-RAY DIFFRACTION' 3.42 4.31 . . 114 1073 99.83 . . . . 0.2328 . . . . . . . . . . . . . . . 0.2906 'X-RAY DIFFRACTION' 4.31 33.74 . . 123 1157 99.53 . . . . 0.2164 . . . . . . . . . . . . . . . 0.2529 # _struct.entry_id 21IK _struct.title 'The MIDN Catch-IRF4 (V2T) fusion protein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 21IK _struct_keywords.text 'Midnolin, IRF4, proteasome, NUCLEAR PROTEIN' _struct_keywords.pdbx_keywords 'NUCLEAR PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP MIDN_HUMAN Q504T8 ? 1 SRPEQSVMQALESLTETQVSDFLSGRSPLTLALRVGDHMMFVQLQLA 111 2 UNP IRF4_HUMAN Q15306 ? 1 WQGPACENGCQVTGTFYACAPPE 205 3 UNP MIDN_HUMAN Q504T8 ? 2 PGAVIESFVNHAPGVFSGTFSGTLHPNCQDSSGRPRRDIGTILQILNDLLSATRHYQGMPPSLAQLRCHA 265 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 21IK A 1 ? 47 ? Q504T8 111 ? 157 ? 111 157 2 2 21IK A 48 ? 68 ? Q15306 205 ? 227 ? 158 178 3 3 21IK B 1 ? 70 ? Q504T8 265 ? 334 ? 265 334 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 2 21IK ? A ? ? UNP Q15306 GLN 206 deletion ? 1 2 21IK ? A ? ? UNP Q15306 GLY 207 deletion ? 2 2 21IK THR A 57 ? UNP Q15306 VAL 216 'engineered mutation' 167 3 3 21IK GLY B 71 ? UNP Q504T8 ? ? 'expression tag' 335 4 3 21IK SER B 72 ? UNP Q504T8 ? ? 'expression tag' 336 5 3 21IK GLY B 73 ? UNP Q504T8 ? ? 'expression tag' 337 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2460 ? 1 MORE -26 ? 1 'SSA (A^2)' 6700 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 2 ? SER A 13 ? ARG A 112 SER A 123 1 ? 12 HELX_P HELX_P2 AA2 THR A 15 ? SER A 24 ? THR A 125 SER A 134 1 ? 10 HELX_P HELX_P3 AA3 ASP B 38 ? THR B 53 ? ASP B 302 THR B 317 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 64 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 64 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 174 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 174 _struct_conn.ptnr2_symmetry 7_554 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.095 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 64 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 64 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 174 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 174 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 7_554 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id TRP _struct_mon_prot_cis.label_seq_id 48 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id TRP _struct_mon_prot_cis.auth_seq_id 158 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 49 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 159 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 4.40 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 29 ? LEU A 33 ? LEU A 139 LEU A 143 AA1 2 MET A 40 ? LEU A 46 ? MET A 150 LEU A 156 AA1 3 GLN A 56 ? CYS A 64 ? GLN A 166 CYS A 174 AA1 4 VAL B 15 ? THR B 23 ? VAL B 279 THR B 287 AA1 5 ALA B 3 ? ALA B 12 ? ALA B 267 ALA B 276 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 31 ? N LEU A 141 O VAL A 42 ? O VAL A 152 AA1 2 3 N PHE A 41 ? N PHE A 151 O CYS A 64 ? O CYS A 174 AA1 3 4 N GLY A 59 ? N GLY A 169 O PHE B 20 ? O PHE B 284 AA1 4 5 O VAL B 15 ? O VAL B 279 N ALA B 12 ? N ALA B 276 # _pdbx_entry_details.entry_id 21IK _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO B 277 ? ? -54.60 106.08 2 1 HIS B 319 ? ? -84.04 35.93 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+5/6 3 y,-x+y,z+1/6 4 -y,x-y,z+2/3 5 -x+y,-x,z+1/3 6 x-y,-y,-z 7 -x,-x+y,-z+1/3 8 -x,-y,z+1/2 9 y,x,-z+2/3 10 -y,-x,-z+1/6 11 -x+y,y,-z+1/2 12 x,x-y,-z+5/6 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 2.85810140231 28.4464721232 -11.1750044196 0.73991360714 ? 0.200964226479 ? -0.0545372586981 ? 0.824763413818 ? -0.0606726846203 ? 0.758505815761 ? 0.231410815324 ? -0.0234756363909 ? 0.131471356229 ? 0.0661138225715 ? -0.152973635896 ? 0.482644906643 ? -0.233308019162 ? 1.51613690041 ? 0.588658863565 ? 0.221821691157 ? -0.0887105791496 ? 0.494307807126 ? -0.714148823219 ? 0.1123914456 ? -0.00469534976539 ? 2 'X-RAY DIFFRACTION' ? refined 8.17425421725 15.4858603993 -4.52279660223 0.699916288636 ? -0.0928181580994 ? -0.00953812938452 ? 0.459621839754 ? -0.0398441719959 ? 0.519022006502 ? 0.263463132866 ? -0.185243002043 ? -0.108662288831 ? 0.182447388633 ? 0.125955227559 ? 0.138133674481 ? 0.236119127309 ? 0.188654611393 ? -0.841518603337 ? 0.3387463345 ? 0.180022231829 ? -0.279559729752 ? 0.472683380674 ? -0.426844844474 ? -0.00207445145184 ? 3 'X-RAY DIFFRACTION' ? refined 12.2932966468 26.7704186818 -8.01275280041 0.743820281361 ? -0.117928832529 ? -0.074248939073 ? 0.33771926879 ? 0.0215581389407 ? 0.619684044594 ? 1.30019893922 ? -0.319746786025 ? -1.08263181347 ? 0.28010434637 ? 0.598093191373 ? 1.41672700453 ? -0.311396921308 ? 0.0360538246552 ? 0.165832806908 ? -0.0190074210052 ? 0.561669333651 ? -1.27308564911 ? -0.321714049113 ? 0.013974581477 ? 0.0276360349481 ? 4 'X-RAY DIFFRACTION' ? refined 14.9129459549 30.7021081587 -7.6445699693 0.765158392814 ? -0.17836495775 ? -0.0373145092867 ? 0.408022333023 ? -0.0100294606975 ? 0.364797956532 ? 0.732314404235 ? 0.00453888129232 ? -0.589318366773 ? 0.681037857162 ? 0.473140337591 ? 0.816783883163 ? 0.164056705831 ? 0.178629952746 ? -0.311990357083 ? -0.40322463603 ? 0.282730319681 ? 0.0348289098235 ? -0.0197259682526 ? 0.270892897289 ? 0.00607679241414 ? 5 'X-RAY DIFFRACTION' ? refined 14.2414499042 19.1343699687 8.79965555445 0.899075501155 ? -0.0379329302982 ? 0.00681781758085 ? 0.625959781114 ? 0.0965930506058 ? 0.580727964074 ? 1.73352438024 ? 0.227036823896 ? -3.04940927587 ? 0.108374716509 ? -0.496740143656 ? 5.85632968741 ? 1.24058002052 ? -0.285931507851 ? -0.402107681151 ? -0.174659428715 ? -0.387576649366 ? 0.696738204555 ? -1.80199448011 ? -0.494825580435 ? 0.125914181864 ? 6 'X-RAY DIFFRACTION' ? refined 18.6778298433 34.3956413436 -5.37497577779 1.03989747625 ? -0.374276144841 ? -0.37574534418 ? 0.142493744108 ? -0.234851801679 ? 0.437948100708 ? 0.553330938486 ? -0.188845676558 ? 0.556627904407 ? 1.36931868255 ? 0.163012214515 ? 1.07036863187 ? -0.490927341489 ? 0.117785738917 ? 0.0373005269163 ? -0.118433201453 ? 0.14868018373 ? -0.696199803038 ? -0.0693663250812 ? -0.172336122876 ? -2.43398270389 ? 7 'X-RAY DIFFRACTION' ? refined 20.0263823971 36.9320174068 1.7597587308 1.11060861143 ? -0.362335855207 ? -0.0409689930504 ? 0.670438790031 ? -0.277240724068 ? 0.474120711124 ? 8.65908786765 ? -0.255361658641 ? -2.35573312271 ? 0.0118096845259 ? 0.0708207952253 ? 0.642383951607 ? -0.174832665693 ? -0.589993092931 ? -0.689796214087 ? -0.547924463801 ? -0.0706723796057 ? -0.433287247072 ? -0.193380120218 ? 0.687935274386 ? -0.826464190571 ? 8 'X-RAY DIFFRACTION' ? refined 11.0848324949 26.9354874515 4.8727534237 0.622930444871 ? -0.00599270139633 ? 0.0990809553038 ? 0.768176136309 ? -0.0979049085317 ? 0.696876832627 ? 0.396316284679 ? -0.158922136398 ? 0.976869308775 ? 0.0752201082084 ? -0.364668944076 ? 2.52032412776 ? -0.282398081446 ? 0.115209727544 ? -0.823315734992 ? 0.335026902241 ? 0.239051696446 ? -0.252903115287 ? -1.0443481942 ? -1.12238471641 ? 0.0776814872445 ? 9 'X-RAY DIFFRACTION' ? refined 6.10011133772 29.4723064988 1.17574098273 0.465921250302 ? 0.030714463626 ? -0.0900869979711 ? 0.537569115935 ? -0.0386402831299 ? 0.747128584582 ? 0.19890324239 ? -0.110988539476 ? 0.194852129814 ? 0.071013759387 ? -0.124736484182 ? 0.228585450176 ? -0.606912762107 ? -0.344012915677 ? 1.18231123403 ? 0.206175834731 ? 0.206444963061 ? 1.29617614991 ? 0.0289200010089 ? -0.611581107074 ? -0.00228345730324 ? 10 'X-RAY DIFFRACTION' ? refined 10.3842804389 42.4164214356 -2.25573025683 1.19021479784 ? 0.0607508665842 ? 0.00765884083312 ? 1.50653078231 ? 0.440723970714 ? 1.45094826783 ? 0.21813581828 ? 0.0399851802275 ? 0.0132730724184 ? 0.0207320648373 ? 0.0101357616893 ? 0.0071631192739 ? 0.537703784914 ? 1.57488865496 ? 0.678333033519 ? 0.0675400659572 ? -0.703526799155 ? 0.169213461096 ? -0.393359852461 ? -0.810502367703 ? 0.00127831240036 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 1 A 112 ? A 11 A 122 ? ? ;chain 'A' and (resid 112 through 122 ) ; 2 'X-RAY DIFFRACTION' 2 A 12 A 123 ? A 22 A 133 ? ? ;chain 'A' and (resid 123 through 133 ) ; 3 'X-RAY DIFFRACTION' 3 A 23 A 134 ? A 36 A 147 ? ? ;chain 'A' and (resid 134 through 147 ) ; 4 'X-RAY DIFFRACTION' 4 A 37 A 148 ? A 45 A 156 ? ? ;chain 'A' and (resid 148 through 156 ) ; 5 'X-RAY DIFFRACTION' 5 A 46 A 157 ? A 54 A 168 ? ? ;chain 'A' and (resid 157 through 168 ) ; 6 'X-RAY