data_21OJ # _entry.id 21OJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.417 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 21OJ pdb_000021oj 10.2210/pdb21oj/pdb WWPDB D_1300067591 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-11-04 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 21OJ _pdbx_database_status.recvd_initial_deposition_date 2025-12-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBC _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 2 _pdbx_contact_author.email zhangzm@jnu.edu.cn _pdbx_contact_author.name_first Zhi-Min _pdbx_contact_author.name_last Zhang _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-5088-5869 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhang, H.' 1 ? 'Zhang, Z.M.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country GE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Angew.Chem.Int.Ed.Engl. _citation.journal_id_ASTM ACIEAY _citation.journal_id_CSD 0179 _citation.journal_id_ISSN 1521-3773 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 65 _citation.language ? _citation.page_first e1224416 _citation.page_last e1224416 _citation.title 'Dual-Site Covalent Targeting Enables BD2-Selective BET Inhibition With Potent Antitumor Activity in Mice.' _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/anie.1224416 _citation.pdbx_database_id_PubMed 42695248 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kang, J.' 1 ? primary 'Wang, X.' 2 ? primary 'Zhang, H.' 3 0009-0001-7334-8425 primary 'Lin, J.' 4 ? primary 'Chen, P.' 5 ? primary 'Wang, Z.' 6 ? primary 'Hao, Z.' 7 ? primary 'Miao, F.' 8 0009-0002-2003-5123 primary 'Zhang, F.' 9 ? primary 'Li, T.' 10 ? primary 'Xie, Y.' 11 ? primary 'Wang, J.' 12 0000-0002-5328-2908 primary 'Zhang, Z.M.' 13 0000-0002-5088-5869 primary 'Yao, S.Q.' 14 0000-0003-4715-769X primary 'Lu, X.' 15 0000-0001-7931-6873 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Bromodomain-containing protein 4' 13194.294 2 ? ? ? ? 2 non-polymer syn ;4-[2-[2,6-dimethyl-4-[(2~{S})-2-methyl-3-oxidanyl-propoxy]phenoxy]-5-(2-oxidanylpropan-2-yl)phenyl]-6-methyl-7-oxidanylidene-~{N}-prop-2-ynyl-1~{H}-pyrrolo[2,3-c]pyridine-2-carboxamide ; 571.663 2 ? ? ? ? 3 non-polymer nat GLYCEROL 92.094 1 ? ? ? ? 4 water nat water 18.015 28 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Protein HUNK1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SKVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFS NCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDE ; _entity_poly.pdbx_seq_one_letter_code_can ;SKVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFS NCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDE ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;4-[2-[2,6-dimethyl-4-[(2~{S})-2-methyl-3-oxidanyl-propoxy]phenoxy]-5-(2-oxidanylpropan-2-yl)phenyl]-6-methyl-7-oxidanylidene-~{N}-prop-2-ynyl-1~{H}-pyrrolo[2,3-c]pyridine-2-carboxamide ; A1E3W 3 GLYCEROL GOL 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 LYS n 1 3 VAL n 1 4 SER n 1 5 GLU n 1 6 GLN n 1 7 LEU n 1 8 LYS n 1 9 CYS n 1 10 CYS n 1 11 SER n 1 12 GLY n 1 13 ILE n 1 14 LEU n 1 15 LYS n 1 16 GLU n 1 17 MET n 1 18 PHE n 1 19 ALA n 1 20 LYS n 1 21 LYS n 1 22 HIS n 1 23 ALA n 1 24 ALA n 1 25 TYR n 1 26 ALA n 1 27 TRP n 1 28 PRO n 1 29 PHE n 1 30 TYR n 1 31 LYS n 1 32 PRO n 1 33 VAL n 1 34 ASP n 1 35 VAL n 1 36 GLU n 1 37 ALA n 1 38 LEU n 1 39 GLY n 1 40 LEU n 1 41 HIS n 1 42 ASP n 1 43 TYR n 1 44 CYS n 1 45 ASP n 1 46 ILE n 1 47 ILE n 1 48 LYS n 1 49 HIS n 1 50 PRO n 1 51 MET n 1 52 ASP n 1 53 MET n 1 54 SER n 1 55 THR n 1 56 ILE n 1 57 LYS n 1 58 SER n 1 59 LYS n 1 60 LEU n 1 61 GLU n 1 62 ALA n 1 63 ARG n 1 64 GLU n 1 65 TYR n 1 66 ARG n 1 67 ASP n 1 68 ALA n 1 69 GLN n 1 70 GLU n 1 71 PHE n 1 72 GLY n 1 73 ALA n 1 74 ASP n 1 75 VAL n 1 76 ARG n 1 77 LEU n 1 78 MET n 1 79 PHE n 1 80 SER n 1 81 ASN n 1 82 CYS n 1 83 TYR n 1 84 LYS n 1 85 TYR n 1 86 ASN n 1 87 PRO n 1 88 PRO n 1 89 ASP n 1 90 HIS n 1 91 GLU n 1 92 VAL n 1 93 VAL n 1 94 ALA n 1 95 MET n 1 96 ALA n 1 97 ARG n 1 98 LYS n 1 99 LEU n 1 100 GLN n 1 101 ASP n 1 102 VAL n 1 103 PHE n 1 104 GLU n 1 105 MET n 1 106 ARG n 1 107 PHE n 1 108 ALA n 1 109 LYS n 1 110 MET n 1 111 PRO n 1 112 ASP n 1 113 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 113 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BRD4, HUNK1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1E3W non-polymer . ;4-[2-[2,6-dimethyl-4-[(2~{S})-2-methyl-3-oxidanyl-propoxy]phenoxy]-5-(2-oxidanylpropan-2-yl)phenyl]-6-methyl-7-oxidanylidene-~{N}-prop-2-ynyl-1~{H}-pyrrolo[2,3-c]pyridine-2-carboxamide ; ;4-[2-[2,6-dimethyl-4-[[(2R)-2-methyloxiran-2-yl]methoxy]phenoxy]-5-(2-oxidanylpropan-2-yl)phenyl]-6-methyl-7-oxidanylidene-N-prop-2-ynyl-1H-pyrrolo[2,3-c]pyridine-2-carboxamide bound form ; 'C33 H37 N3 O6' 571.663 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 348 348 SER SER A . n A 1 2 LYS 2 349 349 LYS LYS A . n A 1 3 VAL 3 350 350 VAL VAL A . n A 1 4 SER 4 351 351 SER SER A . n A 1 5 GLU 5 352 352 GLU GLU A . n A 1 6 GLN 6 353 353 GLN GLN A . n A 1 7 LEU 7 354 354 LEU LEU A . n A 1 8 LYS 8 355 355 LYS LYS A . n A 1 9 CYS 9 356 356 CYS CYS A . n A 1 10 CYS 10 357 357 CYS CYS A . n A 1 11 SER 11 358 358 SER SER A . n A 1 12 GLY 12 359 359 GLY GLY A . n A 1 13 ILE 13 360 360 ILE ILE A . n A 1 14 LEU 14 361 361 LEU LEU A . n A 1 15 LYS 15 362 362 LYS LYS A . n A 1 16 GLU 16 363 363 GLU GLU A . n A 1 17 MET 17 364 364 MET MET A . n A 1 18 PHE 18 365 365 PHE PHE A . n A 1 19 ALA 19 366 366 ALA ALA A . n A 1 20 LYS 20 367 367 LYS LYS A . n A 1 21 LYS 21 368 368 LYS LYS A . n A 1 22 HIS 22 369 369 HIS HIS A . n A 1 23 ALA 23 370 370 ALA ALA A . n A 1 24 ALA 24 371 371 ALA ALA A . n A 1 25 TYR 25 372 372 TYR TYR A . n A 1 26 ALA 26 373 373 ALA ALA A . n A 1 27 TRP 27 374 374 TRP TRP A . n A 1 28 PRO 28 375 375 PRO PRO A . n A 1 29 PHE 29 376 376 PHE PHE A . n A 1 30 TYR 30 377 377 TYR TYR A . n A 1 31 LYS 31 378 378 LYS LYS A . n A 1 32 PRO 32 379 379 PRO PRO A . n A 1 33 VAL 33 380 380 VAL VAL A . n A 1 34 ASP 34 381 381 ASP ASP A . n A 1 35 VAL 35 382 382 VAL VAL A . n A 1 36 GLU 36 383 383 GLU GLU A . n A 1 37 ALA 37 384 384 ALA ALA A . n A 1 38 LEU 38 385 385 LEU LEU A . n A 1 39 GLY 39 386 386 GLY GLY A . n A 1 40 LEU 40 387 387 LEU LEU A . n A 1 41 HIS 41 388 388 HIS HIS A . n A 1 42 ASP 42 389 389 ASP ASP A . n A 1 43 TYR 43 390 390 TYR TYR A . n A 1 44 CYS 44 391 391 CYS CYS A . n A 1 45 ASP 45 392 392 ASP ASP A . n A 1 46 ILE 46 393 393 ILE ILE A . n A 1 47 ILE 47 394 394 ILE ILE A . n A 1 48 LYS 48 395 395 LYS LYS A . n A 1 49 HIS 49 396 396 HIS HIS A . n A 1 50 PRO 50 397 397 PRO PRO A . n A 1 51 MET 51 398 398 MET MET A . n A 1 52 ASP 52 399 399 ASP ASP A . n A 1 53 MET 53 400 400 MET MET A . n A 1 54 SER 54 401 401 SER SER A . n A 1 55 THR 55 402 402 THR THR A . n A 1 56 ILE 56 403 403 ILE ILE A . n A 1 57 LYS 57 404 404 LYS LYS A . n A 1 58 SER 58 405 405 SER SER A . n A 1 59 LYS 59 406 406 LYS LYS A . n A 1 60 LEU 60 407 407 LEU LEU A . n A 1 61 GLU 61 408 408 GLU GLU A . n A 1 62 ALA 62 409 409 ALA ALA A . n A 1 63 ARG 63 410 410 ARG ARG A . n A 1 64 GLU 64 411 411 GLU GLU A . n A 1 65 TYR 65 412 412 TYR TYR A . n A 1 66 ARG 66 413 413 ARG ARG A . n A 1 67 ASP 67 414 414 ASP ASP A . n A 1 68 ALA 68 415 415 ALA ALA A . n A 1 69 GLN 69 416 416 GLN GLN A . n A 1 70 GLU 70 417 417 GLU GLU A . n A 1 71 PHE 71 418 418 PHE PHE A . n A 1 72 GLY 72 419 419 GLY GLY A . n A 1 73 ALA 73 420 420 ALA ALA A . n A 1 74 ASP 74 421 421 ASP ASP A . n A 1 75 VAL 75 422 422 VAL VAL A . n A 1 76 ARG 76 423 423 ARG ARG A . n A 1 77 LEU 77 424 424 LEU LEU A . n A 1 78 MET 78 425 425 MET MET A . n A 1 79 PHE 79 426 426 PHE PHE A . n A 1 80 SER 80 427 427 SER SER A . n A 1 81 ASN 81 428 428 ASN ASN A . n A 1 82 CYS 82 429 429 CYS CYS A . n A 1 83 TYR 83 430 430 TYR TYR A . n A 1 84 LYS 84 431 431 LYS LYS A . n A 1 85 TYR 85 432 432 TYR TYR A . n A 1 86 ASN 86 433 433 ASN ASN A . n A 1 87 PRO 87 434 434 PRO PRO A . n A 1 88 PRO 88 435 435 PRO PRO A . n A 1 89 ASP 89 436 436 ASP ASP A . n A 1 90 HIS 90 437 437 HIS HIS A . n A 1 91 GLU 91 438 438 GLU GLU A . n A 1 92 VAL 92 439 439 VAL VAL A . n A 1 93 VAL 93 440 440 VAL VAL A . n A 1 94 ALA 94 441 441 ALA ALA A . n A 1 95 MET 95 442 442 MET MET A . n A 1 96 ALA 96 443 443 ALA ALA A . n A 1 97 ARG 97 444 444 ARG ARG A . n A 1 98 LYS 98 445 445 LYS LYS A . n A 1 99 LEU 99 446 446 LEU LEU A . n A 1 100 GLN 100 447 447 GLN GLN A . n A 1 101 ASP 101 448 448 ASP ASP A . n A 1 102 VAL 102 449 449 VAL VAL A . n A 1 103 PHE 103 450 450 PHE PHE A . n A 1 104 GLU 104 451 451 GLU GLU A . n A 1 105 MET 105 452 452 MET MET A . n A 1 106 ARG 106 453 453 ARG ARG A . n A 1 107 PHE 107 454 454 PHE PHE A . n A 1 108 ALA 108 455 455 ALA ALA A . n A 1 109 LYS 109 456 456 LYS LYS A . n A 1 110 MET 110 457 457 MET MET A . n A 1 111 PRO 111 458 458 PRO PRO A . n A 1 112 ASP 112 459 459 ASP ASP A . n A 1 113 GLU 113 460 ? ? ? A . n B 1 1 SER 1 348 348 SER SER B . n B 1 2 LYS 2 349 349 LYS LYS B . n B 1 3 VAL 3 350 350 VAL VAL B . n B 1 4 SER 4 351 351 SER SER B . n B 1 5 GLU 5 352 352 GLU GLU B . n B 1 6 GLN 6 353 353 GLN GLN B . n B 1 7 LEU 7 354 354 LEU LEU B . n B 1 8 LYS 8 355 355 LYS LYS B . n B 1 9 CYS 9 356 356 CYS CYS B . n B 1 10 CYS 10 357 357 CYS CYS B . n B 1 11 SER 11 358 358 SER SER B . n B 1 12 GLY 12 359 359 GLY GLY B . n B 1 13 ILE 13 360 360 ILE ILE B . n B 1 14 LEU 14 361 361 LEU LEU B . n B 1 15 LYS 15 362 362 LYS LYS B . n B 1 16 GLU 16 363 363 GLU GLU B . n B 1 17 MET 17 364 364 MET MET B . n B 1 18 PHE 18 365 365 PHE PHE B . n B 1 19 ALA 19 366 366 ALA ALA B . n B 1 20 LYS 20 367 367 LYS LYS B . n B 1 21 LYS 21 368 368 LYS LYS B . n B 1 22 HIS 22 369 369 HIS HIS B . n B 1 23 ALA 23 370 370 ALA ALA B . n B 1 24 ALA 24 371 371 ALA ALA B . n B 1 25 TYR 25 372 372 TYR TYR B . n B 1 26 ALA 26 373 373 ALA ALA B . n B 1 27 TRP 27 374 374 TRP TRP B . n B 1 28 PRO 28 375 375 PRO PRO B . n B 1 29 PHE 29 376 376 PHE PHE B . n B 1 30 TYR 30 377 377 TYR TYR B . n B 1 31 LYS 31 378 378 LYS LYS B . n B 1 32 PRO 32 379 379 PRO PRO B . n B 1 33 VAL 33 380 380 VAL VAL B . n B 1 34 ASP 34 381 381 ASP ASP B . n B 1 35 VAL 35 382 382 VAL VAL B . n B 1 36 GLU 36 383 383 GLU GLU B . n B 1 37 ALA 37 384 384 ALA ALA B . n B 1 38 LEU 38 385 385 LEU LEU B . n B 1 39 GLY 39 386 386 GLY GLY B . n B 1 40 LEU 40 387 387 LEU LEU B . n B 1 41 HIS 41 388 388 HIS HIS B . n B 1 42 ASP 42 389 389 ASP ASP B . n B 1 43 TYR 43 390 390 TYR TYR B . n B 1 44 CYS 44 391 391 CYS CYS B . n B 1 45 ASP 45 392 392 ASP ASP B . n B 1 46 ILE 46 393 393 ILE ILE B . n B 1 47 ILE 47 394 394 ILE ILE B . n B 1 48 LYS 48 395 395 LYS LYS B . n B 1 49 HIS 49 396 396 HIS HIS B . n B 1 50 PRO 50 397 397 PRO PRO B . n B 1 51 MET 51 398 398 MET MET B . n B 1 52 ASP 52 399 399 ASP ASP B . n B 1 53 MET 53 400 400 MET MET B . n B 1 54 SER 54 401 401 SER SER B . n B 1 55 THR 55 402 402 THR THR B . n B 1 56 ILE 56 403 403 ILE ILE B . n B 1 57 LYS 57 404 404 LYS LYS B . n B 1 58 SER 58 405 405 SER SER B . n B 1 59 LYS 59 406 406 LYS LYS B . n B 1 60 LEU 60 407 407 LEU LEU B . n B 1 61 GLU 61 408 408 GLU GLU B . n B 1 62 ALA 62 409 409 ALA ALA B . n B 1 63 ARG 63 410 410 ARG ARG B . n B 1 64 GLU 64 411 411 GLU GLU B . n B 1 65 TYR 65 412 412 TYR TYR B . n B 1 66 ARG 66 413 413 ARG ARG B . n B 1 67 ASP 67 414 414 ASP ASP B . n B 1 68 ALA 68 415 415 ALA ALA B . n B 1 69 GLN 69 416 416 GLN GLN B . n B 1 70 GLU 70 417 417 GLU GLU B . n B 1 71 PHE 71 418 418 PHE PHE B . n B 1 72 GLY 72 419 419 GLY GLY B . n B 1 73 ALA 73 420 420 ALA ALA B . n B 1 74 ASP 74 421 421 ASP ASP B . n B 1 75 VAL 75 422 422 VAL VAL B . n B 1 76 ARG 76 423 423 ARG ARG B . n B 1 77 LEU 77 424 424 LEU LEU B . n B 1 78 MET 78 425 425 MET MET B . n B 1 79 PHE 79 426 426 PHE PHE B . n B 1 80 SER 80 427 427 SER SER B . n B 1 81 ASN 81 428 428 ASN ASN B . n B 1 82 CYS 82 429 429 CYS CYS B . n B 1 83 TYR 83 430 430 TYR TYR B . n B 1 84 LYS 84 431 431 LYS LYS B . n B 1 85 TYR 85 432 432 TYR TYR B . n B 1 86 ASN 86 433 433 ASN ASN B . n B 1 87 PRO 87 434 434 PRO PRO B . n B 1 88 PRO 88 435 435 PRO PRO B . n B 1 89 ASP 89 436 436 ASP ASP B . n B 1 90 HIS 90 437 437 HIS HIS B . n B 1 91 GLU 91 438 438 GLU GLU B . n B 1 92 VAL 92 439 439 VAL VAL B . n B 1 93 VAL 93 440 440 VAL VAL B . n B 1 94 ALA 94 441 441 ALA ALA B . n B 1 95 MET 95 442 442 MET MET B . n B 1 96 ALA 96 443 443 ALA ALA B . n B 1 97 ARG 97 444 444 ARG ARG B . n B 1 98 LYS 98 445 445 LYS LYS B . n B 1 99 LEU 99 446 446 LEU LEU B . n B 1 100 GLN 100 447 447 GLN GLN B . n B 1 101 ASP 101 448 448 ASP ASP B . n B 1 102 VAL 102 449 449 VAL VAL B . n B 1 103 PHE 103 450 450 PHE PHE B . n B 1 104 GLU 104 451 451 GLU GLU B . n B 1 105 MET 105 452 452 MET MET B . n B 1 106 ARG 106 453 453 ARG ARG B . n B 1 107 PHE 107 454 454 PHE PHE B . n B 1 108 ALA 108 455 455 ALA ALA B . n B 1 109 LYS 109 456 456 LYS LYS B . n B 1 110 MET 110 457 457 MET MET B . n B 1 111 PRO 111 458 458 PRO PRO B . n B 1 112 ASP 112 459 ? ? ? B . n B 1 113 GLU 113 460 ? ? ? B . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1E3W _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1E3W _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 A1E3W 1 501 1 A1E3W DRG A . D 3 GOL 1 502 501 GOL GOL A . E 2 A1E3W 1 501 2 A1E3W DRG B . F 4 HOH 1 601 1 HOH HOH A . F 4 HOH 2 602 15 HOH HOH A . F 4 HOH 3 603 30 HOH HOH A . F 4 HOH 4 604 4 HOH HOH A . F 4 HOH 5 605 8 HOH HOH A . F 4 HOH 6 606 7 HOH HOH A . F 4 HOH 7 607 5 HOH HOH A . F 4 HOH 8 608 10 HOH HOH A . F 4 HOH 9 609 46 HOH HOH A . F 4 HOH 10 610 19 HOH HOH A . F 4 HOH 11 611 25 HOH HOH A . F 4 HOH 12 612 48 HOH HOH A . F 4 HOH 13 613 17 HOH HOH A . F 4 HOH 14 614 26 HOH HOH A . F 4 HOH 15 615 18 HOH HOH A . F 4 HOH 16 616 34 HOH HOH A . F 4 HOH 17 617 24 HOH HOH A . F 4 HOH 18 618 33 HOH HOH A . G 4 HOH 1 601 16 HOH HOH B . G 4 HOH 2 602 35 HOH HOH B . G 4 HOH 3 603 12 HOH HOH B . G 4 HOH 4 604 13 HOH HOH B . G 4 HOH 5 605 20 HOH HOH B . G 4 HOH 6 606 51 HOH HOH B . G 4 HOH 7 607 40 HOH HOH B . G 4 HOH 8 608 31 HOH HOH B . G 4 HOH 9 609 28 HOH HOH B . G 4 HOH 10 610 45 HOH HOH B . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1_2575 ? 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1_2575 ? 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . ? 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . ? 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . ? 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 21OJ _cell.details ? _cell.formula_units_Z ? _cell.length_a 110.970 _cell.length_a_esd ? _cell.length_b 110.970 _cell.length_b_esd ? _cell.length_c 72.090 _cell.length_c_esd ? _cell.volume 887740.835 _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 21OJ _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall 'P 4abw 2nw' _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 21OJ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.21 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 70.75 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '10% (v/v) PEG1000, 10% (v/v) PEG8000' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 S 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2025-11-27 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97861 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 5.0.3' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97861 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 5.0.3 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 43.188898981 _reflns.entry_id 21OJ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.6 _reflns.d_resolution_low 39.2338197541 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14345 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.88 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 25.1 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.19 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.1896 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.6 _reflns_shell.d_res_low 2.693 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1411 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 26.2 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.928 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 99.93 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 51.563926398 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 21OJ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.60014166736 _refine.ls_d_res_low 39.2338197541 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14343 _refine.ls_number_reflns_R_free 1435 _refine.ls_number_reflns_R_work 12908 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9303281544 _refine.ls_percent_reflns_R_free 10.0048804295 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.19895705702 _refine.ls_R_factor_R_free 0.235940309525 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.194961003458 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34627277063 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.9753460602 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.253981164127 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.60014166736 _refine_hist.d_res_low 39.2338197541 _refine_hist.number_atoms_solvent 28 _refine_hist.number_atoms_total 1932 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1814 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 90 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.00502909831608 ? 1957 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.859274554307 ? 2640 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0459713295825 ? 257 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.00572006478306 ? 328 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 11.3715564632 ? 1195 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.60014166736 2.6931 . . 141 1269 99.9291282778 . . . . 0.229541821705 . . . . . . . . . . . . . . . 0.310971182325 'X-RAY DIFFRACTION' 2.6931 2.8008 . . 139 1251 99.9281092739 . . . . 0.216096817821 . . . . . . . . . . . . . . . 0.272711201838 'X-RAY DIFFRACTION' 2.8008 2.9283 . . 141 1273 100.0 . . . . 0.224909294274 . . . . . . . . . . . . . . . 0.272941755616 'X-RAY DIFFRACTION' 2.9283 3.0826 . . 142 1276 100.0 . . . . 0.220694491306 . . . . . . . . . . . . . . . 0.254767789665 'X-RAY DIFFRACTION' 3.0826 3.2757 . . 141 1260 100.0 . . . . 0.224023665565 . . . . . . . . . . . . . . . 0.278996727106 'X-RAY DIFFRACTION' 3.2757 3.5284 . . 141 1270 100.0 . . . . 0.20977127506 . . . . . . . . . . . . . . . 0.262264179941 'X-RAY DIFFRACTION' 3.5284 3.8832 . . 144 1297 100.0 . . . . 0.189115782924 . . . . . . . . . . . . . . . 0.234887857538 'X-RAY DIFFRACTION' 3.8832 4.4445 . . 144 1301 100.0 . . . . 0.173961754073 . . . . . . . . . . . . . . . 0.220387466077 'X-RAY DIFFRACTION' 4.4445 5.597 . . 147 1316 100.0 . . . . 0.184696602763 . . . . . . . . . . . . . . . 0.209624825361 'X-RAY DIFFRACTION' 5.597 39.2338197541 . . 155 1395 99.486521181 . . . . 0.17554443148 . . . . . . . . . . . . . . . 0.199382699148 # loop_ _struct_ncs_dom.id _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.details 1 1 ? 2 1 ? # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A SER 1 . A PRO 111 . A SER 348 A PRO 458 ? ;(chain 'A' and resid 348 through 458) ; 1 2 2 B SER 1 . B PRO 111 . B SER 348 B PRO 458 ? ;chain 'B' ; # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 21OJ _struct.title 'Crystal Structure of the second bromodomain of human BRD4 BD2 in complex with the covalent inhibitor' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 21OJ _struct_keywords.text 'Chromatin reader protein, covalent inhibitor, complex, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? E N N 2 ? F N N 4 ? G N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BRD4_HUMAN _struct_ref.pdbx_db_accession O60885 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SKVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFS NCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDE ; _struct_ref.pdbx_align_begin 348 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 21OJ A 1 ? 113 ? O60885 348 ? 460 ? 348 460 2 1 21OJ B 1 ? 113 ? O60885 348 ? 460 ? 348 460 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 author_defined_assembly ? monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,C,D,F 2 1 B,E,G # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 1 ? PHE A 18 ? SER A 348 PHE A 365 1 ? 18 HELX_P HELX_P2 AA2 ALA A 19 ? LYS A 21 ? ALA A 366 LYS A 368 5 ? 3 HELX_P HELX_P3 AA3 HIS A 22 ? TRP A 27 ? HIS A 369 TRP A 374 1 ? 6 HELX_P HELX_P4 AA4 PRO A 28 ? TYR A 30 ? PRO A 375 TYR A 377 5 ? 3 HELX_P HELX_P5 AA5 ASP A 34 ? GLY A 39 ? ASP A 381 GLY A 386 1 ? 6 HELX_P HELX_P6 AA6 ASP A 42 ? ILE A 47 ? ASP A 389 ILE A 394 1 ? 6 HELX_P HELX_P7 AA7 ASP A 52 ? ALA A 62 ? ASP A 399 ALA A 409 1 ? 11 HELX_P HELX_P8 AA8 ASP A 67 ? ASN A 86 ? ASP A 414 ASN A 433 1 ? 20 HELX_P HELX_P9 AA9 HIS A 90 ? LYS A 109 ? HIS A 437 LYS A 456 1 ? 20 HELX_P HELX_P10 AB1 LYS B 2 ? PHE B 18 ? LYS B 349 PHE B 365 1 ? 17 HELX_P HELX_P11 AB2 ALA B 19 ? LYS B 21 ? ALA B 366 LYS B 368 5 ? 3 HELX_P HELX_P12 AB3 HIS B 22 ? TRP B 27 ? HIS B 369 TRP B 374 1 ? 6 HELX_P HELX_P13 AB4 PRO B 28 ? TYR B 30 ? PRO B 375 TYR B 377 5 ? 3 HELX_P HELX_P14 AB5 ASP B 42 ? ILE B 47 ? ASP B 389 ILE B 394 1 ? 6 HELX_P HELX_P15 AB6 ASP B 52 ? ALA B 62 ? ASP B 399 ALA B 409 1 ? 11 HELX_P HELX_P16 AB7 ASP B 67 ? ASN B 86 ? ASP B 414 ASN B 433 1 ? 20 HELX_P HELX_P17 AB8 HIS B 90 ? LYS B 109 ? HIS B 437 LYS B 456 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A GLU 91 OE2 ? ? ? 1_555 C A1E3W . CBM ? ? A GLU 438 A A1E3W 501 1_555 ? ? ? ? ? ? ? 1.516 ? ? covale2 covale none ? B GLU 91 OE2 ? ? ? 1_555 E A1E3W . CBM ? ? B GLU 438 B A1E3W 501 1_555 ? ? ? ? ? ? ? 1.517 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 A1E3W C . ? GLU A 91 ? A1E3W A 501 ? 1_555 GLU A 438 ? 1_555 CBM OE2 GLU 1 A1E3W None 'Covalent chemical modification' 2 A1E3W E . ? GLU B 91 ? A1E3W B 501 ? 1_555 GLU B 438 ? 1_555 CBM OE2 GLU 1 A1E3W None 'Covalent chemical modification' # _pdbx_entry_details.entry_id 21OJ _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 456 ? ? -94.96 34.93 2 1 LYS B 456 ? ? -99.04 30.70 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x+1/2,z+1/4 3 y+1/2,-x+1/2,z+3/4 4 x+1/2,-y+1/2,-z+3/4 5 -x+1/2,y+1/2,-z+1/4 6 -x,-y,z+1/2 7 y,x,-z 8 -y,-x,-z+1/2 # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 2.95974263458 _pdbx_refine_tls.origin_y -26.4423907139 _pdbx_refine_tls.origin_z -3.36748824313 _pdbx_refine_tls.T[1][1] 0.334712038635 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0183811943989 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0421378551072 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.331534891215 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.028053205442 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.345440715078 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 2.97174766538 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.608871662019 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -1.49872357822 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 0.726031323627 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.109345140315 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 1.71808175998 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.0694865605047 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.0641836464886 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.173336828253 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.00832452552361 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.00529746589232 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.0239248373638 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.06657162056 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.157900517858 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.0430944923929 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 460 ? A GLU 113 2 1 Y 1 B ASP 459 ? B ASP 112 3 1 Y 1 B GLU 460 ? B GLU 113 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1E3W CAA C N N 1 A1E3W CAC C N N 2 A1E3W CAD C N N 3 A1E3W CAE C Y N 4 A1E3W CAF C Y N 5 A1E3W CAG C Y N 6 A1E3W CAH C Y N 7 A1E3W CAK C N N 8 A1E3W CAL C N N 9 A1E3W CAO C N N 10 A1E3W CAP C N N 11 A1E3W CAQ C N N 12 A1E3W CAR C Y N 13 A1E3W CAS C Y N 14 A1E3W CAT C Y N 15 A1E3W CAU C Y N 16 A1E3W CAV C Y N 17 A1E3W CAW C Y N 18 A1E3W CAX C N N 19 A1E3W CAY C N N 20 A1E3W CAZ C N N 21 A1E3W CBC C Y N 22 A1E3W CBD C Y N 23 A1E3W CBE C Y N 24 A1E3W CBF C Y N 25 A1E3W CBG C Y N 26 A1E3W CBH C Y N 27 A1E3W CBI C N N 28 A1E3W CBJ C N N 29 A1E3W CBL C N N 30 A1E3W CBM C N S 31 A1E3W CBN C N N 32 A1E3W CBO C N N 33 A1E3W NAB N N N 34 A1E3W NAI N Y N 35 A1E3W NAN N N N 36 A1E3W OAJ O N N 37 A1E3W OAM O N N 38 A1E3W OBA O N N 39 A1E3W OBB O N N 40 A1E3W OBK O N N 41 A1E3W OBP O N N 42 A1E3W H1 H N N 43 A1E3W H2 H N N 44 A1E3W H3 H N N 45 A1E3W H4 H N N 46 A1E3W H5 H N N 47 A1E3W H6 H N N 48 A1E3W H7 H N N 49 A1E3W H9 H N N 50 A1E3W H11 H N N 51 A1E3W H12 H N N 52 A1E3W H13 H N N 53 A1E3W H14 H N N 54 A1E3W H15 H N N 55 A1E3W H16 H N N 56 A1E3W H17 H N N 57 A1E3W H18 H N N 58 A1E3W H19 H N N 59 A1E3W H20 H N N 60 A1E3W H21 H N N 61 A1E3W H22 H N N 62 A1E3W H23 H N N 63 A1E3W H24 H N N 64 A1E3W H25 H N N 65 A1E3W H26 H N N 66 A1E3W H27 H N N 67 A1E3W H28 H N N 68 A1E3W H29 H N N 69 A1E3W H30 H N N 70 A1E3W H31 H N N 71 A1E3W H32 H N N 72 A1E3W H33 H N N 73 A1E3W H34 H N N 74 A1E3W H35 H N N 75 A1E3W H36 H N N 76 A1E3W H37 H N N 77 A1E3W H38 H N N 78 A1E3W H39 H N N 79 ALA N N N N 80 ALA CA C N S 81 ALA C C N N 82 ALA O O N N 83 ALA CB C N N 84 ALA OXT O N N 85 ALA H H N N 86 ALA H2 H N N 87 ALA HA H N N 88 ALA HB1 H N N 89 ALA HB2 H N N 90 ALA HB3 H N N 91 ALA HXT H N N 92 ARG N N N N 93 ARG CA C N S 94 ARG C C N N 95 ARG O O N N 96 ARG CB C N N 97 ARG CG C N N 98 ARG CD C N N 99 ARG NE N N N 100 ARG CZ C N N 101 ARG NH1 N N N 102 ARG NH2 N N N 103 ARG OXT O N N 104 ARG H H N N 105 ARG H2 H N N 106 ARG HA H N N 107 ARG HB2 H N N 108 ARG HB3 H N N 109 ARG HG2 H N N 110 ARG HG3 H N N 111 ARG HD2 H N N 112 ARG HD3 H N N 113 ARG HE H N N 114 ARG HH11 H N N 115 ARG HH12 H N N 116 ARG HH21 H N N 117 ARG HH22 H N N 118 ARG HXT H N N 119 ASN N N N N 120 ASN CA C N S 121 ASN C C N N 122 ASN O O N N 123 ASN CB C N N 124 ASN CG C N N 125 ASN OD1 O N N 126 ASN ND2 N N N 127 ASN OXT O N N 128 ASN H H N N 129 ASN H2 H N N 130 ASN HA H N N 131 ASN HB2 H N N 132 ASN HB3 H N N 133 ASN HD21 H N N 134 ASN HD22 H N N 135 ASN HXT H N N 136 ASP N N N N 137 ASP CA C N S 138 ASP C C N N 139 ASP O O N N 140 ASP CB C N N 141 ASP CG C N N 142 ASP OD1 O N N 143 ASP OD2 O N N 144 ASP OXT O N N 145 ASP H H N N 146 ASP H2 H N N 147 ASP HA H N N 148 ASP HB2 H N N 149 ASP HB3 H N N 150 ASP HD2 H N N 151 ASP HXT H N N 152 CYS N N N N 153 CYS CA C N R 154 CYS C C N N 155 CYS O O N N 156 CYS CB C N N 157 CYS SG S N N 158 CYS OXT O N N 159 CYS H H N N 160 CYS H2 H N N 161 CYS HA H N N 162 CYS HB2 H N N 163 CYS HB3 H N N 164 CYS HG H N N 165 CYS HXT H N N 166 GLN N N N N 167 GLN CA C N S 168 GLN C C N N 169 GLN O O N N 170 GLN CB C N N 171 GLN CG C N N 172 GLN CD C N N 173 GLN OE1 O N N 174 GLN NE2 N N N 175 GLN OXT O N N 176 GLN H H N N 177 GLN H2 H N N 178 GLN HA H N N 179 GLN HB2 H N N 180 GLN HB3 H N N 181 GLN HG2 H N N 182 GLN HG3 H N N 183 GLN HE21 H N N 184 GLN HE22 H N N 185 GLN HXT H N N 186 GLU N N N N 187 GLU CA C N S 188 GLU C C N N 189 GLU O O N N 190 GLU CB C N N 191 GLU CG C N N 192 GLU CD C N N 193 GLU OE1 O N N 194 GLU OE2 O N N 195 GLU OXT O N N 196 GLU H H N N 197 GLU H2 H N N 198 GLU HA H N N 199 GLU HB2 H N N 200 GLU HB3 H N N 201 GLU HG2 H N N 202 GLU HG3 H N N 203 GLU HE2 H N N 204 GLU HXT H N N 205 GLY N N N N 206 GLY CA C N N 207 GLY C C N N 208 GLY O O N N 209 GLY OXT O N N 210 GLY H H N N 211 GLY H2 H N N 212 GLY HA2 H N N 213 GLY HA3 H N N 214 GLY HXT H N N 215 GOL C1 C N N 216 GOL O1 O N N 217 GOL C2 C N N 218 GOL O2 O N N 219 GOL C3 C N N 220 GOL O3 O N N 221 GOL H11 H N N 222 GOL H12 H N N 223 GOL HO1 H N N 224 GOL H2 H N N 225 GOL HO2 H N N 226 GOL H31 H N N 227 GOL H32 H N N 228 GOL HO3 H N N 229 HIS N N N N 230 HIS CA C N S 231 HIS C C N N 232 HIS O O N N 233 HIS CB C N N 234 HIS CG C Y N 235 HIS ND1 N Y N 236 HIS CD2 C Y N 237 HIS CE1 C Y N 238 HIS NE2 N Y N 239 HIS OXT O N N 240 HIS H H N N 241 HIS H2 H N N 242 HIS HA H N N 243 HIS HB2 H N N 244 HIS HB3 H N N 245 HIS HD1 H N N 246 HIS HD2 H N N 247 HIS HE1 H N N 248 HIS HE2 H N N 249 HIS HXT H N N 250 HOH O O N N 251 HOH H1 H N N 252 HOH H2 H N N 253 ILE N N N N 254 ILE CA C N S 255 ILE C C N N 256 ILE O O N N 257 ILE CB C N S 258 ILE CG1 C N N 259 ILE CG2 C N N 260 ILE CD1 C N N 261 ILE OXT O N N 262 ILE H H N N 263 ILE H2 H N N 264 ILE HA H N N 265 ILE HB H N N 266 ILE HG12 H N N 267 ILE HG13 H N N 268 ILE HG21 H N N 269 ILE HG22 H N N 270 ILE HG23 H N N 271 ILE HD11 H N N 272 ILE HD12 H N N 273 ILE HD13 H N N 274 ILE HXT H N N 275 LEU N N N N 276 LEU CA C N S 277 LEU C C N N 278 LEU O O N N 279 LEU CB C N N 280 LEU CG C N N 281 LEU CD1 C N N 282 LEU CD2 C N N 283 LEU OXT O N N 284 LEU H H N N 285 LEU H2 H N N 286 LEU HA H N N 287 LEU HB2 H N N 288 LEU HB3 H N N 289 LEU HG H N N 290 LEU HD11 H N N 291 LEU HD12 H N N 292 LEU HD13 H N N 293 LEU HD21 H N N 294 LEU HD22 H N N 295 LEU HD23 H N N 296 LEU HXT H N N 297 LYS N N N N 298 LYS CA C N S 299 LYS C C N N 300 LYS O O N N 301 LYS CB C N N 302 LYS CG C N N 303 LYS CD C N N 304 LYS CE C N N 305 LYS NZ N N N 306 LYS OXT O N N 307 LYS H H N N 308 LYS H2 H N N 309 LYS HA H N N 310 LYS HB2 H N N 311 LYS HB3 H N N 312 LYS HG2 H N N 313 LYS HG3 H N N 314 LYS HD2 H N N 315 LYS HD3 H N N 316 LYS HE2 H N N 317 LYS HE3 H N N 318 LYS HZ1 H N N 319 LYS HZ2 H N N 320 LYS HZ3 H N N 321 LYS HXT H N N 322 MET N N N N 323 MET CA C N S 324 MET C C N N 325 MET O O N N 326 MET CB C N N 327 MET CG C N N 328 MET SD S N N 329 MET CE C N N 330 MET OXT O N N 331 MET H H N N 332 MET H2 H N N 333 MET HA H N N 334 MET HB2 H N N 335 MET HB3 H N N 336 MET HG2 H N N 337 MET HG3 H N N 338 MET HE1 H N N 339 MET HE2 H N N 340 MET HE3 H N N 341 MET HXT H N N 342 PHE N N N N 343 PHE CA C N S 344 PHE C C N N 345 PHE O O N N 346 PHE CB C N N 347 PHE CG C Y N 348 PHE CD1 C Y N 349 PHE CD2 C Y N 350 PHE CE1 C Y N 351 PHE CE2 C Y N 352 PHE CZ C Y N 353 PHE OXT O N N 354 PHE H H N N 355 PHE H2 H N N 356 PHE HA H N N 357 PHE HB2 H N N 358 PHE HB3 H N N 359 PHE HD1 H N N 360 PHE HD2 H N N 361 PHE HE1 H N N 362 PHE HE2 H N N 363 PHE HZ H N N 364 PHE HXT H N N 365 PRO N N N N 366 PRO CA C N S 367 PRO C C N N 368 PRO O O N N 369 PRO CB C N N 370 PRO CG C N N 371 PRO CD C N N 372 PRO OXT O N N 373 PRO H H N N 374 PRO HA H N N 375 PRO HB2 H N N 376 PRO HB3 H N N 377 PRO HG2 H N N 378 PRO HG3 H N N 379 PRO HD2 H N N 380 PRO HD3 H N N 381 PRO HXT H N N 382 SER N N N N 383 SER CA C N S 384 SER C C N N 385 SER O O N N 386 SER CB C N N 387 SER OG O N N 388 SER OXT O N N 389 SER H H N N 390 SER H2 H N N 391 SER HA H N N 392 SER HB2 H N N 393 SER HB3 H N N 394 SER HG H N N 395 SER HXT H N N 396 THR N N N N 397 THR CA C N S 398 THR C C N N 399 THR O O N N 400 THR CB C N R 401 THR OG1 O N N 402 THR CG2 C N N 403 THR OXT O N N 404 THR H H N N 405 THR H2 H N N 406 THR HA H N N 407 THR HB H N N 408 THR HG1 H N N 409 THR HG21 H N N 410 THR HG22 H N N 411 THR HG23 H N N 412 THR HXT H N N 413 TRP N N N N 414 TRP CA C N S 415 TRP C C N N 416 TRP O O N N 417 TRP CB C N N 418 TRP CG C Y N 419 TRP CD1 C Y N 420 TRP CD2 C Y N 421 TRP NE1 N Y N 422 TRP CE2 C Y N 423 TRP CE3 C Y N 424 TRP CZ2 C Y N 425 TRP CZ3 C Y N 426 TRP CH2 C Y N 427 TRP OXT O N N 428 TRP H H N N 429 TRP H2 H N N 430 TRP HA H N N 431 TRP HB2 H N N 432 TRP HB3 H N N 433 TRP HD1 H N N 434 TRP HE1 H N N 435 TRP HE3 H N N 436 TRP HZ2 H N N 437 TRP HZ3 H N N 438 TRP HH2 H N N 439 TRP HXT H N N 440 TYR N N N N 441 TYR CA C N S 442 TYR C C N N 443 TYR O O N N 444 TYR CB C N N 445 TYR CG C Y N 446 TYR CD1 C Y N 447 TYR CD2 C Y N 448 TYR CE1 C Y N 449 TYR CE2 C Y N 450 TYR CZ C Y N 451 TYR OH O N N 452 TYR OXT O N N 453 TYR H H N N 454 TYR H2 H N N 455 TYR HA H N N 456 TYR HB2 H N N 457 TYR HB3 H N N 458 TYR HD1 H N N 459 TYR HD2 H N N 460 TYR HE1 H N N 461 TYR HE2 H N N 462 TYR HH H N N 463 TYR HXT H N N 464 VAL N N N N 465 VAL CA C N S 466 VAL C C N N 467 VAL O O N N 468 VAL CB C N N 469 VAL CG1 C N N 470 VAL CG2 C N N 471 VAL OXT O N N 472 VAL H H N N 473 VAL H2 H N N 474 VAL HA H N N 475 VAL HB H N N 476 VAL HG11 H N N 477 VAL HG12 H N N 478 VAL HG13 H N N 479 VAL HG21 H N N 480 VAL HG22 H N N 481 VAL HG23 H N N 482 VAL HXT H N N 483 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1E3W CAK NAB sing N N 1 A1E3W CBJ CBD sing N N 2 A1E3W CAZ CAX sing N N 3 A1E3W NAB CAC sing N N 4 A1E3W NAB CAA sing N N 5 A1E3W CAC CAD doub N N 6 A1E3W OBP CBO sing N N 7 A1E3W CBD CBE doub Y N 8 A1E3W CBD CBC sing Y N 9 A1E3W CBE CBF sing Y N 10 A1E3W OBA CAX sing N N 11 A1E3W CAX CAT sing N N 12 A1E3W CAX CAY sing N N 13 A1E3W OAJ CAA doub N N 14 A1E3W CAS CAT doub Y N 15 A1E3W CAS CAR sing Y N 16 A1E3W CAT CAU sing Y N 17 A1E3W CAA CAF sing N N 18 A1E3W CAD CAR sing N N 19 A1E3W CAD CAE sing N N 20 A1E3W CAR CAW doub Y N 21 A1E3W CAU CAV doub Y N 22 A1E3W CAW CAV sing Y N 23 A1E3W CAW OBB sing N N 24 A1E3W OBB CBC sing N N 25 A1E3W CBO CBM sing N N 26 A1E3W CBC CBH doub Y N 27 A1E3W CBF OBK sing N N 28 A1E3W CBF CBG doub Y N 29 A1E3W OBK CBL sing N N 30 A1E3W CAF CAE doub Y N 31 A1E3W CAF NAI sing Y N 32 A1E3W CBM CBL sing N N 33 A1E3W CBM CBN sing N N 34 A1E3W CAE CAG sing Y N 35 A1E3W CBH CBG sing Y N 36 A1E3W CBH CBI sing N N 37 A1E3W NAI CAH sing Y N 38 A1E3W CAG CAH doub Y N 39 A1E3W CAH CAL sing N N 40 A1E3W CAL NAN sing N N 41 A1E3W CAL OAM doub N N 42 A1E3W NAN CAO sing N N 43 A1E3W CAO CAP sing N N 44 A1E3W CAP CAQ trip N N 45 A1E3W CAC H1 sing N N 46 A1E3W CAG H2 sing N N 47 A1E3W CAK H3 sing N N 48 A1E3W CAK H4 sing N N 49 A1E3W CAK H5 sing N N 50 A1E3W CAO H6 sing N N 51 A1E3W CAO H7 sing N N 52 A1E3W CAQ H9 sing N N 53 A1E3W CAS H11 sing N N 54 A1E3W CAU H12 sing N N 55 A1E3W CAV H13 sing N N 56 A1E3W CAY H14 sing N N 57 A1E3W CAY H15 sing N N 58 A1E3W CAY H16 sing N N 59 A1E3W CAZ H17 sing N N 60 A1E3W CAZ H18 sing N N 61 A1E3W CAZ H19 sing N N 62 A1E3W CBE H20 sing N N 63 A1E3W CBG H21 sing N N 64 A1E3W CBI H22 sing N N 65 A1E3W CBI H23 sing N N 66 A1E3W CBI H24 sing N N 67 A1E3W CBJ H25 sing N N 68 A1E3W CBJ H26 sing N N 69 A1E3W CBJ H27 sing N N 70 A1E3W CBL H28 sing N N 71 A1E3W CBL H29 sing N N 72 A1E3W CBM H30 sing N N 73 A1E3W CBN H31 sing N N 74 A1E3W CBN H32 sing N N 75 A1E3W CBN H33 sing N N 76 A1E3W CBO H34 sing N N 77 A1E3W CBO H35 sing N N 78 A1E3W NAI H36 sing N N 79 A1E3W NAN H37 sing N N 80 A1E3W OBA H38 sing N N 81 A1E3W OBP H39 sing N N 82 ALA N CA sing N N 83 ALA N H sing N N 84 ALA N H2 sing N N 85 ALA CA C sing N N 86 ALA CA CB sing N N 87 ALA CA HA sing N N 88 ALA C O doub N N 89 ALA C OXT sing N N 90 ALA CB HB1 sing N N 91 ALA CB HB2 sing N N 92 ALA CB HB3 sing N N 93 ALA OXT HXT sing N N 94 ARG N CA sing N N 95 ARG N H sing N N 96 ARG N H2 sing N N 97 ARG CA C sing N N 98 ARG CA CB sing N N 99 ARG CA HA sing N N 100 ARG C O doub N N 101 ARG C OXT sing N N 102 ARG CB CG sing N N 103 ARG CB HB2 sing N N 104 ARG CB HB3 sing N N 105 ARG CG CD sing N N 106 ARG CG HG2 sing N N 107 ARG CG HG3 sing N N 108 ARG CD NE sing N N 109 ARG CD HD2 sing N N 110 ARG CD HD3 sing N N 111 ARG NE CZ sing N N 112 ARG NE HE sing N N 113 ARG CZ NH1 sing N N 114 ARG CZ NH2 doub N N 115 ARG NH1 HH11 sing N N 116 ARG NH1 HH12 sing N N 117 ARG NH2 HH21 sing N N 118 ARG NH2 HH22 sing N N 119 ARG OXT HXT sing N N 120 ASN N CA sing N N 121 ASN N H sing N N 122 ASN N H2 sing N N 123 ASN CA C sing N N 124 ASN CA CB sing N N 125 ASN CA HA sing N N 126 ASN C O doub N N 127 ASN C OXT sing N N 128 ASN CB CG sing N N 129 ASN CB HB2 sing N N 130 ASN CB HB3 sing N N 131 ASN CG OD1 doub N N 132 ASN CG ND2 sing N N 133 ASN ND2 HD21 sing N N 134 ASN ND2 HD22 sing N N 135 ASN OXT HXT sing N N 136 ASP N CA sing N N 137 ASP N H sing N N 138 ASP N H2 sing N N 139 ASP CA C sing N N 140 ASP CA CB sing N N 141 ASP CA HA sing N N 142 ASP C O doub N N 143 ASP C OXT sing N N 144 ASP CB CG sing N N 145 ASP CB HB2 sing N N 146 ASP CB HB3 sing N N 147 ASP CG OD1 doub N N 148 ASP CG OD2 sing N N 149 ASP OD2 HD2 sing N N 150 ASP OXT HXT sing N N 151 CYS N CA sing N N 152 CYS N H sing N N 153 CYS N H2 sing N N 154 CYS CA C sing N N 155 CYS CA CB sing N N 156 CYS CA HA sing N N 157 CYS C O doub N N 158 CYS C OXT sing N N 159 CYS CB SG sing N N 160 CYS CB HB2 sing N N 161 CYS CB HB3 sing N N 162 CYS SG HG sing N N 163 CYS OXT HXT sing N N 164 GLN N CA sing N N 165 GLN N H sing N N 166 GLN N H2 sing N N 167 GLN CA C sing N N 168 GLN CA CB sing N N 169 GLN CA HA sing N N 170 GLN C O doub N N 171 GLN C OXT sing N N 172 GLN CB CG sing N N 173 GLN CB HB2 sing N N 174 GLN CB HB3 sing N N 175 GLN CG CD sing N N 176 GLN CG HG2 sing N N 177 GLN CG HG3 sing N N 178 GLN CD OE1 doub N N 179 GLN CD NE2 sing N N 180 GLN NE2 HE21 sing N N 181 GLN NE2 HE22 sing N N 182 GLN OXT HXT sing N N 183 GLU N CA sing N N 184 GLU N H sing N N 185 GLU N H2 sing N N 186 GLU CA C sing N N 187 GLU CA CB sing N N 188 GLU CA HA sing N N 189 GLU C O doub N N 190 GLU C OXT sing N N 191 GLU CB CG sing N N 192 GLU CB HB2 sing N N 193 GLU CB HB3 sing N N 194 GLU CG CD sing N N 195 GLU CG HG2 sing N N 196 GLU CG HG3 sing N N 197 GLU CD OE1 doub N N 198 GLU CD OE2 sing N N 199 GLU OE2 HE2 sing N N 200 GLU OXT HXT sing N N 201 GLY N CA sing N N 202 GLY N H sing N N 203 GLY N H2 sing N N 204 GLY CA C sing N N 205 GLY CA HA2 sing N N 206 GLY CA HA3 sing N N 207 GLY C O doub N N 208 GLY C OXT sing N N 209 GLY OXT HXT sing N N 210 GOL C1 O1 sing N N 211 GOL C1 C2 sing N N 212 GOL C1 H11 sing N N 213 GOL C1 H12 sing N N 214 GOL O1 HO1 sing N N 215 GOL C2 O2 sing N N 216 GOL C2 C3 sing N N 217 GOL C2 H2 sing N N 218 GOL O2 HO2 sing N N 219 GOL C3 O3 sing N N 220 GOL C3 H31 sing N N 221 GOL C3 H32 sing N N 222 GOL O3 HO3 sing N N 223 HIS N CA sing N N 224 HIS N H sing N N 225 HIS N H2 sing N N 226 HIS CA C sing N N 227 HIS CA CB sing N N 228 HIS CA HA sing N N 229 HIS C O doub N N 230 HIS C OXT sing N N 231 HIS CB CG sing N N 232 HIS CB HB2 sing N N 233 HIS CB HB3 sing N N 234 HIS CG ND1 sing Y N 235 HIS CG CD2 doub Y N 236 HIS ND1 CE1 doub Y N 237 HIS ND1 HD1 sing N N 238 HIS CD2 NE2 sing Y N 239 HIS CD2 HD2 sing N N 240 HIS CE1 NE2 sing Y N 241 HIS CE1 HE1 sing N N 242 HIS NE2 HE2 sing N N 243 HIS OXT HXT sing N N 244 HOH O H1 sing N N 245 HOH O H2 sing N N 246 ILE N CA sing N N 247 ILE N H sing N N 248 ILE N H2 sing N N 249 ILE CA C sing N N 250 ILE CA CB sing N N 251 ILE CA HA sing N N 252 ILE C O doub N N 253 ILE C OXT sing N N 254 ILE CB CG1 sing N N 255 ILE CB CG2 sing N N 256 ILE CB HB sing N N 257 ILE CG1 CD1 sing N N 258 ILE CG1 HG12 sing N N 259 ILE CG1 HG13 sing N N 260 ILE CG2 HG21 sing N N 261 ILE CG2 HG22 sing N N 262 ILE CG2 HG23 sing N N 263 ILE CD1 HD11 sing N N 264 ILE CD1 HD12 sing N N 265 ILE CD1 HD13 sing N N 266 ILE OXT HXT sing N N 267 LEU N CA sing N N 268 LEU N H sing N N 269 LEU N H2 sing N N 270 LEU CA C sing N N 271 LEU CA CB sing N N 272 LEU CA HA sing N N 273 LEU C O doub N N 274 LEU C OXT sing N N 275 LEU CB CG sing N N 276 LEU CB HB2 sing N N 277 LEU CB HB3 sing N N 278 LEU CG CD1 sing N N 279 LEU CG CD2 sing N N 280 LEU CG HG sing N N 281 LEU CD1 HD11 sing N N 282 LEU CD1 HD12 sing N N 283 LEU CD1 HD13 sing N N 284 LEU CD2 HD21 sing N N 285 LEU CD2 HD22 sing N N 286 LEU CD2 HD23 sing N N 287 LEU OXT HXT sing N N 288 LYS N CA sing N N 289 LYS N H sing N N 290 LYS N H2 sing N N 291 LYS CA C sing N N 292 LYS CA CB sing N N 293 LYS CA HA sing N N 294 LYS C O doub N N 295 LYS C OXT sing N N 296 LYS CB CG sing N N 297 LYS CB HB2 sing N N 298 LYS CB HB3 sing N N 299 LYS CG CD sing N N 300 LYS CG HG2 sing N N 301 LYS CG HG3 sing N N 302 LYS CD CE sing N N 303 LYS CD HD2 sing N N 304 LYS CD HD3 sing N N 305 LYS CE NZ sing N N 306 LYS CE HE2 sing N N 307 LYS CE HE3 sing N N 308 LYS NZ HZ1 sing N N 309 LYS NZ HZ2 sing N N 310 LYS NZ HZ3 sing N N 311 LYS OXT HXT sing N N 312 MET N CA sing N N 313 MET N H sing N N 314 MET N H2 sing N N 315 MET CA C sing N N 316 MET CA CB sing N N 317 MET CA HA sing N N 318 MET C O doub N N 319 MET C OXT sing N N 320 MET CB CG sing N N 321 MET CB HB2 sing N N 322 MET CB HB3 sing N N 323 MET CG SD sing N N 324 MET CG HG2 sing N N 325 MET CG HG3 sing N N 326 MET SD CE sing N N 327 MET CE HE1 sing N N 328 MET CE HE2 sing N N 329 MET CE HE3 sing N N 330 MET OXT HXT sing N N 331 PHE N CA sing N N 332 PHE N H sing N N 333 PHE N H2 sing N N 334 PHE CA C sing N N 335 PHE CA CB sing N N 336 PHE CA HA sing N N 337 PHE C O doub N N 338 PHE C OXT sing N N 339 PHE CB CG sing N N 340 PHE CB HB2 sing N N 341 PHE CB HB3 sing N N 342 PHE CG CD1 doub Y N 343 PHE CG CD2 sing Y N 344 PHE CD1 CE1 sing Y N 345 PHE CD1 HD1 sing N N 346 PHE CD2 CE2 doub Y N 347 PHE CD2 HD2 sing N N 348 PHE CE1 CZ doub Y N 349 PHE CE1 HE1 sing N N 350 PHE CE2 CZ sing Y N 351 PHE CE2 HE2 sing N N 352 PHE CZ HZ sing N N 353 PHE OXT HXT sing N N 354 PRO N CA sing N N 355 PRO N CD sing N N 356 PRO N H sing N N 357 PRO CA C sing N N 358 PRO CA CB sing N N 359 PRO CA HA sing N N 360 PRO C O doub N N 361 PRO C OXT sing N N 362 PRO CB CG sing N N 363 PRO CB HB2 sing N N 364 PRO CB HB3 sing N N 365 PRO CG CD sing N N 366 PRO CG HG2 sing N N 367 PRO CG HG3 sing N N 368 PRO CD HD2 sing N N 369 PRO CD HD3 sing N N 370 PRO OXT HXT sing N N 371 SER N CA sing N N 372 SER N H sing N N 373 SER N H2 sing N N 374 SER CA C sing N N 375 SER CA CB sing N N 376 SER CA HA sing N N 377 SER C O doub N N 378 SER C OXT sing N N 379 SER CB OG sing N N 380 SER CB HB2 sing N N 381 SER CB HB3 sing N N 382 SER OG HG sing N N 383 SER OXT HXT sing N N 384 THR N CA sing N N 385 THR N H sing N N 386 THR N H2 sing N N 387 THR CA C sing N N 388 THR CA CB sing N N 389 THR CA HA sing N N 390 THR C O doub N N 391 THR C OXT sing N N 392 THR CB OG1 sing N N 393 THR CB CG2 sing N N 394 THR CB HB sing N N 395 THR OG1 HG1 sing N N 396 THR CG2 HG21 sing N N 397 THR CG2 HG22 sing N N 398 THR CG2 HG23 sing N N 399 THR OXT HXT sing N N 400 TRP N CA sing N N 401 TRP N H sing N N 402 TRP N H2 sing N N 403 TRP CA C sing N N 404 TRP CA CB sing N N 405 TRP CA HA sing N N 406 TRP C O doub N N 407 TRP C OXT sing N N 408 TRP CB CG sing N N 409 TRP CB HB2 sing N N 410 TRP CB HB3 sing N N 411 TRP CG CD1 doub Y N 412 TRP CG CD2 sing Y N 413 TRP CD1 NE1 sing Y N 414 TRP CD1 HD1 sing N N 415 TRP CD2 CE2 doub Y N 416 TRP CD2 CE3 sing Y N 417 TRP NE1 CE2 sing Y N 418 TRP NE1 HE1 sing N N 419 TRP CE2 CZ2 sing Y N 420 TRP CE3 CZ3 doub Y N 421 TRP CE3 HE3 sing N N 422 TRP CZ2 CH2 doub Y N 423 TRP CZ2 HZ2 sing N N 424 TRP CZ3 CH2 sing Y N 425 TRP CZ3 HZ3 sing N N 426 TRP CH2 HH2 sing N N 427 TRP OXT HXT sing N N 428 TYR N CA sing N N 429 TYR N H sing N N 430 TYR N H2 sing N N 431 TYR CA C sing N N 432 TYR CA CB sing N N 433 TYR CA HA sing N N 434 TYR C O doub N N 435 TYR C OXT sing N N 436 TYR CB CG sing N N 437 TYR CB HB2 sing N N 438 TYR CB HB3 sing N N 439 TYR CG CD1 doub Y N 440 TYR CG CD2 sing Y N 441 TYR CD1 CE1 sing Y N 442 TYR CD1 HD1 sing N N 443 TYR CD2 CE2 doub Y N 444 TYR CD2 HD2 sing N N 445 TYR CE1 CZ doub Y N 446 TYR CE1 HE1 sing N N 447 TYR CE2 CZ sing Y N 448 TYR CE2 HE2 sing N N 449 TYR CZ OH sing N N 450 TYR OH HH sing N N 451 TYR OXT HXT sing N N 452 VAL N CA sing N N 453 VAL N H sing N N 454 VAL N H2 sing N N 455 VAL CA C sing N N 456 VAL CA CB sing N N 457 VAL CA HA sing N N 458 VAL C O doub N N 459 VAL C OXT sing N N 460 VAL CB CG1 sing N N 461 VAL CB CG2 sing N N 462 VAL CB HB sing N N 463 VAL CG1 HG11 sing N N 464 VAL CG1 HG12 sing N N 465 VAL CG1 HG13 sing N N 466 VAL CG2 HG21 sing N N 467 VAL CG2 HG22 sing N N 468 VAL CG2 HG23 sing N N 469 VAL OXT HXT sing N N 470 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7KO0 _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 41 21 2' _space_group.name_Hall 'P 4abw 2nw' _space_group.IT_number 92 _space_group.crystal_system tetragonal _space_group.id 1 # _atom_sites.entry_id 21OJ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.009011 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009011 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013872 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 25.62398 1.50364 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 19.97189 1.75589 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 15.80542 1.70748 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 1.23737 29.19336 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #