data_21KW # _entry.id 21KW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.414 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 21KW pdb_000021kw 10.2210/pdb21kw/pdb WWPDB D_1300067444 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-06-10 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 21KW _pdbx_database_status.recvd_initial_deposition_date 2025-12-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBC _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 2 _pdbx_contact_author.email wangwm@sxu.edu.cn _pdbx_contact_author.name_first Wang _pdbx_contact_author.name_last 'w.m. Wang' _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-0903-3461 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wang, W.M.' 1 0000-0002-0903-3461 'Yao, H.' 2 ? 'Gong, W.J.' 3 ? 'Wang, H.F.' 4 0000-0002-8162-9243 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country DE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Small _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1613-6829 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first e73922 _citation.page_last e73922 _citation.title 'Redesign of the Ferritin Ferroxidase Center for Universal Molecular Binding or Specific Recognition.' _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/smll.73922 _citation.pdbx_database_id_PubMed 42178779 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, W.' 1 ? primary 'Yao, H.' 2 ? primary 'Gong, W.' 3 ? primary 'Ma, D.' 4 ? primary 'Qiao, J.' 5 ? primary 'Zhang, Y.' 6 ? primary 'Wu, L.' 7 ? primary 'Fan, C.' 8 ? primary 'Zhao, Y.' 9 ? primary 'Wang, Z.' 10 ? primary 'Jia, Z.' 11 ? primary 'Guo, Y.' 12 ? primary 'Zhang, N.' 13 ? primary 'Zhao, G.' 14 0000-0001-8587-9680 primary 'Yun, Y.' 15 ? primary 'Wang, H.' 16 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ferritin heavy chain, N-terminally processed' 20067.391 1 ? ? ? ? 2 non-polymer syn '1-(2-chloroethyl)-3-(4-methylcyclohexyl)-1-nitroso-urea' 247.722 2 ? ? ? ? 3 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 4 non-polymer syn 'MAGNESIUM ION' 24.305 2 ? ? ? ? 5 water nat water 18.015 206 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;TTASTSQVRQNYHQDSEAAINRQINLALYASYVALSMSYYFDRDDVALKNFAKAFLAASHAAREAAEALMKLQNQRGGRI FLQDIQKPDCDDWESGLNAMECALHLAKNVNQSLLELHKLATDKNDPHLCDFIETAALNAAVAAIKALGDHVTNLRKMGA PESGLAEYLFDKHTLGDSDNES ; _entity_poly.pdbx_seq_one_letter_code_can ;TTASTSQVRQNYHQDSEAAINRQINLALYASYVALSMSYYFDRDDVALKNFAKAFLAASHAAREAAEALMKLQNQRGGRI FLQDIQKPDCDDWESGLNAMECALHLAKNVNQSLLELHKLATDKNDPHLCDFIETAALNAAVAAIKALGDHVTNLRKMGA PESGLAEYLFDKHTLGDSDNES ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '1-(2-chloroethyl)-3-(4-methylcyclohexyl)-1-nitroso-urea' A1E2Y 3 'CALCIUM ION' CA 4 'MAGNESIUM ION' MG 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 THR n 1 3 ALA n 1 4 SER n 1 5 THR n 1 6 SER n 1 7 GLN n 1 8 VAL n 1 9 ARG n 1 10 GLN n 1 11 ASN n 1 12 TYR n 1 13 HIS n 1 14 GLN n 1 15 ASP n 1 16 SER n 1 17 GLU n 1 18 ALA n 1 19 ALA n 1 20 ILE n 1 21 ASN n 1 22 ARG n 1 23 GLN n 1 24 ILE n 1 25 ASN n 1 26 LEU n 1 27 ALA n 1 28 LEU n 1 29 TYR n 1 30 ALA n 1 31 SER n 1 32 TYR n 1 33 VAL n 1 34 ALA n 1 35 LEU n 1 36 SER n 1 37 MET n 1 38 SER n 1 39 TYR n 1 40 TYR n 1 41 PHE n 1 42 ASP n 1 43 ARG n 1 44 ASP n 1 45 ASP n 1 46 VAL n 1 47 ALA n 1 48 LEU n 1 49 LYS n 1 50 ASN n 1 51 PHE n 1 52 ALA n 1 53 LYS n 1 54 ALA n 1 55 PHE n 1 56 LEU n 1 57 ALA n 1 58 ALA n 1 59 SER n 1 60 HIS n 1 61 ALA n 1 62 ALA n 1 63 ARG n 1 64 GLU n 1 65 ALA n 1 66 ALA n 1 67 GLU n 1 68 ALA n 1 69 LEU n 1 70 MET n 1 71 LYS n 1 72 LEU n 1 73 GLN n 1 74 ASN n 1 75 GLN n 1 76 ARG n 1 77 GLY n 1 78 GLY n 1 79 ARG n 1 80 ILE n 1 81 PHE n 1 82 LEU n 1 83 GLN n 1 84 ASP n 1 85 ILE n 1 86 GLN n 1 87 LYS n 1 88 PRO n 1 89 ASP n 1 90 CYS n 1 91 ASP n 1 92 ASP n 1 93 TRP n 1 94 GLU n 1 95 SER n 1 96 GLY n 1 97 LEU n 1 98 ASN n 1 99 ALA n 1 100 MET n 1 101 GLU n 1 102 CYS n 1 103 ALA n 1 104 LEU n 1 105 HIS n 1 106 LEU n 1 107 ALA n 1 108 LYS n 1 109 ASN n 1 110 VAL n 1 111 ASN n 1 112 GLN n 1 113 SER n 1 114 LEU n 1 115 LEU n 1 116 GLU n 1 117 LEU n 1 118 HIS n 1 119 LYS n 1 120 LEU n 1 121 ALA n 1 122 THR n 1 123 ASP n 1 124 LYS n 1 125 ASN n 1 126 ASP n 1 127 PRO n 1 128 HIS n 1 129 LEU n 1 130 CYS n 1 131 ASP n 1 132 PHE n 1 133 ILE n 1 134 GLU n 1 135 THR n 1 136 ALA n 1 137 ALA n 1 138 LEU n 1 139 ASN n 1 140 ALA n 1 141 ALA n 1 142 VAL n 1 143 ALA n 1 144 ALA n 1 145 ILE n 1 146 LYS n 1 147 ALA n 1 148 LEU n 1 149 GLY n 1 150 ASP n 1 151 HIS n 1 152 VAL n 1 153 THR n 1 154 ASN n 1 155 LEU n 1 156 ARG n 1 157 LYS n 1 158 MET n 1 159 GLY n 1 160 ALA n 1 161 PRO n 1 162 GLU n 1 163 SER n 1 164 GLY n 1 165 LEU n 1 166 ALA n 1 167 GLU n 1 168 TYR n 1 169 LEU n 1 170 PHE n 1 171 ASP n 1 172 LYS n 1 173 HIS n 1 174 THR n 1 175 LEU n 1 176 GLY n 1 177 ASP n 1 178 SER n 1 179 ASP n 1 180 ASN n 1 181 GLU n 1 182 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 182 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1E2Y non-polymer . '1-(2-chloroethyl)-3-(4-methylcyclohexyl)-1-nitroso-urea' ? 'C10 H18 Cl N3 O2' 247.722 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 ALA 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 MET 37 37 37 MET MET A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 MET 70 70 70 MET MET A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 CYS 90 90 90 CYS CYS A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 TRP 93 93 93 TRP TRP A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 MET 100 100 100 MET MET A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 CYS 102 102 102 CYS CYS A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 HIS 105 105 105 HIS HIS A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 GLN 112 112 112 GLN GLN A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 HIS 118 118 118 HIS HIS A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 ASN 125 125 125 ASN ASN A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 PRO 127 127 127 PRO PRO A . n A 1 128 HIS 128 128 128 HIS HIS A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 CYS 130 130 130 CYS CYS A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 PHE 132 132 132 PHE PHE A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 THR 135 135 135 THR THR A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 ASN 139 139 139 ASN ASN A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 LYS 146 146 146 LYS LYS A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 HIS 151 151 151 HIS HIS A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 THR 153 153 153 THR THR A . n A 1 154 ASN 154 154 154 ASN ASN A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 MET 158 158 158 MET MET A . n A 1 159 GLY 159 159 159 GLY GLY A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 PRO 161 161 161 PRO PRO A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 SER 163 163 163 SER SER A . n A 1 164 GLY 164 164 164 GLY GLY A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 TYR 168 168 168 TYR TYR A . n A 1 169 LEU 169 169 169 LEU LEU A . n A 1 170 PHE 170 170 170 PHE PHE A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 LYS 172 172 172 LYS LYS A . n A 1 173 HIS 173 173 173 HIS HIS A . n A 1 174 THR 174 174 174 THR THR A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 GLY 176 176 176 GLY GLY A . n A 1 177 ASP 177 177 ? ? ? A . n A 1 178 SER 178 178 ? ? ? A . n A 1 179 ASP 179 179 ? ? ? A . n A 1 180 ASN 180 180 ? ? ? A . n A 1 181 GLU 181 181 ? ? ? A . n A 1 182 SER 182 182 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1E2Y _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1E2Y _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 A1E2Y 1 201 1 A1E2Y SEM A . C 2 A1E2Y 1 202 2 A1E2Y SEM A . D 3 CA 1 203 1 CA CA A . E 4 MG 1 204 1 MG MG A . F 4 MG 1 205 2 MG MG A . G 5 HOH 1 301 160 HOH HOH A . G 5 HOH 2 302 175 HOH HOH A . G 5 HOH 3 303 101 HOH HOH A . G 5 HOH 4 304 37 HOH HOH A . G 5 HOH 5 305 164 HOH HOH A . G 5 HOH 6 306 4 HOH HOH A . G 5 HOH 7 307 66 HOH HOH A . G 5 HOH 8 308 116 HOH HOH A . G 5 HOH 9 309 186 HOH HOH A . G 5 HOH 10 310 43 HOH HOH A . G 5 HOH 11 311 121 HOH HOH A . G 5 HOH 12 312 89 HOH HOH A . G 5 HOH 13 313 49 HOH HOH A . G 5 HOH 14 314 78 HOH HOH A . G 5 HOH 15 315 13 HOH HOH A . G 5 HOH 16 316 23 HOH HOH A . G 5 HOH 17 317 183 HOH HOH A . G 5 HOH 18 318 196 HOH HOH A . G 5 HOH 19 319 151 HOH HOH A . G 5 HOH 20 320 2 HOH HOH A . G 5 HOH 21 321 74 HOH HOH A . G 5 HOH 22 322 187 HOH HOH A . G 5 HOH 23 323 35 HOH HOH A . G 5 HOH 24 324 84 HOH HOH A . G 5 HOH 25 325 36 HOH HOH A . G 5 HOH 26 326 94 HOH HOH A . G 5 HOH 27 327 118 HOH HOH A . G 5 HOH 28 328 131 HOH HOH A . G 5 HOH 29 329 10 HOH HOH A . G 5 HOH 30 330 161 HOH HOH A . G 5 HOH 31 331 182 HOH HOH A . G 5 HOH 32 332 76 HOH HOH A . G 5 HOH 33 333 103 HOH HOH A . G 5 HOH 34 334 113 HOH HOH A . G 5 HOH 35 335 3 HOH HOH A . G 5 HOH 36 336 25 HOH HOH A . G 5 HOH 37 337 63 HOH HOH A . G 5 HOH 38 338 108 HOH HOH A . G 5 HOH 39 339 21 HOH HOH A . G 5 HOH 40 340 105 HOH HOH A . G 5 HOH 41 341 88 HOH HOH A . G 5 HOH 42 342 67 HOH HOH A . G 5 HOH 43 343 197 HOH HOH A . G 5 HOH 44 344 14 HOH HOH A . G 5 HOH 45 345 104 HOH HOH A . G 5 HOH 46 346 6 HOH HOH A . G 5 HOH 47 347 47 HOH HOH A . G 5 HOH 48 348 95 HOH HOH A . G 5 HOH 49 349 51 HOH HOH A . G 5 HOH 50 350 110 HOH HOH A . G 5 HOH 51 351 54 HOH HOH A . G 5 HOH 52 352 92 HOH HOH A . G 5 HOH 53 353 5 HOH HOH A . G 5 HOH 54 354 189 HOH HOH A . G 5 HOH 55 355 98 HOH HOH A . G 5 HOH 56 356 106 HOH HOH A . G 5 HOH 57 357 59 HOH HOH A . G 5 HOH 58 358 194 HOH HOH A . G 5 HOH 59 359 45 HOH HOH A . G 5 HOH 60 360 174 HOH HOH A . G 5 HOH 61 361 34 HOH HOH A . G 5 HOH 62 362 15 HOH HOH A . G 5 HOH 63 363 38 HOH HOH A . G 5 HOH 64 364 60 HOH HOH A . G 5 HOH 65 365 136 HOH HOH A . G 5 HOH 66 366 166 HOH HOH A . G 5 HOH 67 367 120 HOH HOH A . G 5 HOH 68 368 138 HOH HOH A . G 5 HOH 69 369 17 HOH HOH A . G 5 HOH 70 370 124 HOH HOH A . G 5 HOH 71 371 12 HOH HOH A . G 5 HOH 72 372 11 HOH HOH A . G 5 HOH 73 373 9 HOH HOH A . G 5 HOH 74 374 24 HOH HOH A . G 5 HOH 75 375 32 HOH HOH A . G 5 HOH 76 376 16 HOH HOH A . G 5 HOH 77 377 83 HOH HOH A . G 5 HOH 78 378 28 HOH HOH A . G 5 HOH 79 379 8 HOH HOH A . G 5 HOH 80 380 61 HOH HOH A . G 5 HOH 81 381 115 HOH HOH A . G 5 HOH 82 382 7 HOH HOH A . G 5 HOH 83 383 96 HOH HOH A . G 5 HOH 84 384 157 HOH HOH A . G 5 HOH 85 385 155 HOH HOH A . G 5 HOH 86 386 26 HOH HOH A . G 5 HOH 87 387 44 HOH HOH A . G 5 HOH 88 388 193 HOH HOH A . G 5 HOH 89 389 57 HOH HOH A . G 5 HOH 90 390 20 HOH HOH A . G 5 HOH 91 391 180 HOH HOH A . G 5 HOH 92 392 211 HOH HOH A . G 5 HOH 93 393 109 HOH HOH A . G 5 HOH 94 394 64 HOH HOH A . G 5 HOH 95 395 102 HOH HOH A . G 5 HOH 96 396 42 HOH HOH A . G 5 HOH 97 397 93 HOH HOH A . G 5 HOH 98 398 144 HOH HOH A . G 5 HOH 99 399 111 HOH HOH A . G 5 HOH 100 400 41 HOH HOH A . G 5 HOH 101 401 70 HOH HOH A . G 5 HOH 102 402 22 HOH HOH A . G 5 HOH 103 403 19 HOH HOH A . G 5 HOH 104 404 48 HOH HOH A . G 5 HOH 105 405 159 HOH HOH A . G 5 HOH 106 406 55 HOH HOH A . G 5 HOH 107 407 125 HOH HOH A . G 5 HOH 108 408 206 HOH HOH A . G 5 HOH 109 409 80 HOH HOH A . G 5 HOH 110 410 39 HOH HOH A . G 5 HOH 111 411 62 HOH HOH A . G 5 HOH 112 412 91 HOH HOH A . G 5 HOH 113 413 56 HOH HOH A . G 5 HOH 114 414 100 HOH HOH A . G 5 HOH 115 415 87 HOH HOH A . G 5 HOH 116 416 73 HOH HOH A . G 5 HOH 117 417 52 HOH HOH A . G 5 HOH 118 418 134 HOH HOH A . G 5 HOH 119 419 1 HOH HOH A . G 5 HOH 120 420 168 HOH HOH A . G 5 HOH 121 421 99 HOH HOH A . G 5 HOH 122 422 114 HOH HOH A . G 5 HOH 123 423 86 HOH HOH A . G 5 HOH 124 424 127 HOH HOH A . G 5 HOH 125 425 142 HOH HOH A . G 5 HOH 126 426 146 HOH HOH A . G 5 HOH 127 427 205 HOH HOH A . G 5 HOH 128 428 46 HOH HOH A . G 5 HOH 129 429 27 HOH HOH A . G 5 HOH 130 430 210 HOH HOH A . G 5 HOH 131 431 129 HOH HOH A . G 5 HOH 132 432 90 HOH HOH A . G 5 HOH 133 433 165 HOH HOH A . G 5 HOH 134 434 172 HOH HOH A . G 5 HOH 135 435 50 HOH HOH A . G 5 HOH 136 436 191 HOH HOH A . G 5 HOH 137 437 148 HOH HOH A . G 5 HOH 138 438 71 HOH HOH A . G 5 HOH 139 439 198 HOH HOH A . G 5 HOH 140 440 188 HOH HOH A . G 5 HOH 141 441 58 HOH HOH A . G 5 HOH 142 442 208 HOH HOH A . G 5 HOH 143 443 31 HOH HOH A . G 5 HOH 144 444 147 HOH HOH A . G 5 HOH 145 445 167 HOH HOH A . G 5 HOH 146 446 169 HOH HOH A . G 5 HOH 147 447 33 HOH HOH A . G 5 HOH 148 448 132 HOH HOH A . G 5 HOH 149 449 18 HOH HOH A . G 5 HOH 150 450 133 HOH HOH A . G 5 HOH 151 451 75 HOH HOH A . G 5 HOH 152 452 162 HOH HOH A . G 5 HOH 153 453 185 HOH HOH A . G 5 HOH 154 454 68 HOH HOH A . G 5 HOH 155 455 209 HOH HOH A . G 5 HOH 156 456 77 HOH HOH A . G 5 HOH 157 457 69 HOH HOH A . G 5 HOH 158 458 126 HOH HOH A . G 5 HOH 159 459 190 HOH HOH A . G 5 HOH 160 460 192 HOH HOH A . G 5 HOH 161 461 179 HOH HOH A . G 5 HOH 162 462 82 HOH HOH A . G 5 HOH 163 463 158 HOH HOH A . G 5 HOH 164 464 149 HOH HOH A . G 5 HOH 165 465 163 HOH HOH A . G 5 HOH 166 466 203 HOH HOH A . G 5 HOH 167 467 130 HOH HOH A . G 5 HOH 168 468 207 HOH HOH A . G 5 HOH 169 469 30 HOH HOH A . G 5 HOH 170 470 112 HOH HOH A . G 5 HOH 171 471 156 HOH HOH A . G 5 HOH 172 472 150 HOH HOH A . G 5 HOH 173 473 128 HOH HOH A . G 5 HOH 174 474 97 HOH HOH A . G 5 HOH 175 475 178 HOH HOH A . G 5 HOH 176 476 119 HOH HOH A . G 5 HOH 177 477 107 HOH HOH A . G 5 HOH 178 478 154 HOH HOH A . G 5 HOH 179 479 145 HOH HOH A . G 5 HOH 180 480 184 HOH HOH A . G 5 HOH 181 481 29 HOH HOH A . G 5 HOH 182 482 176 HOH HOH A . G 5 HOH 183 483 170 HOH HOH A . G 5 HOH 184 484 153 HOH HOH A . G 5 HOH 185 485 204 HOH HOH A . G 5 HOH 186 486 117 HOH HOH A . G 5 HOH 187 487 81 HOH HOH A . G 5 HOH 188 488 152 HOH HOH A . G 5 HOH 189 489 137 HOH HOH A . G 5 HOH 190 490 85 HOH HOH A . G 5 HOH 191 491 195 HOH HOH A . G 5 HOH 192 492 65 HOH HOH A . G 5 HOH 193 493 123 HOH HOH A . G 5 HOH 194 494 40 HOH HOH A . G 5 HOH 195 495 141 HOH HOH A . G 5 HOH 196 496 173 HOH HOH A . G 5 HOH 197 497 202 HOH HOH A . G 5 HOH 198 498 139 HOH HOH A . G 5 HOH 199 499 140 HOH HOH A . G 5 HOH 200 500 53 HOH HOH A . G 5 HOH 201 501 212 HOH HOH A . G 5 HOH 202 502 171 HOH HOH A . G 5 HOH 203 503 177 HOH HOH A . G 5 HOH 204 504 143 HOH HOH A . G 5 HOH 205 505 201 HOH HOH A . G 5 HOH 206 506 181 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.19.2_4158: ???)' ? 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . ? 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . ? 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? . ? 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 21KW _cell.details ? _cell.formula_units_Z ? _cell.length_a 182.150 _cell.length_a_esd ? _cell.length_b 182.150 _cell.length_b_esd ? _cell.length_c 182.150 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 96 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 21KW _symmetry.cell_setting ? _symmetry.Int_Tables_number 209 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'F 4 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 21KW _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.14 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 60.79 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'Bicine, MgCl2' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 298 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2025-12-04 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9785 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL18U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9785 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL18U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 21KW _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.00 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 18110 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 37.1 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.371 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.124 _reflns.pdbx_Rpim_I_all 0.020 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 672631 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.995 _reflns.pdbx_CC_star 0.999 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.123 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.00 2.03 ? ? ? ? ? ? 885 ? ? ? ? ? ? ? ? ? ? ? 36.9 0.556 ? ? 0.707 0.115 ? 1 1 0.957 0.989 ? 100.0 ? 0.698 ? ? ? ? ? ? ? ? ? 2.03 2.07 ? ? ? ? ? ? 888 ? ? ? ? ? ? ? ? ? ? ? 39.1 0.592 ? ? 0.613 0.098 ? 2 1 0.956 0.989 ? 100.0 ? 0.605 ? ? ? ? ? ? ? ? ? 2.07 2.11 ? ? ? ? ? ? 878 ? ? ? ? ? ? ? ? ? ? ? 38.9 0.618 ? ? 0.538 0.086 ? 3 1 0.977 0.994 ? 100.0 ? 0.531 ? ? ? ? ? ? ? ? ? 2.11 2.15 ? ? ? ? ? ? 883 ? ? ? ? ? ? ? ? ? ? ? 38.5 0.702 ? ? 0.446 0.072 ? 4 1 0.982 0.996 ? 100.0 ? 0.440 ? ? ? ? ? ? ? ? ? 2.15 2.20 ? ? ? ? ? ? 871 ? ? ? ? ? ? ? ? ? ? ? 37.7 0.748 ? ? 0.396 0.064 ? 5 1 0.986 0.996 ? 100.0 ? 0.391 ? ? ? ? ? ? ? ? ? 2.20 2.25 ? ? ? ? ? ? 892 ? ? ? ? ? ? ? ? ? ? ? 36.4 0.808 ? ? 0.358 0.059 ? 6 1 0.989 0.997 ? 100.0 ? 0.353 ? ? ? ? ? ? ? ? ? 2.25 2.31 ? ? ? ? ? ? 875 ? ? ? ? ? ? ? ? ? ? ? 38.2 0.866 ? ? 0.330 0.053 ? 7 1 0.987 0.997 ? 100.0 ? 0.326 ? ? ? ? ? ? ? ? ? 2.31 2.37 ? ? ? ? ? ? 897 ? ? ? ? ? ? ? ? ? ? ? 36.9 0.918 ? ? 0.286 0.047 ? 8 1 0.993 0.998 ? 100.0 ? 0.282 ? ? ? ? ? ? ? ? ? 2.37 2.44 ? ? ? ? ? ? 889 ? ? ? ? ? ? ? ? ? ? ? 39.3 0.995 ? ? 0.256 0.041 ? 9 1 0.993 0.998 ? 100.0 ? 0.252 ? ? ? ? ? ? ? ? ? 2.44 2.52 ? ? ? ? ? ? 883 ? ? ? ? ? ? ? ? ? ? ? 38.8 1.106 ? ? 0.222 0.036 ? 10 1 0.993 0.998 ? 100.0 ? 0.219 ? ? ? ? ? ? ? ? ? 2.52 2.61 ? ? ? ? ? ? 905 ? ? ? ? ? ? ? ? ? ? ? 37.8 1.144 ? ? 0.207 0.033 ? 11 1 0.996 0.999 ? 100.0 ? 0.204 ? ? ? ? ? ? ? ? ? 2.61 2.71 ? ? ? ? ? ? 885 ? ? ? ? ? ? ? ? ? ? ? 36.0 1.310 ? ? 0.179 0.030 ? 12 1 0.996 0.999 ? 100.0 ? 0.176 ? ? ? ? ? ? ? ? ? 2.71 2.84 ? ? ? ? ? ? 902 ? ? ? ? ? ? ? ? ? ? ? 37.6 1.478 ? ? 0.162 0.026 ? 13 1 0.998 0.999 ? 100.0 ? 0.160 ? ? ? ? ? ? ? ? ? 2.84 2.99 ? ? ? ? ? ? 903 ? ? ? ? ? ? ? ? ? ? ? 36.9 1.773 ? ? 0.136 0.022 ? 14 1 0.997 0.999 ? 100.0 ? 0.135 ? ? ? ? ? ? ? ? ? 2.99 3.17 ? ? ? ? ? ? 908 ? ? ? ? ? ? ? ? ? ? ? 38.2 1.942 ? ? 0.121 0.020 ? 15 1 0.998 1.000 ? 100.0 ? 0.120 ? ? ? ? ? ? ? ? ? 3.17 3.42 ? ? ? ? ? ? 914 ? ? ? ? ? ? ? ? ? ? ? 36.9 2.207 ? ? 0.110 0.018 ? 16 1 0.998 1.000 ? 100.0 ? 0.109 ? ? ? ? ? ? ? ? ? 3.42 3.76 ? ? ? ? ? ? 915 ? ? ? ? ? ? ? ? ? ? ? 35.9 2.687 ? ? 0.099 0.017 ? 17 1 0.999 1.000 ? 100.0 ? 0.098 ? ? ? ? ? ? ? ? ? 3.76 4.31 ? ? ? ? ? ? 937 ? ? ? ? ? ? ? ? ? ? ? 36.9 2.860 ? ? 0.092 0.015 ? 18 1 0.999 1.000 ? 100.0 ? 0.090 ? ? ? ? ? ? ? ? ? 4.31 5.43 ? ? ? ? ? ? 953 ? ? ? ? ? ? ? ? ? ? ? 35.3 2.484 ? ? 0.083 0.014 ? 19 1 0.998 1.000 ? 100.0 ? 0.082 ? ? ? ? ? ? ? ? ? 5.43 50.00 ? ? ? ? ? ? 1047 ? ? ? ? ? ? ? ? ? ? ? 31.8 1.609 ? ? 0.067 0.012 ? 20 1 0.999 1.000 ? 100.0 ? 0.066 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 21KW _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.00 _refine.ls_d_res_low 27.46 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 18095 _refine.ls_number_reflns_R_free 1809 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.98 _refine.ls_percent_reflns_R_free 10.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1695 _refine.ls_R_factor_R_free 0.2001 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1661 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 18.37 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.14 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1337 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 35 _refine_hist.number_atoms_solvent 206 _refine_hist.number_atoms_total 1578 _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 27.46 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 1392 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.900 ? 1878 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 8.435 ? 192 ? f_dihedral_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.045 ? 208 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 245 ? f_plane_restr ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.00 2.05 . . 137 1228 100.00 . . . . 0.1629 . . . . . . . . . . . . . . . 0.2446 'X-RAY DIFFRACTION' 2.05 2.11 . . 135 1227 100.00 . . . . 0.1551 . . . . . . . . . . . . . . . 0.2173 'X-RAY DIFFRACTION' 2.11 2.18 . . 136 1220 100.00 . . . . 0.1484 . . . . . . . . . . . . . . . 0.2081 'X-RAY DIFFRACTION' 2.18 2.26 . . 136 1218 100.00 . . . . 0.1474 . . . . . . . . . . . . . . . 0.1884 'X-RAY DIFFRACTION' 2.26 2.35 . . 136 1225 100.00 . . . . 0.1570 . . . . . . . . . . . . . . . 0.1739 'X-RAY DIFFRACTION' 2.35 2.46 . . 136 1229 100.00 . . . . 0.1663 . . . . . . . . . . . . . . . 0.1953 'X-RAY DIFFRACTION' 2.46 2.59 . . 137 1230 100.00 . . . . 0.1750 . . . . . . . . . . . . . . . 0.1838 'X-RAY DIFFRACTION' 2.59 2.75 . . 139 1248 100.00 . . . . 0.1757 . . . . . . . . . . . . . . . 0.1981 'X-RAY DIFFRACTION' 2.75 2.96 . . 136 1233 100.00 . . . . 0.1776 . . . . . . . . . . . . . . . 0.2354 'X-RAY DIFFRACTION' 2.96 3.26 . . 140 1257 100.00 . . . . 0.1709 . . . . . . . . . . . . . . . 0.2328 'X-RAY DIFFRACTION' 3.26 3.73 . . 141 1274 100.00 . . . . 0.1620 . . . . . . . . . . . . . . . 0.2135 'X-RAY DIFFRACTION' 3.73 4.69 . . 143 1297 100.00 . . . . 0.1446 . . . . . . . . . . . . . . . 0.1635 'X-RAY DIFFRACTION' 4.70 27.46 . . 157 1400 100.00 . . . . 0.1874 . . . . . . . . . . . . . . . 0.2006 # _struct.entry_id 21KW _struct.title 'Crystal strucrue of HuHF-C2-SEM complex' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 21KW _struct_keywords.text 'HuHF, Dacarbazine, Complex, Protein design, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 4 ? G N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FRIH_HUMAN _struct_ref.pdbx_db_accession P02794 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRI FLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGA PESGLAEYLFDKHTLGDSDNES ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 21KW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 182 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02794 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 183 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 182 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 21KW ALA A 27 ? UNP P02794 GLU 28 'engineered mutation' 27 1 1 21KW ALA A 34 ? UNP P02794 TYR 35 'engineered mutation' 34 2 1 21KW ALA A 54 ? UNP P02794 TYR 55 'engineered mutation' 54 3 1 21KW ALA A 57 ? UNP P02794 HIS 58 'engineered mutation' 57 4 1 21KW ALA A 58 ? UNP P02794 GLN 59 'engineered mutation' 58 5 1 21KW ALA A 61 ? UNP P02794 GLU 62 'engineered mutation' 61 6 1 21KW ALA A 62 ? UNP P02794 GLU 63 'engineered mutation' 62 7 1 21KW ALA A 65 ? UNP P02794 HIS 66 'engineered mutation' 65 8 1 21KW ALA A 68 ? UNP P02794 LYS 69 'engineered mutation' 68 9 1 21KW GLN A 86 ? UNP P02794 LYS 87 'engineered mutation' 86 10 1 21KW ALA A 107 ? UNP P02794 GLU 108 'engineered mutation' 107 11 1 21KW ALA A 136 ? UNP P02794 HIS 137 'engineered mutation' 136 12 1 21KW ALA A 137 ? UNP P02794 TYR 138 'engineered mutation' 137 13 1 21KW ALA A 140 ? UNP P02794 GLU 141 'engineered mutation' 140 14 1 21KW ALA A 141 ? UNP P02794 GLN 142 'engineered mutation' 141 15 1 21KW ALA A 143 ? UNP P02794 LYS 144 'engineered mutation' 143 16 1 21KW ALA A 147 ? UNP P02794 GLU 148 'engineered mutation' 147 17 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details 24-meric _pdbx_struct_assembly.oligomeric_count 24 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 96630 ? 1 MORE -914 ? 1 'SSA (A^2)' 134570 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 6 'crystal symmetry operation' 6_555 z,-x,-y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 7 'crystal symmetry operation' 7_555 -z,-x,y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 8 'crystal symmetry operation' 8_555 -z,x,-y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 9 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 10 'crystal symmetry operation' 10_555 -y,z,-x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 11 'crystal symmetry operation' 11_555 y,-z,-x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 12 'crystal symmetry operation' 12_555 -y,-z,x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 13 'crystal symmetry operation' 13_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 14 'crystal symmetry operation' 14_555 -y,-x,-z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 15 'crystal symmetry operation' 15_555 y,-x,z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 16 'crystal symmetry operation' 16_555 -y,x,z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 17 'crystal symmetry operation' 17_555 x,z,-y 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 18 'crystal symmetry operation' 18_555 -x,z,y -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 19 'crystal symmetry operation' 19_555 -x,-z,-y -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 20 'crystal symmetry operation' 20_555 x,-z,y 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 21 'crystal symmetry operation' 21_555 z,y,-x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 22 'crystal symmetry operation' 22_555 z,-y,x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 23 'crystal symmetry operation' 23_555 -z,y,x 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 24 'crystal symmetry operation' 24_555 -z,-y,-x 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 13 ? PHE A 41 ? HIS A 13 PHE A 41 1 ? 29 HELX_P HELX_P2 AA2 LEU A 48 ? ARG A 76 ? LEU A 48 ARG A 76 1 ? 29 HELX_P HELX_P3 AA3 SER A 95 ? LYS A 124 ? SER A 95 LYS A 124 1 ? 30 HELX_P HELX_P4 AA4 ASP A 126 ? ALA A 137 ? ASP A 126 ALA A 137 1 ? 12 HELX_P HELX_P5 AA5 ALA A 137 ? GLY A 159 ? ALA A 137 GLY A 159 1 ? 23 HELX_P HELX_P6 AA6 SER A 163 ? THR A 174 ? SER A 163 THR A 174 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 131 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 131 A CA 203 1_555 ? ? ? ? ? ? ? 2.557 ? ? metalc2 metalc ? ? A GLU 134 OE1 ? ? ? 1_555 D CA . CA ? ? A GLU 134 A CA 203 6_555 ? ? ? ? ? ? ? 3.105 ? ? metalc3 metalc ? ? D CA . CA ? ? ? 1_555 G HOH . O ? ? A CA 203 A HOH 419 1_555 ? ? ? ? ? ? ? 2.534 ? ? metalc4 metalc ? ? D CA . CA ? ? ? 1_555 G HOH . O ? ? A CA 203 A HOH 419 6_555 ? ? ? ? ? ? ? 2.534 ? ? metalc5 metalc ? ? E MG . MG ? ? ? 1_555 G HOH . O ? ? A MG 204 A HOH 306 1_555 ? ? ? ? ? ? ? 2.049 ? ? metalc6 metalc ? ? E MG . MG ? ? ? 1_555 G HOH . O ? ? A MG 204 A HOH 306 6_555 ? ? ? ? ? ? ? 2.049 ? ? metalc7 metalc ? ? E MG . MG ? ? ? 1_555 G HOH . O ? ? A MG 204 A HOH 455 1_555 ? ? ? ? ? ? ? 2.004 ? ? metalc8 metalc ? ? E MG . MG ? ? ? 1_555 G HOH . O ? ? A MG 204 A HOH 455 6_555 ? ? ? ? ? ? ? 2.004 ? ? metalc9 metalc ? ? F MG . MG ? ? ? 1_555 G HOH . O ? ? A MG 205 A HOH 304 1_555 ? ? ? ? ? ? ? 2.348 ? ? metalc10 metalc ? ? F MG . MG ? ? ? 1_555 G HOH . O ? ? A MG 205 A HOH 304 72_555 ? ? ? ? ? ? ? 2.348 ? ? metalc11 metalc ? ? F MG . MG ? ? ? 1_555 G HOH . O ? ? A MG 205 A HOH 321 1_555 ? ? ? ? ? ? ? 1.959 ? ? metalc12 metalc ? ? F MG . MG ? ? ? 1_555 G HOH . O ? ? A MG 205 A HOH 321 72_555 ? ? ? ? ? ? ? 1.959 ? ? metalc13 metalc ? ? F MG . MG ? ? ? 1_555 G HOH . O ? ? A MG 205 A HOH 443 51_555 ? ? ? ? ? ? ? 2.239 ? ? metalc14 metalc ? ? F MG . MG ? ? ? 1_555 G HOH . O ? ? A MG 205 A HOH 500 22_555 ? ? ? ? ? ? ? 1.978 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 131 ? A ASP 131 ? 1_555 CA ? D CA . ? A CA 203 ? 1_555 OE1 ? A GLU 134 ? A GLU 134 ? 1_555 111.3 ? 2 OD1 ? A ASP 131 ? A ASP 131 ? 1_555 CA ? D CA . ? A CA 203 ? 1_555 O ? G HOH . ? A HOH 419 ? 1_555 135.9 ? 3 OE1 ? A GLU 134 ? A GLU 134 ? 1_555 CA ? D CA . ? A CA 203 ? 1_555 O ? G HOH . ? A HOH 419 ? 1_555 32.4 ? 4 OD1 ? A ASP 131 ? A ASP 131 ? 1_555 CA ? D CA . ? A CA 203 ? 1_555 O ? G HOH . ? A HOH 419 ? 6_555 135.9 ? 5 OE1 ? A GLU 134 ? A GLU 134 ? 1_555 CA ? D CA . ? A CA 203 ? 1_555 O ? G HOH . ? A HOH 419 ? 6_555 32.4 ? 6 O ? G HOH . ? A HOH 419 ? 1_555 CA ? D CA . ? A CA 203 ? 1_555 O ? G HOH . ? A HOH 419 ? 6_555 0.0 ? 7 O ? G HOH . ? A HOH 306 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? G HOH . ? A HOH 306 ? 6_555 92.7 ? 8 O ? G HOH . ? A HOH 306 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? G HOH . ? A HOH 455 ? 1_555 84.7 ? 9 O ? G HOH . ? A HOH 306 ? 6_555 MG ? E MG . ? A MG 204 ? 1_555 O ? G HOH . ? A HOH 455 ? 1_555 89.2 ? 10 O ? G HOH . ? A HOH 306 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? G HOH . ? A HOH 455 ? 6_555 176.8 ? 11 O ? G HOH . ? A HOH 306 ? 6_555 MG ? E MG . ? A MG 204 ? 1_555 O ? G HOH . ? A HOH 455 ? 6_555 84.7 ? 12 O ? G HOH . ? A HOH 455 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? G HOH . ? A HOH 455 ? 6_555 93.4 ? 13 O ? G HOH . ? A HOH 304 ? 1_555 MG ? F MG . ? A MG 205 ? 1_555 O ? G HOH . ? A HOH 304 ? 72_555 0.0 ? 14 O ? G HOH . ? A HOH 304 ? 1_555 MG ? F MG . ? A MG 205 ? 1_555 O ? G HOH . ? A HOH 321 ? 1_555 82.8 ? 15 O ? G HOH . ? A HOH 304 ? 72_555 MG ? F MG . ? A MG 205 ? 1_555 O ? G HOH . ? A HOH 321 ? 1_555 82.8 ? 16 O ? G HOH . ? A HOH 304 ? 1_555 MG ? F MG . ? A MG 205 ? 1_555 O ? G HOH . ? A HOH 321 ? 72_555 82.8 ? 17 O ? G HOH . ? A HOH 304 ? 72_555 MG ? F MG . ? A MG 205 ? 1_555 O ? G HOH . ? A HOH 321 ? 72_555 82.8 ? 18 O ? G HOH . ? A HOH 321 ? 1_555 MG ? F MG . ? A MG 205 ? 1_555 O ? G HOH . ? A HOH 321 ? 72_555 165.6 ? 19 O ? G HOH . ? A HOH 304 ? 1_555 MG ? F MG . ? A MG 205 ? 1_555 O ? G HOH . ? A HOH 443 ? 51_555 86.2 ? 20 O ? G HOH . ? A HOH 304 ? 72_555 MG ? F MG . ? A MG 205 ? 1_555 O ? G HOH . ? A HOH 443 ? 51_555 86.2 ? 21 O ? G HOH . ? A HOH 321 ? 1_555 MG ? F MG . ? A MG 205 ? 1_555 O ? G HOH . ? A HOH 443 ? 51_555 85.1 ? 22 O ? G HOH . ? A HOH 321 ? 72_555 MG ? F MG . ? A MG 205 ? 1_555 O ? G HOH . ? A HOH 443 ? 51_555 93.9 ? 23 O ? G HOH . ? A HOH 304 ? 1_555 MG ? F MG . ? A MG 205 ? 1_555 O ? G HOH . ? A HOH 500 ? 22_555 180.0 ? 24 O ? G HOH . ? A HOH 304 ? 72_555 MG ? F MG . ? A MG 205 ? 1_555 O ? G HOH . ? A HOH 500 ? 22_555 180.0 ? 25 O ? G HOH . ? A HOH 321 ? 1_555 MG ? F MG . ? A MG 205 ? 1_555 O ? G HOH . ? A HOH 500 ? 22_555 97.2 ? 26 O ? G HOH . ? A HOH 321 ? 72_555 MG ? F MG . ? A MG 205 ? 1_555 O ? G HOH . ? A HOH 500 ? 22_555 97.2 ? 27 O ? G HOH . ? A HOH 443 ? 51_555 MG ? F MG . ? A MG 205 ? 1_555 O ? G HOH . ? A HOH 500 ? 22_555 93.8 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 160 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 160 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 161 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 161 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 1.78 # _pdbx_entry_details.entry_id 21KW _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 46 ? ? -125.52 -63.25 2 1 GLU A 94 ? ? 70.80 -47.15 3 1 ALA A 137 ? ? -134.21 -47.25 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A MG 204 ? E MG . 2 1 A MG 205 ? F MG . 3 1 A HOH 304 ? G HOH . 4 1 A HOH 419 ? G HOH . 5 1 A HOH 500 ? G HOH . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A THR 1 ? A THR 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A ALA 3 ? A ALA 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A ASP 177 ? A ASP 177 6 1 Y 1 A SER 178 ? A SER 178 7 1 Y 1 A ASP 179 ? A ASP 179 8 1 Y 1 A ASN 180 ? A ASN 180 9 1 Y 1 A GLU 181 ? A GLU 181 10 1 Y 1 A SER 182 ? A SER 182 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1E2Y C01 C N N 1 A1E2Y C02 C N N 2 A1E2Y C03 C N N 3 A1E2Y C04 C N N 4 A1E2Y C05 C N N 5 A1E2Y C06 C N N 6 A1E2Y C07 C N N 7 A1E2Y C08 C N N 8 A1E2Y C09 C N N 9 A1E2Y C10 C N N 10 A1E2Y N01 N N N 11 A1E2Y N02 N N N 12 A1E2Y N03 N N N 13 A1E2Y O01 O N N 14 A1E2Y O02 O N N 15 A1E2Y CL01 CL N N 16 A1E2Y H1 H N N 17 A1E2Y H2 H N N 18 A1E2Y H3 H N N 19 A1E2Y H4 H N N 20 A1E2Y H5 H N N 21 A1E2Y H6 H N N 22 A1E2Y H7 H N N 23 A1E2Y H8 H N N 24 A1E2Y H9 H N N 25 A1E2Y H10 H N N 26 A1E2Y H11 H N N 27 A1E2Y H12 H N N 28 A1E2Y H13 H N N 29 A1E2Y H14 H N N 30 A1E2Y H15 H N N 31 A1E2Y H16 H N N 32 A1E2Y H17 H N N 33 A1E2Y H18 H N N 34 ALA N N N N 35 ALA CA C N S 36 ALA C C N N 37 ALA O O N N 38 ALA CB C N N 39 ALA OXT O N N 40 ALA H H N N 41 ALA H2 H N N 42 ALA HA H N N 43 ALA HB1 H N N 44 ALA HB2 H N N 45 ALA HB3 H N N 46 ALA HXT H N N 47 ARG N N N N 48 ARG CA C N S 49 ARG C C N N 50 ARG O O N N 51 ARG CB C N N 52 ARG CG C N N 53 ARG CD C N N 54 ARG NE N N N 55 ARG CZ C N N 56 ARG NH1 N N N 57 ARG NH2 N N N 58 ARG OXT O N N 59 ARG H H N N 60 ARG H2 H N N 61 ARG HA H N N 62 ARG HB2 H N N 63 ARG HB3 H N N 64 ARG HG2 H N N 65 ARG HG3 H N N 66 ARG HD2 H N N 67 ARG HD3 H N N 68 ARG HE H N N 69 ARG HH11 H N N 70 ARG HH12 H N N 71 ARG HH21 H N N 72 ARG HH22 H N N 73 ARG HXT H N N 74 ASN N N N N 75 ASN CA C N S 76 ASN C C N N 77 ASN O O N N 78 ASN CB C N N 79 ASN CG C N N 80 ASN OD1 O N N 81 ASN ND2 N N N 82 ASN OXT O N N 83 ASN H H N N 84 ASN H2 H N N 85 ASN HA H N N 86 ASN HB2 H N N 87 ASN HB3 H N N 88 ASN HD21 H N N 89 ASN HD22 H N N 90 ASN HXT H N N 91 ASP N N N N 92 ASP CA C N S 93 ASP C C N N 94 ASP O O N N 95 ASP CB C N N 96 ASP CG C N N 97 ASP OD1 O N N 98 ASP OD2 O N N 99 ASP OXT O N N 100 ASP H H N N 101 ASP H2 H N N 102 ASP HA H N N 103 ASP HB2 H N N 104 ASP HB3 H N N 105 ASP HD2 H N N 106 ASP HXT H N N 107 CA CA CA N N 108 CYS N N N N 109 CYS CA C N R 110 CYS C C N N 111 CYS O O N N 112 CYS CB C N N 113 CYS SG S N N 114 CYS OXT O N N 115 CYS H H N N 116 CYS H2 H N N 117 CYS HA H N N 118 CYS HB2 H N N 119 CYS HB3 H N N 120 CYS HG H N N 121 CYS HXT H N N 122 GLN N N N N 123 GLN CA C N S 124 GLN C C N N 125 GLN O O N N 126 GLN CB C N N 127 GLN CG C N N 128 GLN CD C N N 129 GLN OE1 O N N 130 GLN NE2 N N N 131 GLN OXT O N N 132 GLN H H N N 133 GLN H2 H N N 134 GLN HA H N N 135 GLN HB2 H N N 136 GLN HB3 H N N 137 GLN HG2 H N N 138 GLN HG3 H N N 139 GLN HE21 H N N 140 GLN HE22 H N N 141 GLN HXT H N N 142 GLU N N N N 143 GLU CA C N S 144 GLU C C N N 145 GLU O O N N 146 GLU CB C N N 147 GLU CG C N N 148 GLU CD C N N 149 GLU OE1 O N N 150 GLU OE2 O N N 151 GLU OXT O N N 152 GLU H H N N 153 GLU H2 H N N 154 GLU HA H N N 155 GLU HB2 H N N 156 GLU HB3 H N N 157 GLU HG2 H N N 158 GLU HG3 H N N 159 GLU HE2 H N N 160 GLU HXT H N N 161 GLY N N N N 162 GLY CA C N N 163 GLY C C N N 164 GLY O O N N 165 GLY OXT O N N 166 GLY H H N N 167 GLY H2 H N N 168 GLY HA2 H N N 169 GLY HA3 H N N 170 GLY HXT H N N 171 HIS N N N N 172 HIS CA C N S 173 HIS C C N N 174 HIS O O N N 175 HIS CB C N N 176 HIS CG C Y N 177 HIS ND1 N Y N 178 HIS CD2 C Y N 179 HIS CE1 C Y N 180 HIS NE2 N Y N 181 HIS OXT O N N 182 HIS H H N N 183 HIS H2 H N N 184 HIS HA H N N 185 HIS HB2 H N N 186 HIS HB3 H N N 187 HIS HD1 H N N 188 HIS HD2 H N N 189 HIS HE1 H N N 190 HIS HE2 H N N 191 HIS HXT H N N 192 HOH O O N N 193 HOH H1 H N N 194 HOH H2 H N N 195 ILE N N N N 196 ILE CA C N S 197 ILE C C N N 198 ILE O O N N 199 ILE CB C N S 200 ILE CG1 C N N 201 ILE CG2 C N N 202 ILE CD1 C N N 203 ILE OXT O N N 204 ILE H H N N 205 ILE H2 H N N 206 ILE HA H N N 207 ILE HB H N N 208 ILE HG12 H N N 209 ILE HG13 H N N 210 ILE HG21 H N N 211 ILE HG22 H N N 212 ILE HG23 H N N 213 ILE HD11 H N N 214 ILE HD12 H N N 215 ILE HD13 H N N 216 ILE HXT H N N 217 LEU N N N N 218 LEU CA C N S 219 LEU C C N N 220 LEU O O N N 221 LEU CB C N N 222 LEU CG C N N 223 LEU CD1 C N N 224 LEU CD2 C N N 225 LEU OXT O N N 226 LEU H H N N 227 LEU H2 H N N 228 LEU HA H N N 229 LEU HB2 H N N 230 LEU HB3 H N N 231 LEU HG H N N 232 LEU HD11 H N N 233 LEU HD12 H N N 234 LEU HD13 H N N 235 LEU HD21 H N N 236 LEU HD22 H N N 237 LEU HD23 H N N 238 LEU HXT H N N 239 LYS N N N N 240 LYS CA C N S 241 LYS C C N N 242 LYS O O N N 243 LYS CB C N N 244 LYS CG C N N 245 LYS CD C N N 246 LYS CE C N N 247 LYS NZ N N N 248 LYS OXT O N N 249 LYS H H N N 250 LYS H2 H N N 251 LYS HA H N N 252 LYS HB2 H N N 253 LYS HB3 H N N 254 LYS HG2 H N N 255 LYS HG3 H N N 256 LYS HD2 H N N 257 LYS HD3 H N N 258 LYS HE2 H N N 259 LYS HE3 H N N 260 LYS HZ1 H N N 261 LYS HZ2 H N N 262 LYS HZ3 H N N 263 LYS HXT H N N 264 MET N N N N 265 MET CA C N S 266 MET C C N N 267 MET O O N N 268 MET CB C N N 269 MET CG C N N 270 MET SD S N N 271 MET CE C N N 272 MET OXT O N N 273 MET H H N N 274 MET H2 H N N 275 MET HA H N N 276 MET HB2 H N N 277 MET HB3 H N N 278 MET HG2 H N N 279 MET HG3 H N N 280 MET HE1 H N N 281 MET HE2 H N N 282 MET HE3 H N N 283 MET HXT H N N 284 MG MG MG N N 285 PHE N N N N 286 PHE CA C N S 287 PHE C C N N 288 PHE O O N N 289 PHE CB C N N 290 PHE CG C Y N 291 PHE CD1 C Y N 292 PHE CD2 C Y N 293 PHE CE1 C Y N 294 PHE CE2 C Y N 295 PHE CZ C Y N 296 PHE OXT O N N 297 PHE H H N N 298 PHE H2 H N N 299 PHE HA H N N 300 PHE HB2 H N N 301 PHE HB3 H N N 302 PHE HD1 H N N 303 PHE HD2 H N N 304 PHE HE1 H N N 305 PHE HE2 H N N 306 PHE HZ H N N 307 PHE HXT H N N 308 PRO N N N N 309 PRO CA C N S 310 PRO C C N N 311 PRO O O N N 312 PRO CB C N N 313 PRO CG C N N 314 PRO CD C N N 315 PRO OXT O N N 316 PRO H H N N 317 PRO HA H N N 318 PRO HB2 H N N 319 PRO HB3 H N N 320 PRO HG2 H N N 321 PRO HG3 H N N 322 PRO HD2 H N N 323 PRO HD3 H N N 324 PRO HXT H N N 325 SER N N N N 326 SER CA C N S 327 SER C C N N 328 SER O O N N 329 SER CB C N N 330 SER OG O N N 331 SER OXT O N N 332 SER H H N N 333 SER H2 H N N 334 SER HA H N N 335 SER HB2 H N N 336 SER HB3 H N N 337 SER HG H N N 338 SER HXT H N N 339 THR N N N N 340 THR CA C N S 341 THR C C N N 342 THR O O N N 343 THR CB C N R 344 THR OG1 O N N 345 THR CG2 C N N 346 THR OXT O N N 347 THR H H N N 348 THR H2 H N N 349 THR HA H N N 350 THR HB H N N 351 THR HG1 H N N 352 THR HG21 H N N 353 THR HG22 H N N 354 THR HG23 H N N 355 THR HXT H N N 356 TRP N N N N 357 TRP CA C N S 358 TRP C C N N 359 TRP O O N N 360 TRP CB C N N 361 TRP CG C Y N 362 TRP CD1 C Y N 363 TRP CD2 C Y N 364 TRP NE1 N Y N 365 TRP CE2 C Y N 366 TRP CE3 C Y N 367 TRP CZ2 C Y N 368 TRP CZ3 C Y N 369 TRP CH2 C Y N 370 TRP OXT O N N 371 TRP H H N N 372 TRP H2 H N N 373 TRP HA H N N 374 TRP HB2 H N N 375 TRP HB3 H N N 376 TRP HD1 H N N 377 TRP HE1 H N N 378 TRP HE3 H N N 379 TRP HZ2 H N N 380 TRP HZ3 H N N 381 TRP HH2 H N N 382 TRP HXT H N N 383 TYR N N N N 384 TYR CA C N S 385 TYR C C N N 386 TYR O O N N 387 TYR CB C N N 388 TYR CG C Y N 389 TYR CD1 C Y N 390 TYR CD2 C Y N 391 TYR CE1 C Y N 392 TYR CE2 C Y N 393 TYR CZ C Y N 394 TYR OH O N N 395 TYR OXT O N N 396 TYR H H N N 397 TYR H2 H N N 398 TYR HA H N N 399 TYR HB2 H N N 400 TYR HB3 H N N 401 TYR HD1 H N N 402 TYR HD2 H N N 403 TYR HE1 H N N 404 TYR HE2 H N N 405 TYR HH H N N 406 TYR HXT H N N 407 VAL N N N N 408 VAL CA C N S 409 VAL C C N N 410 VAL O O N N 411 VAL CB C N N 412 VAL CG1 C N N 413 VAL CG2 C N N 414 VAL OXT O N N 415 VAL H H N N 416 VAL H2 H N N 417 VAL HA H N N 418 VAL HB H N N 419 VAL HG11 H N N 420 VAL HG12 H N N 421 VAL HG13 H N N 422 VAL HG21 H N N 423 VAL HG22 H N N 424 VAL HG23 H N N 425 VAL HXT H N N 426 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1E2Y C10 CL01 sing N N 1 A1E2Y C10 C09 sing N N 2 A1E2Y C09 N02 sing N N 3 A1E2Y O02 C08 doub N N 4 A1E2Y N02 C08 sing N N 5 A1E2Y N02 N03 sing N N 6 A1E2Y C08 N01 sing N N 7 A1E2Y N03 O01 doub N N 8 A1E2Y C05 C06 sing N N 9 A1E2Y C05 C04 sing N N 10 A1E2Y N01 C04 sing N N 11 A1E2Y C06 C01 sing N N 12 A1E2Y C04 C03 sing N N 13 A1E2Y C01 C07 sing N N 14 A1E2Y C01 C02 sing N N 15 A1E2Y C03 C02 sing N N 16 A1E2Y C01 H1 sing N N 17 A1E2Y C02 H2 sing N N 18 A1E2Y C02 H3 sing N N 19 A1E2Y C03 H4 sing N N 20 A1E2Y C03 H5 sing N N 21 A1E2Y C04 H6 sing N N 22 A1E2Y C05 H7 sing N N 23 A1E2Y C05 H8 sing N N 24 A1E2Y C06 H9 sing N N 25 A1E2Y C06 H10 sing N N 26 A1E2Y C07 H11 sing N N 27 A1E2Y C07 H12 sing N N 28 A1E2Y C07 H13 sing N N 29 A1E2Y C09 H14 sing N N 30 A1E2Y C09 H15 sing N N 31 A1E2Y C10 H16 sing N N 32 A1E2Y C10 H17 sing N N 33 A1E2Y N01 H18 sing N N 34 ALA N CA sing N N 35 ALA N H sing N N 36 ALA N H2 sing N N 37 ALA CA C sing N N 38 ALA CA CB sing N N 39 ALA CA HA sing N N 40 ALA C O doub N N 41 ALA C OXT sing N N 42 ALA CB HB1 sing N N 43 ALA CB HB2 sing N N 44 ALA CB HB3 sing N N 45 ALA OXT HXT sing N N 46 ARG N CA sing N N 47 ARG N H sing N N 48 ARG N H2 sing N N 49 ARG CA C sing N N 50 ARG CA CB sing N N 51 ARG CA HA sing N N 52 ARG C O doub N N 53 ARG C OXT sing N N 54 ARG CB CG sing N N 55 ARG CB HB2 sing N N 56 ARG CB HB3 sing N N 57 ARG CG CD sing N N 58 ARG CG HG2 sing N N 59 ARG CG HG3 sing N N 60 ARG CD NE sing N N 61 ARG CD HD2 sing N N 62 ARG CD HD3 sing N N 63 ARG NE CZ sing N N 64 ARG NE HE sing N N 65 ARG CZ NH1 sing N N 66 ARG CZ NH2 doub N N 67 ARG NH1 HH11 sing N N 68 ARG NH1 HH12 sing N N 69 ARG NH2 HH21 sing N N 70 ARG NH2 HH22 sing N N 71 ARG OXT HXT sing N N 72 ASN N CA sing N N 73 ASN N H sing N N 74 ASN N H2 sing N N 75 ASN CA C sing N N 76 ASN CA CB sing N N 77 ASN CA HA sing N N 78 ASN C O doub N N 79 ASN C OXT sing N N 80 ASN CB CG sing N N 81 ASN CB HB2 sing N N 82 ASN CB HB3 sing N N 83 ASN CG OD1 doub N N 84 ASN CG ND2 sing N N 85 ASN ND2 HD21 sing N N 86 ASN ND2 HD22 sing N N 87 ASN OXT HXT sing N N 88 ASP N CA sing N N 89 ASP N H sing N N 90 ASP N H2 sing N N 91 ASP CA C sing N N 92 ASP CA CB sing N N 93 ASP CA HA sing N N 94 ASP C O doub N N 95 ASP C OXT sing N N 96 ASP CB CG sing N N 97 ASP CB HB2 sing N N 98 ASP CB HB3 sing N N 99 ASP CG OD1 doub N N 100 ASP CG OD2 sing N N 101 ASP OD2 HD2 sing N N 102 ASP OXT HXT sing N N 103 CYS N CA sing N N 104 CYS N H sing N N 105 CYS N H2 sing N N 106 CYS CA C sing N N 107 CYS CA CB sing N N 108 CYS CA HA sing N N 109 CYS C O doub N N 110 CYS C OXT sing N N 111 CYS CB SG sing N N 112 CYS CB HB2 sing N N 113 CYS CB HB3 sing N N 114 CYS SG HG sing N N 115 CYS OXT HXT sing N N 116 GLN N CA sing N N 117 GLN N H sing N N 118 GLN N H2 sing N N 119 GLN CA C sing N N 120 GLN CA CB sing N N 121 GLN CA HA sing N N 122 GLN C O doub N N 123 GLN C OXT sing N N 124 GLN CB CG sing N N 125 GLN CB HB2 sing N N 126 GLN CB HB3 sing N N 127 GLN CG CD sing N N 128 GLN CG HG2 sing N N 129 GLN CG HG3 sing N N 130 GLN CD OE1 doub N N 131 GLN CD NE2 sing N N 132 GLN NE2 HE21 sing N N 133 GLN NE2 HE22 sing N N 134 GLN OXT HXT sing N N 135 GLU N CA sing N N 136 GLU N H sing N N 137 GLU N H2 sing N N 138 GLU CA C sing N N 139 GLU CA CB sing N N 140 GLU CA HA sing N N 141 GLU C O doub N N 142 GLU C OXT sing N N 143 GLU CB CG sing N N 144 GLU CB HB2 sing N N 145 GLU CB HB3 sing N N 146 GLU CG CD sing N N 147 GLU CG HG2 sing N N 148 GLU CG HG3 sing N N 149 GLU CD OE1 doub N N 150 GLU CD OE2 sing N N 151 GLU OE2 HE2 sing N N 152 GLU OXT HXT sing N N 153 GLY N CA sing N N 154 GLY N H sing N N 155 GLY N H2 sing N N 156 GLY CA C sing N N 157 GLY CA HA2 sing N N 158 GLY CA HA3 sing N N 159 GLY C O doub N N 160 GLY C OXT sing N N 161 GLY OXT HXT sing N N 162 HIS N CA sing N N 163 HIS N H sing N N 164 HIS N H2 sing N N 165 HIS CA C sing N N 166 HIS CA CB sing N N 167 HIS CA HA sing N N 168 HIS C O doub N N 169 HIS C OXT sing N N 170 HIS CB CG sing N N 171 HIS CB HB2 sing N N 172 HIS CB HB3 sing N N 173 HIS CG ND1 sing Y N 174 HIS CG CD2 doub Y N 175 HIS ND1 CE1 doub Y N 176 HIS ND1 HD1 sing N N 177 HIS CD2 NE2 sing Y N 178 HIS CD2 HD2 sing N N 179 HIS CE1 NE2 sing Y N 180 HIS CE1 HE1 sing N N 181 HIS NE2 HE2 sing N N 182 HIS OXT HXT sing N N 183 HOH O H1 sing N N 184 HOH O H2 sing N N 185 ILE N CA sing N N 186 ILE N H sing N N 187 ILE N H2 sing N N 188 ILE CA C sing N N 189 ILE CA CB sing N N 190 ILE CA HA sing N N 191 ILE C O doub N N 192 ILE C OXT sing N N 193 ILE CB CG1 sing N N 194 ILE CB CG2 sing N N 195 ILE CB HB sing N N 196 ILE CG1 CD1 sing N N 197 ILE CG1 HG12 sing N N 198 ILE CG1 HG13 sing N N 199 ILE CG2 HG21 sing N N 200 ILE CG2 HG22 sing N N 201 ILE CG2 HG23 sing N N 202 ILE CD1 HD11 sing N N 203 ILE CD1 HD12 sing N N 204 ILE CD1 HD13 sing N N 205 ILE OXT HXT sing N N 206 LEU N CA sing N N 207 LEU N H sing N N 208 LEU N H2 sing N N 209 LEU CA C sing N N 210 LEU CA CB sing N N 211 LEU CA HA sing N N 212 LEU C O doub N N 213 LEU C OXT sing N N 214 LEU CB CG sing N N 215 LEU CB HB2 sing N N 216 LEU CB HB3 sing N N 217 LEU CG CD1 sing N N 218 LEU CG CD2 sing N N 219 LEU CG HG sing N N 220 LEU CD1 HD11 sing N N 221 LEU CD1 HD12 sing N N 222 LEU CD1 HD13 sing N N 223 LEU CD2 HD21 sing N N 224 LEU CD2 HD22 sing N N 225 LEU CD2 HD23 sing N N 226 LEU OXT HXT sing N N 227 LYS N CA sing N N 228 LYS N H sing N N 229 LYS N H2 sing N N 230 LYS CA C sing N N 231 LYS CA CB sing N N 232 LYS CA HA sing N N 233 LYS C O doub N N 234 LYS C OXT sing N N 235 LYS CB CG sing N N 236 LYS CB HB2 sing N N 237 LYS CB HB3 sing N N 238 LYS CG CD sing N N 239 LYS CG HG2 sing N N 240 LYS CG HG3 sing N N 241 LYS CD CE sing N N 242 LYS CD HD2 sing N N 243 LYS CD HD3 sing N N 244 LYS CE NZ sing N N 245 LYS CE HE2 sing N N 246 LYS CE HE3 sing N N 247 LYS NZ HZ1 sing N N 248 LYS NZ HZ2 sing N N 249 LYS NZ HZ3 sing N N 250 LYS OXT HXT sing N N 251 MET N CA sing N N 252 MET N H sing N N 253 MET N H2 sing N N 254 MET CA C sing N N 255 MET CA CB sing N N 256 MET CA HA sing N N 257 MET C O doub N N 258 MET C OXT sing N N 259 MET CB CG sing N N 260 MET CB HB2 sing N N 261 MET CB HB3 sing N N 262 MET CG SD sing N N 263 MET CG HG2 sing N N 264 MET CG HG3 sing N N 265 MET SD CE sing N N 266 MET CE HE1 sing N N 267 MET CE HE2 sing N N 268 MET CE HE3 sing N N 269 MET OXT HXT sing N N 270 PHE N CA sing N N 271 PHE N H sing N N 272 PHE N H2 sing N N 273 PHE CA C sing N N 274 PHE CA CB sing N N 275 PHE CA HA sing N N 276 PHE C O doub N N 277 PHE C OXT sing N N 278 PHE CB CG sing N N 279 PHE CB HB2 sing N N 280 PHE CB HB3 sing N N 281 PHE CG CD1 doub Y N 282 PHE CG CD2 sing Y N 283 PHE CD1 CE1 sing Y N 284 PHE CD1 HD1 sing N N 285 PHE CD2 CE2 doub Y N 286 PHE CD2 HD2 sing N N 287 PHE CE1 CZ doub Y N 288 PHE CE1 HE1 sing N N 289 PHE CE2 CZ sing Y N 290 PHE CE2 HE2 sing N N 291 PHE CZ HZ sing N N 292 PHE OXT HXT sing N N 293 PRO N CA sing N N 294 PRO N CD sing N N 295 PRO N H sing N N 296 PRO CA C sing N N 297 PRO CA CB sing N N 298 PRO CA HA sing N N 299 PRO C O doub N N 300 PRO C OXT sing N N 301 PRO CB CG sing N N 302 PRO CB HB2 sing N N 303 PRO CB HB3 sing N N 304 PRO CG CD sing N N 305 PRO CG HG2 sing N N 306 PRO CG HG3 sing N N 307 PRO CD HD2 sing N N 308 PRO CD HD3 sing N N 309 PRO OXT HXT sing N N 310 SER N CA sing N N 311 SER N H sing N N 312 SER N H2 sing N N 313 SER CA C sing N N 314 SER CA CB sing N N 315 SER CA HA sing N N 316 SER C O doub N N 317 SER C OXT sing N N 318 SER CB OG sing N N 319 SER CB HB2 sing N N 320 SER CB HB3 sing N N 321 SER OG HG sing N N 322 SER OXT HXT sing N N 323 THR N CA sing N N 324 THR N H sing N N 325 THR N H2 sing N N 326 THR CA C sing N N 327 THR CA CB sing N N 328 THR CA HA sing N N 329 THR C O doub N N 330 THR C OXT sing N N 331 THR CB OG1 sing N N 332 THR CB CG2 sing N N 333 THR CB HB sing N N 334 THR OG1 HG1 sing N N 335 THR CG2 HG21 sing N N 336 THR CG2 HG22 sing N N 337 THR CG2 HG23 sing N N 338 THR OXT HXT sing N N 339 TRP N CA sing N N 340 TRP N H sing N N 341 TRP N H2 sing N N 342 TRP CA C sing N N 343 TRP CA CB sing N N 344 TRP CA HA sing N N 345 TRP C O doub N N 346 TRP C OXT sing N N 347 TRP CB CG sing N N 348 TRP CB HB2 sing N N 349 TRP CB HB3 sing N N 350 TRP CG CD1 doub Y N 351 TRP CG CD2 sing Y N 352 TRP CD1 NE1 sing Y N 353 TRP CD1 HD1 sing N N 354 TRP CD2 CE2 doub Y N 355 TRP CD2 CE3 sing Y N 356 TRP NE1 CE2 sing Y N 357 TRP NE1 HE1 sing N N 358 TRP CE2 CZ2 sing Y N 359 TRP CE3 CZ3 doub Y N 360 TRP CE3 HE3 sing N N 361 TRP CZ2 CH2 doub Y N 362 TRP CZ2 HZ2 sing N N 363 TRP CZ3 CH2 sing Y N 364 TRP CZ3 HZ3 sing N N 365 TRP CH2 HH2 sing N N 366 TRP OXT HXT sing N N 367 TYR N CA sing N N 368 TYR N H sing N N 369 TYR N H2 sing N N 370 TYR CA C sing N N 371 TYR CA CB sing N N 372 TYR CA HA sing N N 373 TYR C O doub N N 374 TYR C OXT sing N N 375 TYR CB CG sing N N 376 TYR CB HB2 sing N N 377 TYR CB HB3 sing N N 378 TYR CG CD1 doub Y N 379 TYR CG CD2 sing Y N 380 TYR CD1 CE1 sing Y N 381 TYR CD1 HD1 sing N N 382 TYR CD2 CE2 doub Y N 383 TYR CD2 HD2 sing N N 384 TYR CE1 CZ doub Y N 385 TYR CE1 HE1 sing N N 386 TYR CE2 CZ sing Y N 387 TYR CE2 HE2 sing N N 388 TYR CZ OH sing N N 389 TYR OH HH sing N N 390 TYR OXT HXT sing N N 391 VAL N CA sing N N 392 VAL N H sing N N 393 VAL N H2 sing N N 394 VAL CA C sing N N 395 VAL CA CB sing N N 396 VAL CA HA sing N N 397 VAL C O doub N N 398 VAL C OXT sing N N 399 VAL CB CG1 sing N N 400 VAL CB CG2 sing N N 401 VAL CB HB sing N N 402 VAL CG1 HG11 sing N N 403 VAL CG1 HG12 sing N N 404 VAL CG1 HG13 sing N N 405 VAL CG2 HG21 sing N N 406 VAL CG2 HG22 sing N N 407 VAL CG2 HG23 sing N N 408 VAL OXT HXT sing N N 409 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 22577068 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 9VOC _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 21KW _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.005490 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.005490 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005490 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CA CL MG N O S # loop_ #