DIFFRACTION' 6 A 55 A 169 ? A 63 A 177 ? ? ;chain 'A' and (resid 169 through 177 ) ; 7 'X-RAY DIFFRACTION' 7 B 1 B 266 ? B 14 B 279 ? ? ;chain 'B' and (resid 266 through 279 ) ; 8 'X-RAY DIFFRACTION' 8 B 15 B 280 ? B 26 B 302 ? ? ;chain 'B' and (resid 280 through 302 ) ; 9 'X-RAY DIFFRACTION' 9 B 27 B 303 ? B 41 B 317 ? ? ;chain 'B' and (resid 303 through 317 ) ; 10 'X-RAY DIFFRACTION' 10 B 42 B 318 ? B 52 B 328 ? ? ;chain 'B' and (resid 318 through 328 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 111 ? A SER 1 2 1 Y 1 A CYS 161 ? A CYS 51 3 1 Y 1 A GLU 162 ? A GLU 52 4 1 Y 1 A ASN 163 ? A ASN 53 5 1 Y 1 A GLU 178 ? A GLU 68 6 1 Y 1 B PRO 265 ? B PRO 1 7 1 Y 1 B PRO 290 ? B PRO 26 8 1 Y 1 B ASN 291 ? B ASN 27 9 1 Y 1 B CYS 292 ? B CYS 28 10 1 Y 1 B GLN 293 ? B GLN 29 11 1 Y 1 B ASP 294 ? B ASP 30 12 1 Y 1 B SER 295 ? B SER 31 13 1 Y 1 B SER 296 ? B SER 32 14 1 Y 1 B GLY 297 ? B GLY 33 15 1 Y 1 B ARG 298 ? B ARG 34 16 1 Y 1 B PRO 299 ? B PRO 35 17 1 Y 1 B ARG 300 ? B ARG 36 18 1 Y 1 B GLN 329 ? B GLN 65 19 1 Y 1 B LEU 330 ? B LEU 66 20 1 Y 1 B ARG 331 ? B ARG 67 21 1 Y 1 B CYS 332 ? B CYS 68 22 1 Y 1 B HIS 333 ? B HIS 69 23 1 Y 1 B ALA 334 ? B ALA 70 24 1 Y 1 B GLY 335 ? B GLY 71 25 1 Y 1 B SER 336 ? B SER 72 26 1 Y 1 B GLY 337 ? B GLY 73 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 MET N N N N 202 MET CA C N S 203 MET C C N N 204 MET O O N N 205 MET CB C N N 206 MET CG C N N 207 MET SD S N N 208 MET CE C N N 209 MET OXT O N N 210 MET H H N N 211 MET H2 H N N 212 MET HA H N N 213 MET HB2 H N N 214 MET HB3 H N N 215 MET HG2 H N N 216 MET HG3 H N N 217 MET HE1 H N N 218 MET HE2 H N N 219 MET HE3 H N N 220 MET HXT H N N 221 PHE N N N N 222 PHE CA C N S 223 PHE C C N N 224 PHE O O N N 225 PHE CB C N N 226 PHE CG C Y N 227 PHE CD1 C Y N 228 PHE CD2 C Y N 229 PHE CE1 C Y N 230 PHE CE2 C Y N 231 PHE CZ C Y N 232 PHE OXT O N N 233 PHE H H N N 234 PHE H2 H N N 235 PHE HA H N N 236 PHE HB2 H N N 237 PHE HB3 H N N 238 PHE HD1 H N N 239 PHE HD2 H N N 240 PHE HE1 H N N 241 PHE HE2 H N N 242 PHE HZ H N N 243 PHE HXT H N N 244 PRO N N N N 245 PRO CA C N S 246 PRO C C N N 247 PRO O O N N 248 PRO CB C N N 249 PRO CG C N N 250 PRO CD C N N 251 PRO OXT O N N 252 PRO H H N N 253 PRO HA H N N 254 PRO HB2 H N N 255 PRO HB3 H N N 256 PRO HG2 H N N 257 PRO HG3 H N N 258 PRO HD2 H N N 259 PRO HD3 H N N 260 PRO HXT H N N 261 SER N N N N 262 SER CA C N S 263 SER C C N N 264 SER O O N N 265 SER CB C N N 266 SER OG O N N 267 SER OXT O N N 268 SER H H N N 269 SER H2 H N N 270 SER HA H N N 271 SER HB2 H N N 272 SER HB3 H N N 273 SER HG H N N 274 SER HXT H N N 275 THR N N N N 276 THR CA C N S 277 THR C C N N 278 THR O O N N 279 THR CB C N R 280 THR OG1 O N N 281 THR CG2 C N N 282 THR OXT O N N 283 THR H H N N 284 THR H2 H N N 285 THR HA H N N 286 THR HB H N N 287 THR HG1 H N N 288 THR HG21 H N N 289 THR HG22 H N N 290 THR HG23 H N N 291 THR HXT H N N 292 TRP N N N N 293 TRP CA C N S 294 TRP C C N N 295 TRP O O N N 296 TRP CB C N N 297 TRP CG C Y N 298 TRP CD1 C Y N 299 TRP CD2 C Y N 300 TRP NE1 N Y N 301 TRP CE2 C Y N 302 TRP CE3 C Y N 303 TRP CZ2 C Y N 304 TRP CZ3 C Y N 305 TRP CH2 C Y N 306 TRP OXT O N N 307 TRP H H N N 308 TRP H2 H N N 309 TRP HA H N N 310 TRP HB2 H N N 311 TRP HB3 H N N 312 TRP HD1 H N N 313 TRP HE1 H N N 314 TRP HE3 H N N 315 TRP HZ2 H N N 316 TRP HZ3 H N N 317 TRP HH2 H N N 318 TRP HXT H N N 319 TYR N N N N 320 TYR CA C N S 321 TYR C C N N 322 TYR O O N N 323 TYR CB C N N 324 TYR CG C Y N 325 TYR CD1 C Y N 326 TYR CD2 C Y N 327 TYR CE1 C Y N 328 TYR CE2 C Y N 329 TYR CZ C Y N 330 TYR OH O N N 331 TYR OXT O N N 332 TYR H H N N 333 TYR H2 H N N 334 TYR HA H N N 335 TYR HB2 H N N 336 TYR HB3 H N N 337 TYR HD1 H N N 338 TYR HD2 H N N 339 TYR HE1 H N N 340 TYR HE2 H N N 341 TYR HH H N N 342 TYR HXT H N N 343 VAL N N N N 344 VAL CA C N S 345 VAL C C N N 346 VAL O O N N 347 VAL CB C N N 348 VAL CG1 C N N 349 VAL CG2 C N N 350 VAL OXT O N N 351 VAL H H N N 352 VAL H2 H N N 353 VAL HA H N N 354 VAL HB H N N 355 VAL HG11 H N N 356 VAL HG12 H N N 357 VAL HG13 H N N 358 VAL HG21 H N N 359 VAL HG22 H N N 360 VAL HG23 H N N 361 VAL HXT H N N 362 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 MET N CA sing N N 192 MET N H sing N N 193 MET N H2 sing N N 194 MET CA C sing N N 195 MET CA CB sing N N 196 MET CA HA sing N N 197 MET C O doub N N 198 MET C OXT sing N N 199 MET CB CG sing N N 200 MET CB HB2 sing N N 201 MET CB HB3 sing N N 202 MET CG SD sing N N 203 MET CG HG2 sing N N 204 MET CG HG3 sing N N 205 MET SD CE sing N N 206 MET CE HE1 sing N N 207 MET CE HE2 sing N N 208 MET CE HE3 sing N N 209 MET OXT HXT sing N N 210 PHE N CA sing N N 211 PHE N H sing N N 212 PHE N H2 sing N N 213 PHE CA C sing N N 214 PHE CA CB sing N N 215 PHE CA HA sing N N 216 PHE C O doub N N 217 PHE C OXT sing N N 218 PHE CB CG sing N N 219 PHE CB HB2 sing N N 220 PHE CB HB3 sing N N 221 PHE CG CD1 doub Y N 222 PHE CG CD2 sing Y N 223 PHE CD1 CE1 sing Y N 224 PHE CD1 HD1 sing N N 225 PHE CD2 CE2 doub Y N 226 PHE CD2 HD2 sing N N 227 PHE CE1 CZ doub Y N 228 PHE CE1 HE1 sing N N 229 PHE CE2 CZ sing Y N 230 PHE CE2 HE2 sing N N 231 PHE CZ HZ sing N N 232 PHE OXT HXT sing N N 233 PRO N CA sing N N 234 PRO N CD sing N N 235 PRO N H sing N N 236 PRO CA C sing N N 237 PRO CA CB sing N N 238 PRO CA HA sing N N 239 PRO C O doub N N 240 PRO C OXT sing N N 241 PRO CB CG sing N N 242 PRO CB HB2 sing N N 243 PRO CB HB3 sing N N 244 PRO CG CD sing N N 245 PRO CG HG2 sing N N 246 PRO CG HG3 sing N N 247 PRO CD HD2 sing N N 248 PRO CD HD3 sing N N 249 PRO OXT HXT sing N N 250 SER N CA sing N N 251 SER N H sing N N 252 SER N H2 sing N N 253 SER CA C sing N N 254 SER CA CB sing N N 255 SER CA HA sing N N 256 SER C O doub N N 257 SER C OXT sing N N 258 SER CB OG sing N N 259 SER CB HB2 sing N N 260 SER CB HB3 sing N N 261 SER OG HG sing N N 262 SER OXT HXT sing N N 263 THR N CA sing N N 264 THR N H sing N N 265 THR N H2 sing N N 266 THR CA C sing N N 267 THR CA CB sing N N 268 THR CA HA sing N N 269 THR C O doub N N 270 THR C OXT sing N N 271 THR CB OG1 sing N N 272 THR CB CG2 sing N N 273 THR CB HB sing N N 274 THR OG1 HG1 sing N N 275 THR CG2 HG21 sing N N 276 THR CG2 HG22 sing N N 277 THR CG2 HG23 sing N N 278 THR OXT HXT sing N N 279 TRP N CA sing N N 280 TRP N H sing N N 281 TRP N H2 sing N N 282 TRP CA C sing N N 283 TRP CA CB sing N N 284 TRP CA HA sing N N 285 TRP C O doub N N 286 TRP C OXT sing N N 287 TRP CB CG sing N N 288 TRP CB HB2 sing N N 289 TRP CB HB3 sing N N 290 TRP CG CD1 doub Y N 291 TRP CG CD2 sing Y N 292 TRP CD1 NE1 sing Y N 293 TRP CD1 HD1 sing N N 294 TRP CD2 CE2 doub Y N 295 TRP CD2 CE3 sing Y N 296 TRP NE1 CE2 sing Y N 297 TRP NE1 HE1 sing N N 298 TRP CE2 CZ2 sing Y N 299 TRP CE3 CZ3 doub Y N 300 TRP CE3 HE3 sing N N 301 TRP CZ2 CH2 doub Y N 302 TRP CZ2 HZ2 sing N N 303 TRP CZ3 CH2 sing Y N 304 TRP CZ3 HZ3 sing N N 305 TRP CH2 HH2 sing N N 306 TRP OXT HXT sing N N 307 TYR N CA sing N N 308 TYR N H sing N N 309 TYR N H2 sing N N 310 TYR CA C sing N N 311 TYR CA CB sing N N 312 TYR CA HA sing N N 313 TYR C O doub N N 314 TYR C OXT sing N N 315 TYR CB CG sing N N 316 TYR CB HB2 sing N N 317 TYR CB HB3 sing N N 318 TYR CG CD1 doub Y N 319 TYR CG CD2 sing Y N 320 TYR CD1 CE1 sing Y N 321 TYR CD1 HD1 sing N N 322 TYR CD2 CE2 doub Y N 323 TYR CD2 HD2 sing N N 324 TYR CE1 CZ doub Y N 325 TYR CE1 HE1 sing N N 326 TYR CE2 CZ sing Y N 327 TYR CE2 HE2 sing N N 328 TYR CZ OH sing N N 329 TYR OH HH sing N N 330 TYR OXT HXT sing N N 331 VAL N CA sing N N 332 VAL N H sing N N 333 VAL N H2 sing N N 334 VAL CA C sing N N 335 VAL CA CB sing N N 336 VAL CA HA sing N N 337 VAL C O doub N N 338 VAL C OXT sing N N 339 VAL CB CG1 sing N N 340 VAL CB CG2 sing N N 341 VAL CB HB sing N N 342 VAL CG1 HG11 sing N N 343 VAL CG1 HG12 sing N N 344 VAL CG1 HG13 sing N N 345 VAL CG2 HG21 sing N N 346 VAL CG2 HG22 sing N N 347 VAL CG2 HG23 sing N N 348 VAL OXT HXT sing N N 349 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 65 2 2' _space_group.name_Hall 'P 65 2 (x,y,z+1/12)' _space_group.IT_number 179 _space_group.crystal_system hexagonal _space_group.id 1 # _atom_sites.entry_id 21IK _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.011326 _atom_sites.fract_transf_matrix[1][2] 0.006539 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013079 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013932 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 6.96715 ? ? ? 11.43723 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #