data_22GW # _entry.id 22GW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.410 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 22GW pdb_000022gw 10.2210/pdb22gw/pdb WWPDB D_1300068488 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-04-01 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 22GW _pdbx_database_status.recvd_initial_deposition_date 2026-01-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email sungil@kangwon.ac.kr _pdbx_contact_author.name_first Sung-il _pdbx_contact_author.name_last Yoon _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-0777-0457 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Park, M.A.' 1 ? 'Yoon, S.I.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structure of the CJ1041C protein from Campylobacter jejuni and its interaction with Ca2+ ions' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # _citation_author.citation_id primary _citation_author.name 'Yoon, S.I.' _citation_author.ordinal 1 _citation_author.identifier_ORCID ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man CJ1041C 30606.361 4 ? ? ? WP_227944480.1 2 water nat water 18.015 246 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSAKDPSELKYQEFDGFKSPESIFVDKNYVYVSNVGEKLEPLAKDNDGFISKLDKNGKVLEYKFLTHLNAPKGMMEIGKT LYVVDIDVLRGFDLKTKKEIFNLPIKGAIFLNDIEKLDDNTLLVSDTGTGLILKVDLKTKQYDELLKLDLAKFGGPNGLY LDRKKHKLFITGYHPDGVSGGVVMAYDLNTKELSIIKNEKESYDGIVPYKDGLLVSSWGNNLNGYIYNLDNVKSVKLELP LMKGPADIFIEGNILWIPKMVEGKIFKVELNK ; _entity_poly.pdbx_seq_one_letter_code_can ;GSAKDPSELKYQEFDGFKSPESIFVDKNYVYVSNVGEKLEPLAKDNDGFISKLDKNGKVLEYKFLTHLNAPKGMMEIGKT LYVVDIDVLRGFDLKTKKEIFNLPIKGAIFLNDIEKLDDNTLLVSDTGTGLILKVDLKTKQYDELLKLDLAKFGGPNGLY LDRKKHKLFITGYHPDGVSGGVVMAYDLNTKELSIIKNEKESYDGIVPYKDGLLVSSWGNNLNGYIYNLDNVKSVKLELP LMKGPADIFIEGNILWIPKMVEGKIFKVELNK ; _entity_poly.pdbx_strand_id A,B,C,D _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ALA n 1 4 LYS n 1 5 ASP n 1 6 PRO n 1 7 SER n 1 8 GLU n 1 9 LEU n 1 10 LYS n 1 11 TYR n 1 12 GLN n 1 13 GLU n 1 14 PHE n 1 15 ASP n 1 16 GLY n 1 17 PHE n 1 18 LYS n 1 19 SER n 1 20 PRO n 1 21 GLU n 1 22 SER n 1 23 ILE n 1 24 PHE n 1 25 VAL n 1 26 ASP n 1 27 LYS n 1 28 ASN n 1 29 TYR n 1 30 VAL n 1 31 TYR n 1 32 VAL n 1 33 SER n 1 34 ASN n 1 35 VAL n 1 36 GLY n 1 37 GLU n 1 38 LYS n 1 39 LEU n 1 40 GLU n 1 41 PRO n 1 42 LEU n 1 43 ALA n 1 44 LYS n 1 45 ASP n 1 46 ASN n 1 47 ASP n 1 48 GLY n 1 49 PHE n 1 50 ILE n 1 51 SER n 1 52 LYS n 1 53 LEU n 1 54 ASP n 1 55 LYS n 1 56 ASN n 1 57 GLY n 1 58 LYS n 1 59 VAL n 1 60 LEU n 1 61 GLU n 1 62 TYR n 1 63 LYS n 1 64 PHE n 1 65 LEU n 1 66 THR n 1 67 HIS n 1 68 LEU n 1 69 ASN n 1 70 ALA n 1 71 PRO n 1 72 LYS n 1 73 GLY n 1 74 MET n 1 75 MET n 1 76 GLU n 1 77 ILE n 1 78 GLY n 1 79 LYS n 1 80 THR n 1 81 LEU n 1 82 TYR n 1 83 VAL n 1 84 VAL n 1 85 ASP n 1 86 ILE n 1 87 ASP n 1 88 VAL n 1 89 LEU n 1 90 ARG n 1 91 GLY n 1 92 PHE n 1 93 ASP n 1 94 LEU n 1 95 LYS n 1 96 THR n 1 97 LYS n 1 98 LYS n 1 99 GLU n 1 100 ILE n 1 101 PHE n 1 102 ASN n 1 103 LEU n 1 104 PRO n 1 105 ILE n 1 106 LYS n 1 107 GLY n 1 108 ALA n 1 109 ILE n 1 110 PHE n 1 111 LEU n 1 112 ASN n 1 113 ASP n 1 114 ILE n 1 115 GLU n 1 116 LYS n 1 117 LEU n 1 118 ASP n 1 119 ASP n 1 120 ASN n 1 121 THR n 1 122 LEU n 1 123 LEU n 1 124 VAL n 1 125 SER n 1 126 ASP n 1 127 THR n 1 128 GLY n 1 129 THR n 1 130 GLY n 1 131 LEU n 1 132 ILE n 1 133 LEU n 1 134 LYS n 1 135 VAL n 1 136 ASP n 1 137 LEU n 1 138 LYS n 1 139 THR n 1 140 LYS n 1 141 GLN n 1 142 TYR n 1 143 ASP n 1 144 GLU n 1 145 LEU n 1 146 LEU n 1 147 LYS n 1 148 LEU n 1 149 ASP n 1 150 LEU n 1 151 ALA n 1 152 LYS n 1 153 PHE n 1 154 GLY n 1 155 GLY n 1 156 PRO n 1 157 ASN n 1 158 GLY n 1 159 LEU n 1 160 TYR n 1 161 LEU n 1 162 ASP n 1 163 ARG n 1 164 LYS n 1 165 LYS n 1 166 HIS n 1 167 LYS n 1 168 LEU n 1 169 PHE n 1 170 ILE n 1 171 THR n 1 172 GLY n 1 173 TYR n 1 174 HIS n 1 175 PRO n 1 176 ASP n 1 177 GLY n 1 178 VAL n 1 179 SER n 1 180 GLY n 1 181 GLY n 1 182 VAL n 1 183 VAL n 1 184 MET n 1 185 ALA n 1 186 TYR n 1 187 ASP n 1 188 LEU n 1 189 ASN n 1 190 THR n 1 191 LYS n 1 192 GLU n 1 193 LEU n 1 194 SER n 1 195 ILE n 1 196 ILE n 1 197 LYS n 1 198 ASN n 1 199 GLU n 1 200 LYS n 1 201 GLU n 1 202 SER n 1 203 TYR n 1 204 ASP n 1 205 GLY n 1 206 ILE n 1 207 VAL n 1 208 PRO n 1 209 TYR n 1 210 LYS n 1 211 ASP n 1 212 GLY n 1 213 LEU n 1 214 LEU n 1 215 VAL n 1 216 SER n 1 217 SER n 1 218 TRP n 1 219 GLY n 1 220 ASN n 1 221 ASN n 1 222 LEU n 1 223 ASN n 1 224 GLY n 1 225 TYR n 1 226 ILE n 1 227 TYR n 1 228 ASN n 1 229 LEU n 1 230 ASP n 1 231 ASN n 1 232 VAL n 1 233 LYS n 1 234 SER n 1 235 VAL n 1 236 LYS n 1 237 LEU n 1 238 GLU n 1 239 LEU n 1 240 PRO n 1 241 LEU n 1 242 MET n 1 243 LYS n 1 244 GLY n 1 245 PRO n 1 246 ALA n 1 247 ASP n 1 248 ILE n 1 249 PHE n 1 250 ILE n 1 251 GLU n 1 252 GLY n 1 253 ASN n 1 254 ILE n 1 255 LEU n 1 256 TRP n 1 257 ILE n 1 258 PRO n 1 259 LYS n 1 260 MET n 1 261 VAL n 1 262 GLU n 1 263 GLY n 1 264 LYS n 1 265 ILE n 1 266 PHE n 1 267 LYS n 1 268 VAL n 1 269 GLU n 1 270 LEU n 1 271 ASN n 1 272 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 272 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Campylobacter jejuni' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 197 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 12 ? ? ? A . n A 1 2 SER 2 13 ? ? ? A . n A 1 3 ALA 3 14 ? ? ? A . n A 1 4 LYS 4 15 ? ? ? A . n A 1 5 ASP 5 16 ? ? ? A . n A 1 6 PRO 6 17 ? ? ? A . n A 1 7 SER 7 18 ? ? ? A . n A 1 8 GLU 8 19 19 GLU GLU A . n A 1 9 LEU 9 20 20 LEU LEU A . n A 1 10 LYS 10 21 21 LYS LYS A . n A 1 11 TYR 11 22 22 TYR TYR A . n A 1 12 GLN 12 23 23 GLN GLN A . n A 1 13 GLU 13 24 24 GLU GLU A . n A 1 14 PHE 14 25 25 PHE PHE A . n A 1 15 ASP 15 26 26 ASP ASP A . n A 1 16 GLY 16 27 27 GLY GLY A . n A 1 17 PHE 17 28 28 PHE PHE A . n A 1 18 LYS 18 29 29 LYS LYS A . n A 1 19 SER 19 30 30 SER SER A . n A 1 20 PRO 20 31 31 PRO PRO A . n A 1 21 GLU 21 32 32 GLU GLU A . n A 1 22 SER 22 33 33 SER SER A . n A 1 23 ILE 23 34 34 ILE ILE A . n A 1 24 PHE 24 35 35 PHE PHE A . n A 1 25 VAL 25 36 36 VAL VAL A . n A 1 26 ASP 26 37 37 ASP ASP A . n A 1 27 LYS 27 38 38 LYS LYS A . n A 1 28 ASN 28 39 39 ASN ASN A . n A 1 29 TYR 29 40 40 TYR TYR A . n A 1 30 VAL 30 41 41 VAL VAL A . n A 1 31 TYR 31 42 42 TYR TYR A . n A 1 32 VAL 32 43 43 VAL VAL A . n A 1 33 SER 33 44 44 SER SER A . n A 1 34 ASN 34 45 45 ASN ASN A . n A 1 35 VAL 35 46 46 VAL VAL A . n A 1 36 GLY 36 47 47 GLY GLY A . n A 1 37 GLU 37 48 48 GLU GLU A . n A 1 38 LYS 38 49 49 LYS LYS A . n A 1 39 LEU 39 50 50 LEU LEU A . n A 1 40 GLU 40 51 51 GLU GLU A . n A 1 41 PRO 41 52 52 PRO PRO A . n A 1 42 LEU 42 53 53 LEU LEU A . n A 1 43 ALA 43 54 54 ALA ALA A . n A 1 44 LYS 44 55 55 LYS LYS A . n A 1 45 ASP 45 56 56 ASP ASP A . n A 1 46 ASN 46 57 57 ASN ASN A . n A 1 47 ASP 47 58 58 ASP ASP A . n A 1 48 GLY 48 59 59 GLY GLY A . n A 1 49 PHE 49 60 60 PHE PHE A . n A 1 50 ILE 50 61 61 ILE ILE A . n A 1 51 SER 51 62 62 SER SER A . n A 1 52 LYS 52 63 63 LYS LYS A . n A 1 53 LEU 53 64 64 LEU LEU A . n A 1 54 ASP 54 65 65 ASP ASP A . n A 1 55 LYS 55 66 66 LYS LYS A . n A 1 56 ASN 56 67 67 ASN ASN A . n A 1 57 GLY 57 68 68 GLY GLY A . n A 1 58 LYS 58 69 69 LYS LYS A . n A 1 59 VAL 59 70 70 VAL VAL A . n A 1 60 LEU 60 71 71 LEU LEU A . n A 1 61 GLU 61 72 72 GLU GLU A . n A 1 62 TYR 62 73 73 TYR TYR A . n A 1 63 LYS 63 74 74 LYS LYS A . n A 1 64 PHE 64 75 75 PHE PHE A . n A 1 65 LEU 65 76 76 LEU LEU A . n A 1 66 THR 66 77 77 THR THR A . n A 1 67 HIS 67 78 78 HIS HIS A . n A 1 68 LEU 68 79 79 LEU LEU A . n A 1 69 ASN 69 80 80 ASN ASN A . n A 1 70 ALA 70 81 81 ALA ALA A . n A 1 71 PRO 71 82 82 PRO PRO A . n A 1 72 LYS 72 83 83 LYS LYS A . n A 1 73 GLY 73 84 84 GLY GLY A . n A 1 74 MET 74 85 85 MET MET A . n A 1 75 MET 75 86 86 MET MET A . n A 1 76 GLU 76 87 87 GLU GLU A . n A 1 77 ILE 77 88 88 ILE ILE A . n A 1 78 GLY 78 89 89 GLY GLY A . n A 1 79 LYS 79 90 90 LYS LYS A . n A 1 80 THR 80 91 91 THR THR A . n A 1 81 LEU 81 92 92 LEU LEU A . n A 1 82 TYR 82 93 93 TYR TYR A . n A 1 83 VAL 83 94 94 VAL VAL A . n A 1 84 VAL 84 95 95 VAL VAL A . n A 1 85 ASP 85 96 96 ASP ASP A . n A 1 86 ILE 86 97 97 ILE ILE A . n A 1 87 ASP 87 98 98 ASP ASP A . n A 1 88 VAL 88 99 99 VAL VAL A . n A 1 89 LEU 89 100 100 LEU LEU A . n A 1 90 ARG 90 101 101 ARG ARG A . n A 1 91 GLY 91 102 102 GLY GLY A . n A 1 92 PHE 92 103 103 PHE PHE A . n A 1 93 ASP 93 104 104 ASP ASP A . n A 1 94 LEU 94 105 105 LEU LEU A . n A 1 95 LYS 95 106 106 LYS LYS A . n A 1 96 THR 96 107 107 THR THR A . n A 1 97 LYS 97 108 108 LYS LYS A . n A 1 98 LYS 98 109 109 LYS LYS A . n A 1 99 GLU 99 110 110 GLU GLU A . n A 1 100 ILE 100 111 111 ILE ILE A . n A 1 101 PHE 101 112 112 PHE PHE A . n A 1 102 ASN 102 113 113 ASN ASN A . n A 1 103 LEU 103 114 114 LEU LEU A . n A 1 104 PRO 104 115 115 PRO PRO A . n A 1 105 ILE 105 116 116 ILE ILE A . n A 1 106 LYS 106 117 117 LYS LYS A . n A 1 107 GLY 107 118 118 GLY GLY A . n A 1 108 ALA 108 119 119 ALA ALA A . n A 1 109 ILE 109 120 120 ILE ILE A . n A 1 110 PHE 110 121 121 PHE PHE A . n A 1 111 LEU 111 122 122 LEU LEU A . n A 1 112 ASN 112 123 123 ASN ASN A . n A 1 113 ASP 113 124 124 ASP ASP A . n A 1 114 ILE 114 125 125 ILE ILE A . n A 1 115 GLU 115 126 126 GLU GLU A . n A 1 116 LYS 116 127 127 LYS LYS A . n A 1 117 LEU 117 128 128 LEU LEU A . n A 1 118 ASP 118 129 129 ASP ASP A . n A 1 119 ASP 119 130 130 ASP ASP A . n A 1 120 ASN 120 131 131 ASN ASN A . n A 1 121 THR 121 132 132 THR THR A . n A 1 122 LEU 122 133 133 LEU LEU A . n A 1 123 LEU 123 134 134 LEU LEU A . n A 1 124 VAL 124 135 135 VAL VAL A . n A 1 125 SER 125 136 136 SER SER A . n A 1 126 ASP 126 137 137 ASP ASP A . n A 1 127 THR 127 138 138 THR THR A . n A 1 128 GLY 128 139 139 GLY GLY A . n A 1 129 THR 129 140 140 THR THR A . n A 1 130 GLY 130 141 141 GLY GLY A . n A 1 131 LEU 131 142 142 LEU LEU A . n A 1 132 ILE 132 143 143 ILE ILE A . n A 1 133 LEU 133 144 144 LEU LEU A . n A 1 134 LYS 134 145 145 LYS LYS A . n A 1 135 VAL 135 146 146 VAL VAL A . n A 1 136 ASP 136 147 147 ASP ASP A . n A 1 137 LEU 137 148 148 LEU LEU A . n A 1 138 LYS 138 149 149 LYS LYS A . n A 1 139 THR 139 150 150 THR THR A . n A 1 140 LYS 140 151 151 LYS LYS A . n A 1 141 GLN 141 152 152 GLN GLN A . n A 1 142 TYR 142 153 153 TYR TYR A . n A 1 143 ASP 143 154 154 ASP ASP A . n A 1 144 GLU 144 155 155 GLU GLU A . n A 1 145 LEU 145 156 156 LEU LEU A . n A 1 146 LEU 146 157 157 LEU LEU A . n A 1 147 LYS 147 158 158 LYS LYS A . n A 1 148 LEU 148 159 159 LEU LEU A . n A 1 149 ASP 149 160 160 ASP ASP A . n A 1 150 LEU 150 161 161 LEU LEU A . n A 1 151 ALA 151 162 162 ALA ALA A . n A 1 152 LYS 152 163 163 LYS LYS A . n A 1 153 PHE 153 164 164 PHE PHE A . n A 1 154 GLY 154 165 165 GLY GLY A . n A 1 155 GLY 155 166 166 GLY GLY A . n A 1 156 PRO 156 167 167 PRO PRO A . n A 1 157 ASN 157 168 168 ASN ASN A . n A 1 158 GLY 158 169 169 GLY GLY A . n A 1 159 LEU 159 170 170 LEU LEU A . n A 1 160 TYR 160 171 171 TYR TYR A . n A 1 161 LEU 161 172 172 LEU LEU A . n A 1 162 ASP 162 173 173 ASP ASP A . n A 1 163 ARG 163 174 174 ARG ARG A . n A 1 164 LYS 164 175 175 LYS LYS A . n A 1 165 LYS 165 176 176 LYS LYS A . n A 1 166 HIS 166 177 177 HIS HIS A . n A 1 167 LYS 167 178 178 LYS LYS A . n A 1 168 LEU 168 179 179 LEU LEU A . n A 1 169 PHE 169 180 180 PHE PHE A . n A 1 170 ILE 170 181 181 ILE ILE A . n A 1 171 THR 171 182 182 THR THR A . n A 1 172 GLY 172 183 183 GLY GLY A . n A 1 173 TYR 173 184 184 TYR TYR A . n A 1 174 HIS 174 185 185 HIS HIS A . n A 1 175 PRO 175 186 186 PRO PRO A . n A 1 176 ASP 176 187 187 ASP ASP A . n A 1 177 GLY 177 188 188 GLY GLY A . n A 1 178 VAL 178 189 189 VAL VAL A . n A 1 179 SER 179 190 190 SER SER A . n A 1 180 GLY 180 191 191 GLY GLY A . n A 1 181 GLY 181 192 192 GLY GLY A . n A 1 182 VAL 182 193 193 VAL VAL A . n A 1 183 VAL 183 194 194 VAL VAL A . n A 1 184 MET 184 195 195 MET MET A . n A 1 185 ALA 185 196 196 ALA ALA A . n A 1 186 TYR 186 197 197 TYR TYR A . n A 1 187 ASP 187 198 198 ASP ASP A . n A 1 188 LEU 188 199 199 LEU LEU A . n A 1 189 ASN 189 200 200 ASN ASN A . n A 1 190 THR 190 201 201 THR THR A . n A 1 191 LYS 191 202 202 LYS LYS A . n A 1 192 GLU 192 203 203 GLU GLU A . n A 1 193 LEU 193 204 204 LEU LEU A . n A 1 194 SER 194 205 205 SER SER A . n A 1 195 ILE 195 206 206 ILE ILE A . n A 1 196 ILE 196 207 207 ILE ILE A . n A 1 197 LYS 197 208 208 LYS LYS A . n A 1 198 ASN 198 209 209 ASN ASN A . n A 1 199 GLU 199 210 210 GLU GLU A . n A 1 200 LYS 200 211 211 LYS LYS A . n A 1 201 GLU 201 212 212 GLU GLU A . n A 1 202 SER 202 213 213 SER SER A . n A 1 203 TYR 203 214 214 TYR TYR A . n A 1 204 ASP 204 215 215 ASP ASP A . n A 1 205 GLY 205 216 216 GLY GLY A . n A 1 206 ILE 206 217 217 ILE ILE A . n A 1 207 VAL 207 218 218 VAL VAL A . n A 1 208 PRO 208 219 219 PRO PRO A . n A 1 209 TYR 209 220 220 TYR TYR A . n A 1 210 LYS 210 221 221 LYS LYS A . n A 1 211 ASP 211 222 222 ASP ASP A . n A 1 212 GLY 212 223 223 GLY GLY A . n A 1 213 LEU 213 224 224 LEU LEU A . n A 1 214 LEU 214 225 225 LEU LEU A . n A 1 215 VAL 215 226 226 VAL VAL A . n A 1 216 SER 216 227 227 SER SER A . n A 1 217 SER 217 228 228 SER SER A . n A 1 218 TRP 218 229 229 TRP TRP A . n A 1 219 GLY 219 230 230 GLY GLY A . n A 1 220 ASN 220 231 231 ASN ASN A . n A 1 221 ASN 221 232 232 ASN ASN A . n A 1 222 LEU 222 233 233 LEU LEU A . n A 1 223 ASN 223 234 234 ASN ASN A . n A 1 224 GLY 224 235 235 GLY GLY A . n A 1 225 TYR 225 236 236 TYR TYR A . n A 1 226 ILE 226 237 237 ILE ILE A . n A 1 227 TYR 227 238 238 TYR TYR A . n A 1 228 ASN 228 239 239 ASN ASN A . n A 1 229 LEU 229 240 240 LEU LEU A . n A 1 230 ASP 230 241 241 ASP ASP A . n A 1 231 ASN 231 242 242 ASN ASN A . n A 1 232 VAL 232 243 243 VAL VAL A . n A 1 233 LYS 233 244 244 LYS LYS A . n A 1 234 SER 234 245 245 SER SER A . n A 1 235 VAL 235 246 246 VAL VAL A . n A 1 236 LYS 236 247 247 LYS LYS A . n A 1 237 LEU 237 248 248 LEU LEU A . n A 1 238 GLU 238 249 249 GLU GLU A . n A 1 239 LEU 239 250 250 LEU LEU A . n A 1 240 PRO 240 251 251 PRO PRO A . n A 1 241 LEU 241 252 252 LEU LEU A . n A 1 242 MET 242 253 253 MET MET A . n A 1 243 LYS 243 254 254 LYS LYS A . n A 1 244 GLY 244 255 255 GLY GLY A . n A 1 245 PRO 245 256 256 PRO PRO A . n A 1 246 ALA 246 257 257 ALA ALA A . n A 1 247 ASP 247 258 258 ASP ASP A . n A 1 248 ILE 248 259 259 ILE ILE A . n A 1 249 PHE 249 260 260 PHE PHE A . n A 1 250 ILE 250 261 261 ILE ILE A . n A 1 251 GLU 251 262 262 GLU GLU A . n A 1 252 GLY 252 263 263 GLY GLY A . n A 1 253 ASN 253 264 264 ASN ASN A . n A 1 254 ILE 254 265 265 ILE ILE A . n A 1 255 LEU 255 266 266 LEU LEU A . n A 1 256 TRP 256 267 267 TRP TRP A . n A 1 257 ILE 257 268 268 ILE ILE A . n A 1 258 PRO 258 269 269 PRO PRO A . n A 1 259 LYS 259 270 270 LYS LYS A . n A 1 260 MET 260 271 271 MET MET A . n A 1 261 VAL 261 272 272 VAL VAL A . n A 1 262 GLU 262 273 273 GLU GLU A . n A 1 263 GLY 263 274 274 GLY GLY A . n A 1 264 LYS 264 275 275 LYS LYS A . n A 1 265 ILE 265 276 276 ILE ILE A . n A 1 266 PHE 266 277 277 PHE PHE A . n A 1 267 LYS 267 278 278 LYS LYS A . n A 1 268 VAL 268 279 279 VAL VAL A . n A 1 269 GLU 269 280 280 GLU GLU A . n A 1 270 LEU 270 281 281 LEU LEU A . n A 1 271 ASN 271 282 282 ASN ASN A . n A 1 272 LYS 272 283 ? ? ? A . n B 1 1 GLY 1 12 ? ? ? B . n B 1 2 SER 2 13 ? ? ? B . n B 1 3 ALA 3 14 ? ? ? B . n B 1 4 LYS 4 15 ? ? ? B . n B 1 5 ASP 5 16 ? ? ? B . n B 1 6 PRO 6 17 ? ? ? B . n B 1 7 SER 7 18 ? ? ? B . n B 1 8 GLU 8 19 ? ? ? B . n B 1 9 LEU 9 20 20 LEU LEU B . n B 1 10 LYS 10 21 21 LYS LYS B . n B 1 11 TYR 11 22 22 TYR TYR B . n B 1 12 GLN 12 23 23 GLN GLN B . n B 1 13 GLU 13 24 24 GLU GLU B . n B 1 14 PHE 14 25 25 PHE PHE B . n B 1 15 ASP 15 26 26 ASP ASP B . n B 1 16 GLY 16 27 27 GLY GLY B . n B 1 17 PHE 17 28 28 PHE PHE B . n B 1 18 LYS 18 29 29 LYS LYS B . n B 1 19 SER 19 30 30 SER SER B . n B 1 20 PRO 20 31 31 PRO PRO B . n B 1 21 GLU 21 32 32 GLU GLU B . n B 1 22 SER 22 33 33 SER SER B . n B 1 23 ILE 23 34 34 ILE ILE B . n B 1 24 PHE 24 35 35 PHE PHE B . n B 1 25 VAL 25 36 36 VAL VAL B . n B 1 26 ASP 26 37 37 ASP ASP B . n B 1 27 LYS 27 38 38 LYS LYS B . n B 1 28 ASN 28 39 39 ASN ASN B . n B 1 29 TYR 29 40 40 TYR TYR B . n B 1 30 VAL 30 41 41 VAL VAL B . n B 1 31 TYR 31 42 42 TYR TYR B . n B 1 32 VAL 32 43 43 VAL VAL B . n B 1 33 SER 33 44 44 SER SER B . n B 1 34 ASN 34 45 45 ASN ASN B . n B 1 35 VAL 35 46 46 VAL VAL B . n B 1 36 GLY 36 47 47 GLY GLY B . n B 1 37 GLU 37 48 48 GLU GLU B . n B 1 38 LYS 38 49 49 LYS LYS B . n B 1 39 LEU 39 50 50 LEU LEU B . n B 1 40 GLU 40 51 51 GLU GLU B . n B 1 41 PRO 41 52 52 PRO PRO B . n B 1 42 LEU 42 53 53 LEU LEU B . n B 1 43 ALA 43 54 54 ALA ALA B . n B 1 44 LYS 44 55 55 LYS LYS B . n B 1 45 ASP 45 56 56 ASP ASP B . n B 1 46 ASN 46 57 57 ASN ASN B . n B 1 47 ASP 47 58 58 ASP ASP B . n B 1 48 GLY 48 59 59 GLY GLY B . n B 1 49 PHE 49 60 60 PHE PHE B . n B 1 50 ILE 50 61 61 ILE ILE B . n B 1 51 SER 51 62 62 SER SER B . n B 1 52 LYS 52 63 63 LYS LYS B . n B 1 53 LEU 53 64 64 LEU LEU B . n B 1 54 ASP 54 65 65 ASP ASP B . n B 1 55 LYS 55 66 66 LYS LYS B . n B 1 56 ASN 56 67 67 ASN ASN B . n B 1 57 GLY 57 68 68 GLY GLY B . n B 1 58 LYS 58 69 69 LYS LYS B . n B 1 59 VAL 59 70 70 VAL VAL B . n B 1 60 LEU 60 71 71 LEU LEU B . n B 1 61 GLU 61 72 72 GLU GLU B . n B 1 62 TYR 62 73 73 TYR TYR B . n B 1 63 LYS 63 74 74 LYS LYS B . n B 1 64 PHE 64 75 75 PHE PHE B . n B 1 65 LEU 65 76 76 LEU LEU B . n B 1 66 THR 66 77 77 THR THR B . n B 1 67 HIS 67 78 78 HIS HIS B . n B 1 68 LEU 68 79 79 LEU LEU B . n B 1 69 ASN 69 80 80 ASN ASN B . n B 1 70 ALA 70 81 81 ALA ALA B . n B 1 71 PRO 71 82 82 PRO PRO B . n B 1 72 LYS 72 83 83 LYS LYS B . n B 1 73 GLY 73 84 84 GLY GLY B . n B 1 74 MET 74 85 85 MET MET B . n B 1 75 MET 75 86 86 MET MET B . n B 1 76 GLU 76 87 87 GLU GLU B . n B 1 77 ILE 77 88 88 ILE ILE B . n B 1 78 GLY 78 89 89 GLY GLY B . n B 1 79 LYS 79 90 90 LYS LYS B . n B 1 80 THR 80 91 91 THR THR B . n B 1 81 LEU 81 92 92 LEU LEU B . n B 1 82 TYR 82 93 93 TYR TYR B . n B 1 83 VAL 83 94 94 VAL VAL B . n B 1 84 VAL 84 95 95 VAL VAL B . n B 1 85 ASP 85 96 96 ASP ASP B . n B 1 86 ILE 86 97 97 ILE ILE B . n B 1 87 ASP 87 98 98 ASP ASP B . n B 1 88 VAL 88 99 99 VAL VAL B . n B 1 89 LEU 89 100 100 LEU LEU B . n B 1 90 ARG 90 101 101 ARG ARG B . n B 1 91 GLY 91 102 102 GLY GLY B . n B 1 92 PHE 92 103 103 PHE PHE B . n B 1 93 ASP 93 104 104 ASP ASP B . n B 1 94 LEU 94 105 105 LEU LEU B . n B 1 95 LYS 95 106 106 LYS LYS B . n B 1 96 THR 96 107 107 THR THR B . n B 1 97 LYS 97 108 108 LYS LYS B . n B 1 98 LYS 98 109 109 LYS LYS B . n B 1 99 GLU 99 110 110 GLU GLU B . n B 1 100 ILE 100 111 111 ILE ILE B . n B 1 101 PHE 101 112 112 PHE PHE B . n B 1 102 ASN 102 113 113 ASN ASN B . n B 1 103 LEU 103 114 114 LEU LEU B . n B 1 104 PRO 104 115 115 PRO PRO B . n B 1 105 ILE 105 116 116 ILE ILE B . n B 1 106 LYS 106 117 117 LYS LYS B . n B 1 107 GLY 107 118 118 GLY GLY B . n B 1 108 ALA 108 119 119 ALA ALA B . n B 1 109 ILE 109 120 120 ILE ILE B . n B 1 110 PHE 110 121 121 PHE PHE B . n B 1 111 LEU 111 122 122 LEU LEU B . n B 1 112 ASN 112 123 123 ASN ASN B . n B 1 113 ASP 113 124 124 ASP ASP B . n B 1 114 ILE 114 125 125 ILE ILE B . n B 1 115 GLU 115 126 126 GLU GLU B . n B 1 116 LYS 116 127 127 LYS LYS B . n B 1 117 LEU 117 128 128 LEU LEU B . n B 1 118 ASP 118 129 129 ASP ASP B . n B 1 119 ASP 119 130 130 ASP ASP B . n B 1 120 ASN 120 131 131 ASN ASN B . n B 1 121 THR 121 132 132 THR THR B . n B 1 122 LEU 122 133 133 LEU LEU B . n B 1 123 LEU 123 134 134 LEU LEU B . n B 1 124 VAL 124 135 135 VAL VAL B . n B 1 125 SER 125 136 136 SER SER B . n B 1 126 ASP 126 137 137 ASP ASP B . n B 1 127 THR 127 138 138 THR THR B . n B 1 128 GLY 128 139 139 GLY GLY B . n B 1 129 THR 129 140 140 THR THR B . n B 1 130 GLY 130 141 141 GLY GLY B . n B 1 131 LEU 131 142 142 LEU LEU B . n B 1 132 ILE 132 143 143 ILE ILE B . n B 1 133 LEU 133 144 144 LEU LEU B . n B 1 134 LYS 134 145 145 LYS LYS B . n B 1 135 VAL 135 146 146 VAL VAL B . n B 1 136 ASP 136 147 147 ASP ASP B . n B 1 137 LEU 137 148 148 LEU LEU B . n B 1 138 LYS 138 149 149 LYS LYS B . n B 1 139 THR 139 150 150 THR THR B . n B 1 140 LYS 140 151 151 LYS LYS B . n B 1 141 GLN 141 152 152 GLN GLN B . n B 1 142 TYR 142 153 153 TYR TYR B . n B 1 143 ASP 143 154 154 ASP ASP B . n B 1 144 GLU 144 155 155 GLU GLU B . n B 1 145 LEU 145 156 156 LEU LEU B . n B 1 146 LEU 146 157 157 LEU LEU B . n B 1 147 LYS 147 158 158 LYS LYS B . n B 1 148 LEU 148 159 159 LEU LEU B . n B 1 149 ASP 149 160 160 ASP ASP B . n B 1 150 LEU 150 161 161 LEU LEU B . n B 1 151 ALA 151 162 162 ALA ALA B . n B 1 152 LYS 152 163 163 LYS LYS B . n B 1 153 PHE 153 164 164 PHE PHE B . n B 1 154 GLY 154 165 165 GLY GLY B . n B 1 155 GLY 155 166 166 GLY GLY B . n B 1 156 PRO 156 167 167 PRO PRO B . n B 1 157 ASN 157 168 168 ASN ASN B . n B 1 158 GLY 158 169 169 GLY GLY B . n B 1 159 LEU 159 170 170 LEU LEU B . n B 1 160 TYR 160 171 171 TYR TYR B . n B 1 161 LEU 161 172 172 LEU LEU B . n B 1 162 ASP 162 173 173 ASP ASP B . n B 1 163 ARG 163 174 174 ARG ARG B . n B 1 164 LYS 164 175 175 LYS LYS B . n B 1 165 LYS 165 176 176 LYS LYS B . n B 1 166 HIS 166 177 177 HIS HIS B . n B 1 167 LYS 167 178 178 LYS LYS B . n B 1 168 LEU 168 179 179 LEU LEU B . n B 1 169 PHE 169 180 180 PHE PHE B . n B 1 170 ILE 170 181 181 ILE ILE B . n B 1 171 THR 171 182 182 THR THR B . n B 1 172 GLY 172 183 183 GLY GLY B . n B 1 173 TYR 173 184 184 TYR TYR B . n B 1 174 HIS 174 185 185 HIS HIS B . n B 1 175 PRO 175 186 186 PRO PRO B . n B 1 176 ASP 176 187 187 ASP ASP B . n B 1 177 GLY 177 188 188 GLY GLY B . n B 1 178 VAL 178 189 189 VAL VAL B . n B 1 179 SER 179 190 190 SER SER B . n B 1 180 GLY 180 191 191 GLY GLY B . n B 1 181 GLY 181 192 192 GLY GLY B . n B 1 182 VAL 182 193 193 VAL VAL B . n B 1 183 VAL 183 194 194 VAL VAL B . n B 1 184 MET 184 195 195 MET MET B . n B 1 185 ALA 185 196 196 ALA ALA B . n B 1 186 TYR 186 197 197 TYR TYR B . n B 1 187 ASP 187 198 198 ASP ASP B . n B 1 188 LEU 188 199 199 LEU LEU B . n B 1 189 ASN 189 200 200 ASN ASN B . n B 1 190 THR 190 201 201 THR THR B . n B 1 191 LYS 191 202 202 LYS LYS B . n B 1 192 GLU 192 203 203 GLU GLU B . n B 1 193 LEU 193 204 204 LEU LEU B . n B 1 194 SER 194 205 205 SER SER B . n B 1 195 ILE 195 206 206 ILE ILE B . n B 1 196 ILE 196 207 207 ILE ILE B . n B 1 197 LYS 197 208 208 LYS LYS B . n B 1 198 ASN 198 209 209 ASN ASN B . n B 1 199 GLU 199 210 210 GLU GLU B . n B 1 200 LYS 200 211 211 LYS LYS B . n B 1 201 GLU 201 212 212 GLU GLU B . n B 1 202 SER 202 213 213 SER SER B . n B 1 203 TYR 203 214 214 TYR TYR B . n B 1 204 ASP 204 215 215 ASP ASP B . n B 1 205 GLY 205 216 216 GLY GLY B . n B 1 206 ILE 206 217 217 ILE ILE B . n B 1 207 VAL 207 218 218 VAL VAL B . n B 1 208 PRO 208 219 219 PRO PRO B . n B 1 209 TYR 209 220 220 TYR TYR B . n B 1 210 LYS 210 221 221 LYS LYS B . n B 1 211 ASP 211 222 222 ASP ASP B . n B 1 212 GLY 212 223 223 GLY GLY B . n B 1 213 LEU 213 224 224 LEU LEU B . n B 1 214 LEU 214 225 225 LEU LEU B . n B 1 215 VAL 215 226 226 VAL VAL B . n B 1 216 SER 216 227 227 SER SER B . n B 1 217 SER 217 228 228 SER SER B . n B 1 218 TRP 218 229 229 TRP TRP B . n B 1 219 GLY 219 230 230 GLY GLY B . n B 1 220 ASN 220 231 231 ASN ASN B . n B 1 221 ASN 221 232 232 ASN ASN B . n B 1 222 LEU 222 233 233 LEU LEU B . n B 1 223 ASN 223 234 234 ASN ASN B . n B 1 224 GLY 224 235 235 GLY GLY B . n B 1 225 TYR 225 236 236 TYR TYR B . n B 1 226 ILE 226 237 237 ILE ILE B . n B 1 227 TYR 227 238 238 TYR TYR B . n B 1 228 ASN 228 239 239 ASN ASN B . n B 1 229 LEU 229 240 240 LEU LEU B . n B 1 230 ASP 230 241 241 ASP ASP B . n B 1 231 ASN 231 242 242 ASN ASN B . n B 1 232 VAL 232 243 243 VAL VAL B . n B 1 233 LYS 233 244 244 LYS LYS B . n B 1 234 SER 234 245 245 SER SER B . n B 1 235 VAL 235 246 246 VAL VAL B . n B 1 236 LYS 236 247 247 LYS LYS B . n B 1 237 LEU 237 248 248 LEU LEU B . n B 1 238 GLU 238 249 249 GLU GLU B . n B 1 239 LEU 239 250 250 LEU LEU B . n B 1 240 PRO 240 251 251 PRO PRO B . n B 1 241 LEU 241 252 252 LEU LEU B . n B 1 242 MET 242 253 253 MET MET B . n B 1 243 LYS 243 254 254 LYS LYS B . n B 1 244 GLY 244 255 255 GLY GLY B . n B 1 245 PRO 245 256 256 PRO PRO B . n B 1 246 ALA 246 257 257 ALA ALA B . n B 1 247 ASP 247 258 258 ASP ASP B . n B 1 248 ILE 248 259 259 ILE ILE B . n B 1 249 PHE 249 260 260 PHE PHE B . n B 1 250 ILE 250 261 261 ILE ILE B . n B 1 251 GLU 251 262 262 GLU GLU B . n B 1 252 GLY 252 263 263 GLY GLY B . n B 1 253 ASN 253 264 264 ASN ASN B . n B 1 254 ILE 254 265 265 ILE ILE B . n B 1 255 LEU 255 266 266 LEU LEU B . n B 1 256 TRP 256 267 267 TRP TRP B . n B 1 257 ILE 257 268 268 ILE ILE B . n B 1 258 PRO 258 269 269 PRO PRO B . n B 1 259 LYS 259 270 270 LYS LYS B . n B 1 260 MET 260 271 271 MET MET B . n B 1 261 VAL 261 272 272 VAL VAL B . n B 1 262 GLU 262 273 273 GLU GLU B . n B 1 263 GLY 263 274 274 GLY GLY B . n B 1 264 LYS 264 275 275 LYS LYS B . n B 1 265 ILE 265 276 276 ILE ILE B . n B 1 266 PHE 266 277 277 PHE PHE B . n B 1 267 LYS 267 278 278 LYS LYS B . n B 1 268 VAL 268 279 279 VAL VAL B . n B 1 269 GLU 269 280 280 GLU GLU B . n B 1 270 LEU 270 281 281 LEU LEU B . n B 1 271 ASN 271 282 282 ASN ASN B . n B 1 272 LYS 272 283 ? ? ? B . n C 1 1 GLY 1 12 ? ? ? C . n C 1 2 SER 2 13 ? ? ? C . n C 1 3 ALA 3 14 ? ? ? C . n C 1 4 LYS 4 15 ? ? ? C . n C 1 5 ASP 5 16 ? ? ? C . n C 1 6 PRO 6 17 ? ? ? C . n C 1 7 SER 7 18 ? ? ? C . n C 1 8 GLU 8 19 19 GLU GLU C . n C 1 9 LEU 9 20 20 LEU LEU C . n C 1 10 LYS 10 21 21 LYS LYS C . n C 1 11 TYR 11 22 22 TYR TYR C . n C 1 12 GLN 12 23 23 GLN GLN C . n C 1 13 GLU 13 24 24 GLU GLU C . n C 1 14 PHE 14 25 25 PHE PHE C . n C 1 15 ASP 15 26 26 ASP ASP C . n C 1 16 GLY 16 27 27 GLY GLY C . n C 1 17 PHE 17 28 28 PHE PHE C . n C 1 18 LYS 18 29 29 LYS LYS C . n C 1 19 SER 19 30 30 SER SER C . n C 1 20 PRO 20 31 31 PRO PRO C . n C 1 21 GLU 21 32 32 GLU GLU C . n C 1 22 SER 22 33 33 SER SER C . n C 1 23 ILE 23 34 34 ILE ILE C . n C 1 24 PHE 24 35 35 PHE PHE C . n C 1 25 VAL 25 36 36 VAL VAL C . n C 1 26 ASP 26 37 37 ASP ASP C . n C 1 27 LYS 27 38 38 LYS LYS C . n C 1 28 ASN 28 39 39 ASN ASN C . n C 1 29 TYR 29 40 40 TYR TYR C . n C 1 30 VAL 30 41 41 VAL VAL C . n C 1 31 TYR 31 42 42 TYR TYR C . n C 1 32 VAL 32 43 43 VAL VAL C . n C 1 33 SER 33 44 44 SER SER C . n C 1 34 ASN 34 45 45 ASN ASN C . n C 1 35 VAL 35 46 46 VAL VAL C . n C 1 36 GLY 36 47 47 GLY GLY C . n C 1 37 GLU 37 48 48 GLU GLU C . n C 1 38 LYS 38 49 49 LYS LYS C . n C 1 39 LEU 39 50 50 LEU LEU C . n C 1 40 GLU 40 51 51 GLU GLU C . n C 1 41 PRO 41 52 52 PRO PRO C . n C 1 42 LEU 42 53 53 LEU LEU C . n C 1 43 ALA 43 54 54 ALA ALA C . n C 1 44 LYS 44 55 55 LYS LYS C . n C 1 45 ASP 45 56 56 ASP ASP C . n C 1 46 ASN 46 57 57 ASN ASN C . n C 1 47 ASP 47 58 58 ASP ASP C . n C 1 48 GLY 48 59 59 GLY GLY C . n C 1 49 PHE 49 60 60 PHE PHE C . n C 1 50 ILE 50 61 61 ILE ILE C . n C 1 51 SER 51 62 62 SER SER C . n C 1 52 LYS 52 63 63 LYS LYS C . n C 1 53 LEU 53 64 64 LEU LEU C . n C 1 54 ASP 54 65 65 ASP ASP C . n C 1 55 LYS 55 66 66 LYS LYS C . n C 1 56 ASN 56 67 67 ASN ASN C . n C 1 57 GLY 57 68 68 GLY GLY C . n C 1 58 LYS 58 69 69 LYS LYS C . n C 1 59 VAL 59 70 70 VAL VAL C . n C 1 60 LEU 60 71 71 LEU LEU C . n C 1 61 GLU 61 72 72 GLU GLU C . n C 1 62 TYR 62 73 73 TYR TYR C . n C 1 63 LYS 63 74 74 LYS LYS C . n C 1 64 PHE 64 75 75 PHE PHE C . n C 1 65 LEU 65 76 76 LEU LEU C . n C 1 66 THR 66 77 77 THR THR C . n C 1 67 HIS 67 78 78 HIS HIS C . n C 1 68 LEU 68 79 79 LEU LEU C . n C 1 69 ASN 69 80 80 ASN ASN C . n C 1 70 ALA 70 81 81 ALA ALA C . n C 1 71 PRO 71 82 82 PRO PRO C . n C 1 72 LYS 72 83 83 LYS LYS C . n C 1 73 GLY 73 84 84 GLY GLY C . n C 1 74 MET 74 85 85 MET MET C . n C 1 75 MET 75 86 86 MET MET C . n C 1 76 GLU 76 87 87 GLU GLU C . n C 1 77 ILE 77 88 88 ILE ILE C . n C 1 78 GLY 78 89 89 GLY GLY C . n C 1 79 LYS 79 90 90 LYS LYS C . n C 1 80 THR 80 91 91 THR THR C . n C 1 81 LEU 81 92 92 LEU LEU C . n C 1 82 TYR 82 93 93 TYR TYR C . n C 1 83 VAL 83 94 94 VAL VAL C . n C 1 84 VAL 84 95 95 VAL VAL C . n C 1 85 ASP 85 96 96 ASP ASP C . n C 1 86 ILE 86 97 97 ILE ILE C . n C 1 87 ASP 87 98 98 ASP ASP C . n C 1 88 VAL 88 99 99 VAL VAL C . n C 1 89 LEU 89 100 100 LEU LEU C . n C 1 90 ARG 90 101 101 ARG ARG C . n C 1 91 GLY 91 102 102 GLY GLY C . n C 1 92 PHE 92 103 103 PHE PHE C . n C 1 93 ASP 93 104 104 ASP ASP C . n C 1 94 LEU 94 105 105 LEU LEU C . n C 1 95 LYS 95 106 106 LYS LYS C . n C 1 96 THR 96 107 107 THR THR C . n C 1 97 LYS 97 108 108 LYS LYS C . n C 1 98 LYS 98 109 109 LYS LYS C . n C 1 99 GLU 99 110 110 GLU GLU C . n C 1 100 ILE 100 111 111 ILE ILE C . n C 1 101 PHE 101 112 112 PHE PHE C . n C 1 102 ASN 102 113 113 ASN ASN C . n C 1 103 LEU 103 114 114 LEU LEU C . n C 1 104 PRO 104 115 115 PRO PRO C . n C 1 105 ILE 105 116 116 ILE ILE C . n C 1 106 LYS 106 117 117 LYS LYS C . n C 1 107 GLY 107 118 118 GLY GLY C . n C 1 108 ALA 108 119 119 ALA ALA C . n C 1 109 ILE 109 120 120 ILE ILE C . n C 1 110 PHE 110 121 121 PHE PHE C . n C 1 111 LEU 111 122 122 LEU LEU C . n C 1 112 ASN 112 123 123 ASN ASN C . n C 1 113 ASP 113 124 124 ASP ASP C . n C 1 114 ILE 114 125 125 ILE ILE C . n C 1 115 GLU 115 126 126 GLU GLU C . n C 1 116 LYS 116 127 127 LYS LYS C . n C 1 117 LEU 117 128 128 LEU LEU C . n C 1 118 ASP 118 129 129 ASP ASP C . n C 1 119 ASP 119 130 130 ASP ASP C . n C 1 120 ASN 120 131 131 ASN ASN C . n C 1 121 THR 121 132 132 THR THR C . n C 1 122 LEU 122 133 133 LEU LEU C . n C 1 123 LEU 123 134 134 LEU LEU C . n C 1 124 VAL 124 135 135 VAL VAL C . n C 1 125 SER 125 136 136 SER SER C . n C 1 126 ASP 126 137 137 ASP ASP C . n C 1 127 THR 127 138 138 THR THR C . n C 1 128 GLY 128 139 139 GLY GLY C . n C 1 129 THR 129 140 140 THR THR C . n C 1 130 GLY 130 141 141 GLY GLY C . n C 1 131 LEU 131 142 142 LEU LEU C . n C 1 132 ILE 132 143 143 ILE ILE C . n C 1 133 LEU 133 144 144 LEU LEU C . n C 1 134 LYS 134 145 145 LYS LYS C . n C 1 135 VAL 135 146 146 VAL VAL C . n C 1 136 ASP 136 147 147 ASP ASP C . n C 1 137 LEU 137 148 148 LEU LEU C . n C 1 138 LYS 138 149 149 LYS LYS C . n C 1 139 THR 139 150 150 THR THR C . n C 1 140 LYS 140 151 151 LYS LYS C . n C 1 141 GLN 141 152 152 GLN GLN C . n C 1 142 TYR 142 153 153 TYR TYR C . n C 1 143 ASP 143 154 154 ASP ASP C . n C 1 144 GLU 144 155 155 GLU GLU C . n C 1 145 LEU 145 156 156 LEU LEU C . n C 1 146 LEU 146 157 157 LEU LEU C . n C 1 147 LYS 147 158 158 LYS LYS C . n C 1 148 LEU 148 159 159 LEU LEU C . n C 1 149 ASP 149 160 160 ASP ASP C . n C 1 150 LEU 150 161 161 LEU LEU C . n C 1 151 ALA 151 162 162 ALA ALA C . n C 1 152 LYS 152 163 163 LYS LYS C . n C 1 153 PHE 153 164 164 PHE PHE C . n C 1 154 GLY 154 165 165 GLY GLY C . n C 1 155 GLY 155 166 166 GLY GLY C . n C 1 156 PRO 156 167 167 PRO PRO C . n C 1 157 ASN 157 168 168 ASN ASN C . n C 1 158 GLY 158 169 169 GLY GLY C . n C 1 159 LEU 159 170 170 LEU LEU C . n C 1 160 TYR 160 171 171 TYR TYR C . n C 1 161 LEU 161 172 172 LEU LEU C . n C 1 162 ASP 162 173 173 ASP ASP C . n C 1 163 ARG 163 174 174 ARG ARG C . n C 1 164 LYS 164 175 175 LYS LYS C . n C 1 165 LYS 165 176 176 LYS LYS C . n C 1 166 HIS 166 177 177 HIS HIS C . n C 1 167 LYS 167 178 178 LYS LYS C . n C 1 168 LEU 168 179 179 LEU LEU C . n C 1 169 PHE 169 180 180 PHE PHE C . n C 1 170 ILE 170 181 181 ILE ILE C . n C 1 171 THR 171 182 182 THR THR C . n C 1 172 GLY 172 183 183 GLY GLY C . n C 1 173 TYR 173 184 184 TYR TYR C . n C 1 174 HIS 174 185 185 HIS HIS C . n C 1 175 PRO 175 186 186 PRO PRO C . n C 1 176 ASP 176 187 187 ASP ASP C . n C 1 177 GLY 177 188 188 GLY GLY C . n C 1 178 VAL 178 189 189 VAL VAL C . n C 1 179 SER 179 190 190 SER SER C . n C 1 180 GLY 180 191 191 GLY GLY C . n C 1 181 GLY 181 192 192 GLY GLY C . n C 1 182 VAL 182 193 193 VAL VAL C . n C 1 183 VAL 183 194 194 VAL VAL C . n C 1 184 MET 184 195 195 MET MET C . n C 1 185 ALA 185 196 196 ALA ALA C . n C 1 186 TYR 186 197 197 TYR TYR C . n C 1 187 ASP 187 198 198 ASP ASP C . n C 1 188 LEU 188 199 199 LEU LEU C . n C 1 189 ASN 189 200 200 ASN ASN C . n C 1 190 THR 190 201 201 THR THR C . n C 1 191 LYS 191 202 202 LYS LYS C . n C 1 192 GLU 192 203 203 GLU GLU C . n C 1 193 LEU 193 204 204 LEU LEU C . n C 1 194 SER 194 205 205 SER SER C . n C 1 195 ILE 195 206 206 ILE ILE C . n C 1 196 ILE 196 207 207 ILE ILE C . n C 1 197 LYS 197 208 208 LYS LYS C . n C 1 198 ASN 198 209 209 ASN ASN C . n C 1 199 GLU 199 210 210 GLU GLU C . n C 1 200 LYS 200 211 211 LYS LYS C . n C 1 201 GLU 201 212 212 GLU GLU C . n C 1 202 SER 202 213 213 SER SER C . n C 1 203 TYR 203 214 214 TYR TYR C . n C 1 204 ASP 204 215 215 ASP ASP C . n C 1 205 GLY 205 216 216 GLY GLY C . n C 1 206 ILE 206 217 217 ILE ILE C . n C 1 207 VAL 207 218 218 VAL VAL C . n C 1 208 PRO 208 219 219 PRO PRO C . n C 1 209 TYR 209 220 220 TYR TYR C . n C 1 210 LYS 210 221 221 LYS LYS C . n C 1 211 ASP 211 222 222 ASP ASP C . n C 1 212 GLY 212 223 223 GLY GLY C . n C 1 213 LEU 213 224 224 LEU LEU C . n C 1 214 LEU 214 225 225 LEU LEU C . n C 1 215 VAL 215 226 226 VAL VAL C . n C 1 216 SER 216 227 227 SER SER C . n C 1 217 SER 217 228 228 SER SER C . n C 1 218 TRP 218 229 229 TRP TRP C . n C 1 219 GLY 219 230 230 GLY GLY C . n C 1 220 ASN 220 231 231 ASN ASN C . n C 1 221 ASN 221 232 232 ASN ASN C . n C 1 222 LEU 222 233 233 LEU LEU C . n C 1 223 ASN 223 234 234 ASN ASN C . n C 1 224 GLY 224 235 235 GLY GLY C . n C 1 225 TYR 225 236 236 TYR TYR C . n C 1 226 ILE 226 237 237 ILE ILE C . n C 1 227 TYR 227 238 238 TYR TYR C . n C 1 228 ASN 228 239 239 ASN ASN C . n C 1 229 LEU 229 240 240 LEU LEU C . n C 1 230 ASP 230 241 241 ASP ASP C . n C 1 231 ASN 231 242 ? ? ? C . n C 1 232 VAL 232 243 ? ? ? C . n C 1 233 LYS 233 244 ? ? ? C . n C 1 234 SER 234 245 245 SER SER C . n C 1 235 VAL 235 246 246 VAL VAL C . n C 1 236 LYS 236 247 247 LYS LYS C . n C 1 237 LEU 237 248 248 LEU LEU C . n C 1 238 GLU 238 249 249 GLU GLU C . n C 1 239 LEU 239 250 250 LEU LEU C . n C 1 240 PRO 240 251 251 PRO PRO C . n C 1 241 LEU 241 252 252 LEU LEU C . n C 1 242 MET 242 253 253 MET MET C . n C 1 243 LYS 243 254 254 LYS LYS C . n C 1 244 GLY 244 255 255 GLY GLY C . n C 1 245 PRO 245 256 256 PRO PRO C . n C 1 246 ALA 246 257 257 ALA ALA C . n C 1 247 ASP 247 258 258 ASP ASP C . n C 1 248 ILE 248 259 259 ILE ILE C . n C 1 249 PHE 249 260 260 PHE PHE C . n C 1 250 ILE 250 261 261 ILE ILE C . n C 1 251 GLU 251 262 262 GLU GLU C . n C 1 252 GLY 252 263 263 GLY GLY C . n C 1 253 ASN 253 264 264 ASN ASN C . n C 1 254 ILE 254 265 265 ILE ILE C . n C 1 255 LEU 255 266 266 LEU LEU C . n C 1 256 TRP 256 267 267 TRP TRP C . n C 1 257 ILE 257 268 268 ILE ILE C . n C 1 258 PRO 258 269 269 PRO PRO C . n C 1 259 LYS 259 270 270 LYS LYS C . n C 1 260 MET 260 271 271 MET MET C . n C 1 261 VAL 261 272 272 VAL VAL C . n C 1 262 GLU 262 273 273 GLU GLU C . n C 1 263 GLY 263 274 274 GLY GLY C . n C 1 264 LYS 264 275 275 LYS LYS C . n C 1 265 ILE 265 276 276 ILE ILE C . n C 1 266 PHE 266 277 277 PHE PHE C . n C 1 267 LYS 267 278 278 LYS LYS C . n C 1 268 VAL 268 279 279 VAL VAL C . n C 1 269 GLU 269 280 280 GLU GLU C . n C 1 270 LEU 270 281 281 LEU LEU C . n C 1 271 ASN 271 282 282 ASN ASN C . n C 1 272 LYS 272 283 ? ? ? C . n D 1 1 GLY 1 12 ? ? ? D . n D 1 2 SER 2 13 ? ? ? D . n D 1 3 ALA 3 14 ? ? ? D . n D 1 4 LYS 4 15 ? ? ? D . n D 1 5 ASP 5 16 ? ? ? D . n D 1 6 PRO 6 17 ? ? ? D . n D 1 7 SER 7 18 18 SER SER D . n D 1 8 GLU 8 19 19 GLU GLU D . n D 1 9 LEU 9 20 20 LEU LEU D . n D 1 10 LYS 10 21 21 LYS LYS D . n D 1 11 TYR 11 22 22 TYR TYR D . n D 1 12 GLN 12 23 23 GLN GLN D . n D 1 13 GLU 13 24 24 GLU GLU D . n D 1 14 PHE 14 25 25 PHE PHE D . n D 1 15 ASP 15 26 26 ASP ASP D . n D 1 16 GLY 16 27 27 GLY GLY D . n D 1 17 PHE 17 28 28 PHE PHE D . n D 1 18 LYS 18 29 29 LYS LYS D . n D 1 19 SER 19 30 30 SER SER D . n D 1 20 PRO 20 31 31 PRO PRO D . n D 1 21 GLU 21 32 32 GLU GLU D . n D 1 22 SER 22 33 33 SER SER D . n D 1 23 ILE 23 34 34 ILE ILE D . n D 1 24 PHE 24 35 35 PHE PHE D . n D 1 25 VAL 25 36 36 VAL VAL D . n D 1 26 ASP 26 37 37 ASP ASP D . n D 1 27 LYS 27 38 38 LYS LYS D . n D 1 28 ASN 28 39 39 ASN ASN D . n D 1 29 TYR 29 40 40 TYR TYR D . n D 1 30 VAL 30 41 41 VAL VAL D . n D 1 31 TYR 31 42 42 TYR TYR D . n D 1 32 VAL 32 43 43 VAL VAL D . n D 1 33 SER 33 44 44 SER SER D . n D 1 34 ASN 34 45 45 ASN ASN D . n D 1 35 VAL 35 46 46 VAL VAL D . n D 1 36 GLY 36 47 47 GLY GLY D . n D 1 37 GLU 37 48 48 GLU GLU D . n D 1 38 LYS 38 49 49 LYS LYS D . n D 1 39 LEU 39 50 50 LEU LEU D . n D 1 40 GLU 40 51 51 GLU GLU D . n D 1 41 PRO 41 52 52 PRO PRO D . n D 1 42 LEU 42 53 53 LEU LEU D . n D 1 43 ALA 43 54 54 ALA ALA D . n D 1 44 LYS 44 55 55 LYS LYS D . n D 1 45 ASP 45 56 56 ASP ASP D . n D 1 46 ASN 46 57 57 ASN ASN D . n D 1 47 ASP 47 58 58 ASP ASP D . n D 1 48 GLY 48 59 59 GLY GLY D . n D 1 49 PHE 49 60 60 PHE PHE D . n D 1 50 ILE 50 61 61 ILE ILE D . n D 1 51 SER 51 62 62 SER SER D . n D 1 52 LYS 52 63 63 LYS LYS D . n D 1 53 LEU 53 64 64 LEU LEU D . n D 1 54 ASP 54 65 65 ASP ASP D . n D 1 55 LYS 55 66 66 LYS LYS D . n D 1 56 ASN 56 67 67 ASN ASN D . n D 1 57 GLY 57 68 68 GLY GLY D . n D 1 58 LYS 58 69 69 LYS LYS D . n D 1 59 VAL 59 70 70 VAL VAL D . n D 1 60 LEU 60 71 71 LEU LEU D . n D 1 61 GLU 61 72 72 GLU GLU D . n D 1 62 TYR 62 73 73 TYR TYR D . n D 1 63 LYS 63 74 74 LYS LYS D . n D 1 64 PHE 64 75 75 PHE PHE D . n D 1 65 LEU 65 76 76 LEU LEU D . n D 1 66 THR 66 77 77 THR THR D . n D 1 67 HIS 67 78 78 HIS HIS D . n D 1 68 LEU 68 79 79 LEU LEU D . n D 1 69 ASN 69 80 80 ASN ASN D . n D 1 70 ALA 70 81 81 ALA ALA D . n D 1 71 PRO 71 82 82 PRO PRO D . n D 1 72 LYS 72 83 83 LYS LYS D . n D 1 73 GLY 73 84 84 GLY GLY D . n D 1 74 MET 74 85 85 MET MET D . n D 1 75 MET 75 86 86 MET MET D . n D 1 76 GLU 76 87 87 GLU GLU D . n D 1 77 ILE 77 88 88 ILE ILE D . n D 1 78 GLY 78 89 89 GLY GLY D . n D 1 79 LYS 79 90 90 LYS LYS D . n D 1 80 THR 80 91 91 THR THR D . n D 1 81 LEU 81 92 92 LEU LEU D . n D 1 82 TYR 82 93 93 TYR TYR D . n D 1 83 VAL 83 94 94 VAL VAL D . n D 1 84 VAL 84 95 95 VAL VAL D . n D 1 85 ASP 85 96 96 ASP ASP D . n D 1 86 ILE 86 97 97 ILE ILE D . n D 1 87 ASP 87 98 98 ASP ASP D . n D 1 88 VAL 88 99 99 VAL VAL D . n D 1 89 LEU 89 100 100 LEU LEU D . n D 1 90 ARG 90 101 101 ARG ARG D . n D 1 91 GLY 91 102 102 GLY GLY D . n D 1 92 PHE 92 103 103 PHE PHE D . n D 1 93 ASP 93 104 104 ASP ASP D . n D 1 94 LEU 94 105 105 LEU LEU D . n D 1 95 LYS 95 106 106 LYS LYS D . n D 1 96 THR 96 107 107 THR THR D . n D 1 97 LYS 97 108 108 LYS LYS D . n D 1 98 LYS 98 109 109 LYS LYS D . n D 1 99 GLU 99 110 110 GLU GLU D . n D 1 100 ILE 100 111 111 ILE ILE D . n D 1 101 PHE 101 112 112 PHE PHE D . n D 1 102 ASN 102 113 113 ASN ASN D . n D 1 103 LEU 103 114 114 LEU LEU D . n D 1 104 PRO 104 115 115 PRO PRO D . n D 1 105 ILE 105 116 116 ILE ILE D . n D 1 106 LYS 106 117 117 LYS LYS D . n D 1 107 GLY 107 118 118 GLY GLY D . n D 1 108 ALA 108 119 119 ALA ALA D . n D 1 109 ILE 109 120 120 ILE ILE D . n D 1 110 PHE 110 121 121 PHE PHE D . n D 1 111 LEU 111 122 122 LEU LEU D . n D 1 112 ASN 112 123 123 ASN ASN D . n D 1 113 ASP 113 124 124 ASP ASP D . n D 1 114 ILE 114 125 125 ILE ILE D . n D 1 115 GLU 115 126 126 GLU GLU D . n D 1 116 LYS 116 127 127 LYS LYS D . n D 1 117 LEU 117 128 128 LEU LEU D . n D 1 118 ASP 118 129 129 ASP ASP D . n D 1 119 ASP 119 130 130 ASP ASP D . n D 1 120 ASN 120 131 131 ASN ASN D . n D 1 121 THR 121 132 132 THR THR D . n D 1 122 LEU 122 133 133 LEU LEU D . n D 1 123 LEU 123 134 134 LEU LEU D . n D 1 124 VAL 124 135 135 VAL VAL D . n D 1 125 SER 125 136 136 SER SER D . n D 1 126 ASP 126 137 137 ASP ASP D . n D 1 127 THR 127 138 138 THR THR D . n D 1 128 GLY 128 139 139 GLY GLY D . n D 1 129 THR 129 140 140 THR THR D . n D 1 130 GLY 130 141 141 GLY GLY D . n D 1 131 LEU 131 142 142 LEU LEU D . n D 1 132 ILE 132 143 143 ILE ILE D . n D 1 133 LEU 133 144 144 LEU LEU D . n D 1 134 LYS 134 145 145 LYS LYS D . n D 1 135 VAL 135 146 146 VAL VAL D . n D 1 136 ASP 136 147 147 ASP ASP D . n D 1 137 LEU 137 148 148 LEU LEU D . n D 1 138 LYS 138 149 149 LYS LYS D . n D 1 139 THR 139 150 150 THR THR D . n D 1 140 LYS 140 151 151 LYS LYS D . n D 1 141 GLN 141 152 152 GLN GLN D . n D 1 142 TYR 142 153 153 TYR TYR D . n D 1 143 ASP 143 154 154 ASP ASP D . n D 1 144 GLU 144 155 155 GLU GLU D . n D 1 145 LEU 145 156 156 LEU LEU D . n D 1 146 LEU 146 157 157 LEU LEU D . n D 1 147 LYS 147 158 158 LYS LYS D . n D 1 148 LEU 148 159 159 LEU LEU D . n D 1 149 ASP 149 160 160 ASP ASP D . n D 1 150 LEU 150 161 161 LEU LEU D . n D 1 151 ALA 151 162 162 ALA ALA D . n D 1 152 LYS 152 163 163 LYS LYS D . n D 1 153 PHE 153 164 164 PHE PHE D . n D 1 154 GLY 154 165 165 GLY GLY D . n D 1 155 GLY 155 166 166 GLY GLY D . n D 1 156 PRO 156 167 167 PRO PRO D . n D 1 157 ASN 157 168 168 ASN ASN D . n D 1 158 GLY 158 169 169 GLY GLY D . n D 1 159 LEU 159 170 170 LEU LEU D . n D 1 160 TYR 160 171 171 TYR TYR D . n D 1 161 LEU 161 172 172 LEU LEU D . n D 1 162 ASP 162 173 173 ASP ASP D . n D 1 163 ARG 163 174 174 ARG ARG D . n D 1 164 LYS 164 175 175 LYS LYS D . n D 1 165 LYS 165 176 176 LYS LYS D . n D 1 166 HIS 166 177 177 HIS HIS D . n D 1 167 LYS 167 178 178 LYS LYS D . n D 1 168 LEU 168 179 179 LEU LEU D . n D 1 169 PHE 169 180 180 PHE PHE D . n D 1 170 ILE 170 181 181 ILE ILE D . n D 1 171 THR 171 182 182 THR THR D . n D 1 172 GLY 172 183 183 GLY GLY D . n D 1 173 TYR 173 184 184 TYR TYR D . n D 1 174 HIS 174 185 185 HIS HIS D . n D 1 175 PRO 175 186 186 PRO PRO D . n D 1 176 ASP 176 187 187 ASP ASP D . n D 1 177 GLY 177 188 188 GLY GLY D . n D 1 178 VAL 178 189 189 VAL VAL D . n D 1 179 SER 179 190 190 SER SER D . n D 1 180 GLY 180 191 191 GLY GLY D . n D 1 181 GLY 181 192 192 GLY GLY D . n D 1 182 VAL 182 193 193 VAL VAL D . n D 1 183 VAL 183 194 194 VAL VAL D . n D 1 184 MET 184 195 195 MET MET D . n D 1 185 ALA 185 196 196 ALA ALA D . n D 1 186 TYR 186 197 197 TYR TYR D . n D 1 187 ASP 187 198 198 ASP ASP D . n D 1 188 LEU 188 199 199 LEU LEU D . n D 1 189 ASN 189 200 200 ASN ASN D . n D 1 190 THR 190 201 201 THR THR D . n D 1 191 LYS 191 202 202 LYS LYS D . n D 1 192 GLU 192 203 203 GLU GLU D . n D 1 193 LEU 193 204 204 LEU LEU D . n D 1 194 SER 194 205 205 SER SER D . n D 1 195 ILE 195 206 206 ILE ILE D . n D 1 196 ILE 196 207 207 ILE ILE D . n D 1 197 LYS 197 208 208 LYS LYS D . n D 1 198 ASN 198 209 209 ASN ASN D . n D 1 199 GLU 199 210 210 GLU GLU D . n D 1 200 LYS 200 211 211 LYS LYS D . n D 1 201 GLU 201 212 212 GLU GLU D . n D 1 202 SER 202 213 213 SER SER D . n D 1 203 TYR 203 214 214 TYR TYR D . n D 1 204 ASP 204 215 215 ASP ASP D . n D 1 205 GLY 205 216 216 GLY GLY D . n D 1 206 ILE 206 217 217 ILE ILE D . n D 1 207 VAL 207 218 218 VAL VAL D . n D 1 208 PRO 208 219 219 PRO PRO D . n D 1 209 TYR 209 220 220 TYR TYR D . n D 1 210 LYS 210 221 221 LYS LYS D . n D 1 211 ASP 211 222 222 ASP ASP D . n D 1 212 GLY 212 223 223 GLY GLY D . n D 1 213 LEU 213 224 224 LEU LEU D . n D 1 214 LEU 214 225 225 LEU LEU D . n D 1 215 VAL 215 226 226 VAL VAL D . n D 1 216 SER 216 227 227 SER SER D . n D 1 217 SER 217 228 228 SER SER D . n D 1 218 TRP 218 229 229 TRP TRP D . n D 1 219 GLY 219 230 230 GLY GLY D . n D 1 220 ASN 220 231 231 ASN ASN D . n D 1 221 ASN 221 232 232 ASN ASN D . n D 1 222 LEU 222 233 233 LEU LEU D . n D 1 223 ASN 223 234 234 ASN ASN D . n D 1 224 GLY 224 235 235 GLY GLY D . n D 1 225 TYR 225 236 236 TYR TYR D . n D 1 226 ILE 226 237 237 ILE ILE D . n D 1 227 TYR 227 238 238 TYR TYR D . n D 1 228 ASN 228 239 239 ASN ASN D . n D 1 229 LEU 229 240 240 LEU LEU D . n D 1 230 ASP 230 241 241 ASP ASP D . n D 1 231 ASN 231 242 ? ? ? D . n D 1 232 VAL 232 243 ? ? ? D . n D 1 233 LYS 233 244 244 LYS LYS D . n D 1 234 SER 234 245 245 SER SER D . n D 1 235 VAL 235 246 246 VAL VAL D . n D 1 236 LYS 236 247 247 LYS LYS D . n D 1 237 LEU 237 248 248 LEU LEU D . n D 1 238 GLU 238 249 249 GLU GLU D . n D 1 239 LEU 239 250 250 LEU LEU D . n D 1 240 PRO 240 251 251 PRO PRO D . n D 1 241 LEU 241 252 252 LEU LEU D . n D 1 242 MET 242 253 253 MET MET D . n D 1 243 LYS 243 254 254 LYS LYS D . n D 1 244 GLY 244 255 255 GLY GLY D . n D 1 245 PRO 245 256 256 PRO PRO D . n D 1 246 ALA 246 257 257 ALA ALA D . n D 1 247 ASP 247 258 258 ASP ASP D . n D 1 248 ILE 248 259 259 ILE ILE D . n D 1 249 PHE 249 260 260 PHE PHE D . n D 1 250 ILE 250 261 261 ILE ILE D . n D 1 251 GLU 251 262 262 GLU GLU D . n D 1 252 GLY 252 263 263 GLY GLY D . n D 1 253 ASN 253 264 264 ASN ASN D . n D 1 254 ILE 254 265 265 ILE ILE D . n D 1 255 LEU 255 266 266 LEU LEU D . n D 1 256 TRP 256 267 267 TRP TRP D . n D 1 257 ILE 257 268 268 ILE ILE D . n D 1 258 PRO 258 269 269 PRO PRO D . n D 1 259 LYS 259 270 270 LYS LYS D . n D 1 260 MET 260 271 271 MET MET D . n D 1 261 VAL 261 272 272 VAL VAL D . n D 1 262 GLU 262 273 273 GLU GLU D . n D 1 263 GLY 263 274 274 GLY GLY D . n D 1 264 LYS 264 275 275 LYS LYS D . n D 1 265 ILE 265 276 276 ILE ILE D . n D 1 266 PHE 266 277 277 PHE PHE D . n D 1 267 LYS 267 278 278 LYS LYS D . n D 1 268 VAL 268 279 279 VAL VAL D . n D 1 269 GLU 269 280 280 GLU GLU D . n D 1 270 LEU 270 281 281 LEU LEU D . n D 1 271 ASN 271 282 282 ASN ASN D . n D 1 272 LYS 272 283 ? ? ? D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 2 HOH 1 301 1 HOH HOH A . E 2 HOH 2 302 4 HOH HOH A . E 2 HOH 3 303 16 HOH HOH A . E 2 HOH 4 304 113 HOH HOH A . E 2 HOH 5 305 128 HOH HOH A . E 2 HOH 6 306 2 HOH HOH A . E 2 HOH 7 307 139 HOH HOH A . E 2 HOH 8 308 225 HOH HOH A . E 2 HOH 9 309 254 HOH HOH A . E 2 HOH 10 310 202 HOH HOH A . E 2 HOH 11 311 185 HOH HOH A . E 2 HOH 12 312 44 HOH HOH A . E 2 HOH 13 313 78 HOH HOH A . E 2 HOH 14 314 37 HOH HOH A . E 2 HOH 15 315 125 HOH HOH A . E 2 HOH 16 316 51 HOH HOH A . E 2 HOH 17 317 107 HOH HOH A . E 2 HOH 18 318 52 HOH HOH A . E 2 HOH 19 319 255 HOH HOH A . E 2 HOH 20 320 20 HOH HOH A . E 2 HOH 21 321 136 HOH HOH A . E 2 HOH 22 322 164 HOH HOH A . E 2 HOH 23 323 48 HOH HOH A . E 2 HOH 24 324 21 HOH HOH A . E 2 HOH 25 325 169 HOH HOH A . E 2 HOH 26 326 188 HOH HOH A . E 2 HOH 27 327 178 HOH HOH A . E 2 HOH 28 328 249 HOH HOH A . E 2 HOH 29 329 239 HOH HOH A . E 2 HOH 30 330 218 HOH HOH A . E 2 HOH 31 331 217 HOH HOH A . E 2 HOH 32 332 127 HOH HOH A . E 2 HOH 33 333 72 HOH HOH A . E 2 HOH 34 334 28 HOH HOH A . E 2 HOH 35 335 148 HOH HOH A . E 2 HOH 36 336 104 HOH HOH A . E 2 HOH 37 337 38 HOH HOH A . E 2 HOH 38 338 228 HOH HOH A . E 2 HOH 39 339 19 HOH HOH A . E 2 HOH 40 340 204 HOH HOH A . E 2 HOH 41 341 46 HOH HOH A . E 2 HOH 42 342 197 HOH HOH A . E 2 HOH 43 343 166 HOH HOH A . E 2 HOH 44 344 97 HOH HOH A . E 2 HOH 45 345 246 HOH HOH A . E 2 HOH 46 346 115 HOH HOH A . E 2 HOH 47 347 132 HOH HOH A . E 2 HOH 48 348 76 HOH HOH A . E 2 HOH 49 349 193 HOH HOH A . E 2 HOH 50 350 111 HOH HOH A . E 2 HOH 51 351 109 HOH HOH A . E 2 HOH 52 352 98 HOH HOH A . E 2 HOH 53 353 27 HOH HOH A . E 2 HOH 54 354 85 HOH HOH A . E 2 HOH 55 355 165 HOH HOH A . E 2 HOH 56 356 24 HOH HOH A . E 2 HOH 57 357 36 HOH HOH A . E 2 HOH 58 358 144 HOH HOH A . E 2 HOH 59 359 86 HOH HOH A . E 2 HOH 60 360 119 HOH HOH A . E 2 HOH 61 361 35 HOH HOH A . E 2 HOH 62 362 195 HOH HOH A . E 2 HOH 63 363 259 HOH HOH A . E 2 HOH 64 364 172 HOH HOH A . E 2 HOH 65 365 23 HOH HOH A . E 2 HOH 66 366 176 HOH HOH A . E 2 HOH 67 367 189 HOH HOH A . E 2 HOH 68 368 91 HOH HOH A . E 2 HOH 69 369 192 HOH HOH A . E 2 HOH 70 370 146 HOH HOH A . E 2 HOH 71 371 3 HOH HOH A . E 2 HOH 72 372 75 HOH HOH A . E 2 HOH 73 373 247 HOH HOH A . E 2 HOH 74 374 96 HOH HOH A . E 2 HOH 75 375 230 HOH HOH A . E 2 HOH 76 376 100 HOH HOH A . E 2 HOH 77 377 180 HOH HOH A . E 2 HOH 78 378 211 HOH HOH A . E 2 HOH 79 379 209 HOH HOH A . E 2 HOH 80 380 92 HOH HOH A . E 2 HOH 81 381 66 HOH HOH A . E 2 HOH 82 382 219 HOH HOH A . E 2 HOH 83 383 81 HOH HOH A . E 2 HOH 84 384 71 HOH HOH A . E 2 HOH 85 385 69 HOH HOH A . E 2 HOH 86 386 201 HOH HOH A . E 2 HOH 87 387 82 HOH HOH A . E 2 HOH 88 388 80 HOH HOH A . E 2 HOH 89 389 179 HOH HOH A . E 2 HOH 90 390 196 HOH HOH A . E 2 HOH 91 391 138 HOH HOH A . E 2 HOH 92 392 57 HOH HOH A . E 2 HOH 93 393 99 HOH HOH A . E 2 HOH 94 394 55 HOH HOH A . E 2 HOH 95 395 31 HOH HOH A . E 2 HOH 96 396 61 HOH HOH A . E 2 HOH 97 397 140 HOH HOH A . E 2 HOH 98 398 45 HOH HOH A . E 2 HOH 99 399 168 HOH HOH A . E 2 HOH 100 400 83 HOH HOH A . E 2 HOH 101 401 130 HOH HOH A . E 2 HOH 102 402 133 HOH HOH A . E 2 HOH 103 403 256 HOH HOH A . E 2 HOH 104 404 257 HOH HOH A . E 2 HOH 105 405 222 HOH HOH A . E 2 HOH 106 406 260 HOH HOH A . E 2 HOH 107 407 235 HOH HOH A . E 2 HOH 108 408 156 HOH HOH A . E 2 HOH 109 409 237 HOH HOH A . E 2 HOH 110 410 183 HOH HOH A . E 2 HOH 111 411 203 HOH HOH A . E 2 HOH 112 412 216 HOH HOH A . E 2 HOH 113 413 264 HOH HOH A . E 2 HOH 114 414 251 HOH HOH A . E 2 HOH 115 415 261 HOH HOH A . E 2 HOH 116 416 177 HOH HOH A . F 2 HOH 1 301 7 HOH HOH B . F 2 HOH 2 302 103 HOH HOH B . F 2 HOH 3 303 6 HOH HOH B . F 2 HOH 4 304 198 HOH HOH B . F 2 HOH 5 305 158 HOH HOH B . F 2 HOH 6 306 215 HOH HOH B . F 2 HOH 7 307 160 HOH HOH B . F 2 HOH 8 308 191 HOH HOH B . F 2 HOH 9 309 242 HOH HOH B . F 2 HOH 10 310 152 HOH HOH B . F 2 HOH 11 311 134 HOH HOH B . F 2 HOH 12 312 153 HOH HOH B . F 2 HOH 13 313 89 HOH HOH B . F 2 HOH 14 314 194 HOH HOH B . F 2 HOH 15 315 199 HOH HOH B . F 2 HOH 16 316 137 HOH HOH B . F 2 HOH 17 317 213 HOH HOH B . F 2 HOH 18 318 117 HOH HOH B . F 2 HOH 19 319 182 HOH HOH B . F 2 HOH 20 320 145 HOH HOH B . G 2 HOH 1 301 8 HOH HOH C . G 2 HOH 2 302 121 HOH HOH C . G 2 HOH 3 303 9 HOH HOH C . G 2 HOH 4 304 108 HOH HOH C . G 2 HOH 5 305 212 HOH HOH C . G 2 HOH 6 306 250 HOH HOH C . G 2 HOH 7 307 58 HOH HOH C . G 2 HOH 8 308 200 HOH HOH C . G 2 HOH 9 309 74 HOH HOH C . G 2 HOH 10 310 120 HOH HOH C . H 2 HOH 1 301 11 HOH HOH D . H 2 HOH 2 302 12 HOH HOH D . H 2 HOH 3 303 263 HOH HOH D . H 2 HOH 4 304 15 HOH HOH D . H 2 HOH 5 305 88 HOH HOH D . H 2 HOH 6 306 208 HOH HOH D . H 2 HOH 7 307 13 HOH HOH D . H 2 HOH 8 308 205 HOH HOH D . H 2 HOH 9 309 64 HOH HOH D . H 2 HOH 10 310 167 HOH HOH D . H 2 HOH 11 311 67 HOH HOH D . H 2 HOH 12 312 141 HOH HOH D . H 2 HOH 13 313 122 HOH HOH D . H 2 HOH 14 314 30 HOH HOH D . H 2 HOH 15 315 32 HOH HOH D . H 2 HOH 16 316 223 HOH HOH D . H 2 HOH 17 317 26 HOH HOH D . H 2 HOH 18 318 39 HOH HOH D . H 2 HOH 19 319 131 HOH HOH D . H 2 HOH 20 320 159 HOH HOH D . H 2 HOH 21 321 79 HOH HOH D . H 2 HOH 22 322 41 HOH HOH D . H 2 HOH 23 323 206 HOH HOH D . H 2 HOH 24 324 40 HOH HOH D . H 2 HOH 25 325 54 HOH HOH D . H 2 HOH 26 326 142 HOH HOH D . H 2 HOH 27 327 34 HOH HOH D . H 2 HOH 28 328 126 HOH HOH D . H 2 HOH 29 329 116 HOH HOH D . H 2 HOH 30 330 59 HOH HOH D . H 2 HOH 31 331 221 HOH HOH D . H 2 HOH 32 332 154 HOH HOH D . H 2 HOH 33 333 43 HOH HOH D . H 2 HOH 34 334 238 HOH HOH D . H 2 HOH 35 335 190 HOH HOH D . H 2 HOH 36 336 149 HOH HOH D . H 2 HOH 37 337 70 HOH HOH D . H 2 HOH 38 338 214 HOH HOH D . H 2 HOH 39 339 56 HOH HOH D . H 2 HOH 40 340 252 HOH HOH D . H 2 HOH 41 341 65 HOH HOH D . H 2 HOH 42 342 94 HOH HOH D . H 2 HOH 43 343 245 HOH HOH D . H 2 HOH 44 344 42 HOH HOH D . H 2 HOH 45 345 53 HOH HOH D . H 2 HOH 46 346 33 HOH HOH D . H 2 HOH 47 347 147 HOH HOH D . H 2 HOH 48 348 87 HOH HOH D . H 2 HOH 49 349 162 HOH HOH D . H 2 HOH 50 350 150 HOH HOH D . H 2 HOH 51 351 135 HOH HOH D . H 2 HOH 52 352 220 HOH HOH D . H 2 HOH 53 353 90 HOH HOH D . H 2 HOH 54 354 174 HOH HOH D . H 2 HOH 55 355 129 HOH HOH D . H 2 HOH 56 356 25 HOH HOH D . H 2 HOH 57 357 17 HOH HOH D . H 2 HOH 58 358 29 HOH HOH D . H 2 HOH 59 359 110 HOH HOH D . H 2 HOH 60 360 171 HOH HOH D . H 2 HOH 61 361 101 HOH HOH D . H 2 HOH 62 362 143 HOH HOH D . H 2 HOH 63 363 84 HOH HOH D . H 2 HOH 64 364 175 HOH HOH D . H 2 HOH 65 365 207 HOH HOH D . H 2 HOH 66 366 105 HOH HOH D . H 2 HOH 67 367 262 HOH HOH D . H 2 HOH 68 368 124 HOH HOH D . H 2 HOH 69 369 63 HOH HOH D . H 2 HOH 70 370 95 HOH HOH D . H 2 HOH 71 371 123 HOH HOH D . H 2 HOH 72 372 155 HOH HOH D . H 2 HOH 73 373 258 HOH HOH D . H 2 HOH 74 374 73 HOH HOH D . H 2 HOH 75 375 22 HOH HOH D . H 2 HOH 76 376 47 HOH HOH D . H 2 HOH 77 377 62 HOH HOH D . H 2 HOH 78 378 49 HOH HOH D . H 2 HOH 79 379 60 HOH HOH D . H 2 HOH 80 380 93 HOH HOH D . H 2 HOH 81 381 106 HOH HOH D . H 2 HOH 82 382 224 HOH HOH D . H 2 HOH 83 383 68 HOH HOH D . H 2 HOH 84 384 173 HOH HOH D . H 2 HOH 85 385 112 HOH HOH D . H 2 HOH 86 386 118 HOH HOH D . H 2 HOH 87 387 151 HOH HOH D . H 2 HOH 88 388 229 HOH HOH D . H 2 HOH 89 389 244 HOH HOH D . H 2 HOH 90 390 231 HOH HOH D . H 2 HOH 91 391 248 HOH HOH D . H 2 HOH 92 392 240 HOH HOH D . H 2 HOH 93 393 233 HOH HOH D . H 2 HOH 94 394 234 HOH HOH D . H 2 HOH 95 395 114 HOH HOH D . H 2 HOH 96 396 241 HOH HOH D . H 2 HOH 97 397 232 HOH HOH D . H 2 HOH 98 398 243 HOH HOH D . H 2 HOH 99 399 157 HOH HOH D . H 2 HOH 100 400 170 HOH HOH D . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 19 ? CG ? A GLU 8 CG 2 1 Y 1 A GLU 19 ? CD ? A GLU 8 CD 3 1 Y 1 A GLU 19 ? OE1 ? A GLU 8 OE1 4 1 Y 1 A GLU 19 ? OE2 ? A GLU 8 OE2 5 1 Y 1 A LYS 21 ? CD ? A LYS 10 CD 6 1 Y 1 A LYS 21 ? CE ? A LYS 10 CE 7 1 Y 1 A LYS 21 ? NZ ? A LYS 10 NZ 8 1 Y 1 A LYS 38 ? CG ? A LYS 27 CG 9 1 Y 1 A LYS 38 ? CD ? A LYS 27 CD 10 1 Y 1 A LYS 38 ? CE ? A LYS 27 CE 11 1 Y 1 A LYS 38 ? NZ ? A LYS 27 NZ 12 1 Y 1 A LYS 90 ? CG ? A LYS 79 CG 13 1 Y 1 A LYS 90 ? CD ? A LYS 79 CD 14 1 Y 1 A LYS 90 ? CE ? A LYS 79 CE 15 1 Y 1 A LYS 90 ? NZ ? A LYS 79 NZ 16 1 Y 1 A LYS 106 ? CG ? A LYS 95 CG 17 1 Y 1 A LYS 106 ? CD ? A LYS 95 CD 18 1 Y 1 A LYS 106 ? CE ? A LYS 95 CE 19 1 Y 1 A LYS 106 ? NZ ? A LYS 95 NZ 20 1 Y 1 A LYS 109 ? CG ? A LYS 98 CG 21 1 Y 1 A LYS 109 ? CD ? A LYS 98 CD 22 1 Y 1 A LYS 109 ? CE ? A LYS 98 CE 23 1 Y 1 A LYS 109 ? NZ ? A LYS 98 NZ 24 1 Y 1 A LYS 117 ? CG ? A LYS 106 CG 25 1 Y 1 A LYS 117 ? CD ? A LYS 106 CD 26 1 Y 1 A LYS 117 ? CE ? A LYS 106 CE 27 1 Y 1 A LYS 117 ? NZ ? A LYS 106 NZ 28 1 Y 1 A LYS 149 ? CD ? A LYS 138 CD 29 1 Y 1 A LYS 149 ? CE ? A LYS 138 CE 30 1 Y 1 A LYS 149 ? NZ ? A LYS 138 NZ 31 1 Y 1 A GLN 152 ? CG ? A GLN 141 CG 32 1 Y 1 A GLN 152 ? CD ? A GLN 141 CD 33 1 Y 1 A GLN 152 ? OE1 ? A GLN 141 OE1 34 1 Y 1 A GLN 152 ? NE2 ? A GLN 141 NE2 35 1 Y 1 A LYS 175 ? CG ? A LYS 164 CG 36 1 Y 1 A LYS 175 ? CD ? A LYS 164 CD 37 1 Y 1 A LYS 175 ? CE ? A LYS 164 CE 38 1 Y 1 A LYS 175 ? NZ ? A LYS 164 NZ 39 1 Y 1 A LYS 176 ? CD ? A LYS 165 CD 40 1 Y 1 A LYS 176 ? CE ? A LYS 165 CE 41 1 Y 1 A LYS 176 ? NZ ? A LYS 165 NZ 42 1 Y 1 A LYS 202 ? CE ? A LYS 191 CE 43 1 Y 1 A LYS 202 ? NZ ? A LYS 191 NZ 44 1 Y 1 A LYS 244 ? CE ? A LYS 233 CE 45 1 Y 1 A LYS 244 ? NZ ? A LYS 233 NZ 46 1 Y 1 B LYS 21 ? CG ? B LYS 10 CG 47 1 Y 1 B LYS 21 ? CD ? B LYS 10 CD 48 1 Y 1 B LYS 21 ? CE ? B LYS 10 CE 49 1 Y 1 B LYS 21 ? NZ ? B LYS 10 NZ 50 1 Y 1 B LYS 38 ? CG ? B LYS 27 CG 51 1 Y 1 B LYS 38 ? CD ? B LYS 27 CD 52 1 Y 1 B LYS 38 ? CE ? B LYS 27 CE 53 1 Y 1 B LYS 38 ? NZ ? B LYS 27 NZ 54 1 Y 1 B GLU 48 ? CG ? B GLU 37 CG 55 1 Y 1 B GLU 48 ? CD ? B GLU 37 CD 56 1 Y 1 B GLU 48 ? OE1 ? B GLU 37 OE1 57 1 Y 1 B GLU 48 ? OE2 ? B GLU 37 OE2 58 1 Y 1 B LYS 49 ? CG ? B LYS 38 CG 59 1 Y 1 B LYS 49 ? CD ? B LYS 38 CD 60 1 Y 1 B LYS 49 ? CE ? B LYS 38 CE 61 1 Y 1 B LYS 49 ? NZ ? B LYS 38 NZ 62 1 Y 1 B GLU 51 ? CG ? B GLU 40 CG 63 1 Y 1 B GLU 51 ? CD ? B GLU 40 CD 64 1 Y 1 B GLU 51 ? OE1 ? B GLU 40 OE1 65 1 Y 1 B GLU 51 ? OE2 ? B GLU 40 OE2 66 1 Y 1 B LYS 90 ? CG ? B LYS 79 CG 67 1 Y 1 B LYS 90 ? CD ? B LYS 79 CD 68 1 Y 1 B LYS 90 ? CE ? B LYS 79 CE 69 1 Y 1 B LYS 90 ? NZ ? B LYS 79 NZ 70 1 Y 1 B LYS 106 ? CG ? B LYS 95 CG 71 1 Y 1 B LYS 106 ? CD ? B LYS 95 CD 72 1 Y 1 B LYS 106 ? CE ? B LYS 95 CE 73 1 Y 1 B LYS 106 ? NZ ? B LYS 95 NZ 74 1 Y 1 B LYS 109 ? CG ? B LYS 98 CG 75 1 Y 1 B LYS 109 ? CD ? B LYS 98 CD 76 1 Y 1 B LYS 109 ? CE ? B LYS 98 CE 77 1 Y 1 B LYS 109 ? NZ ? B LYS 98 NZ 78 1 Y 1 B LYS 117 ? CG ? B LYS 106 CG 79 1 Y 1 B LYS 117 ? CD ? B LYS 106 CD 80 1 Y 1 B LYS 117 ? CE ? B LYS 106 CE 81 1 Y 1 B LYS 117 ? NZ ? B LYS 106 NZ 82 1 Y 1 B LYS 149 ? CD ? B LYS 138 CD 83 1 Y 1 B LYS 149 ? CE ? B LYS 138 CE 84 1 Y 1 B LYS 149 ? NZ ? B LYS 138 NZ 85 1 Y 1 B GLN 152 ? CG ? B GLN 141 CG 86 1 Y 1 B GLN 152 ? CD ? B GLN 141 CD 87 1 Y 1 B GLN 152 ? OE1 ? B GLN 141 OE1 88 1 Y 1 B GLN 152 ? NE2 ? B GLN 141 NE2 89 1 Y 1 B GLU 155 ? CG ? B GLU 144 CG 90 1 Y 1 B GLU 155 ? CD ? B GLU 144 CD 91 1 Y 1 B GLU 155 ? OE1 ? B GLU 144 OE1 92 1 Y 1 B GLU 155 ? OE2 ? B GLU 144 OE2 93 1 Y 1 B LYS 158 ? CE ? B LYS 147 CE 94 1 Y 1 B LYS 158 ? NZ ? B LYS 147 NZ 95 1 Y 1 B LYS 163 ? CG ? B LYS 152 CG 96 1 Y 1 B LYS 163 ? CD ? B LYS 152 CD 97 1 Y 1 B LYS 163 ? CE ? B LYS 152 CE 98 1 Y 1 B LYS 163 ? NZ ? B LYS 152 NZ 99 1 Y 1 B ARG 174 ? CG ? B ARG 163 CG 100 1 Y 1 B ARG 174 ? CD ? B ARG 163 CD 101 1 Y 1 B ARG 174 ? NE ? B ARG 163 NE 102 1 Y 1 B ARG 174 ? CZ ? B ARG 163 CZ 103 1 Y 1 B ARG 174 ? NH1 ? B ARG 163 NH1 104 1 Y 1 B ARG 174 ? NH2 ? B ARG 163 NH2 105 1 Y 1 B LYS 175 ? CG ? B LYS 164 CG 106 1 Y 1 B LYS 175 ? CD ? B LYS 164 CD 107 1 Y 1 B LYS 175 ? CE ? B LYS 164 CE 108 1 Y 1 B LYS 175 ? NZ ? B LYS 164 NZ 109 1 Y 1 B ASN 264 ? CG ? B ASN 253 CG 110 1 Y 1 B ASN 264 ? OD1 ? B ASN 253 OD1 111 1 Y 1 B ASN 264 ? ND2 ? B ASN 253 ND2 112 1 Y 1 C GLU 19 ? CG ? C GLU 8 CG 113 1 Y 1 C GLU 19 ? CD ? C GLU 8 CD 114 1 Y 1 C GLU 19 ? OE1 ? C GLU 8 OE1 115 1 Y 1 C GLU 19 ? OE2 ? C GLU 8 OE2 116 1 Y 1 C LYS 21 ? CG ? C LYS 10 CG 117 1 Y 1 C LYS 21 ? CD ? C LYS 10 CD 118 1 Y 1 C LYS 21 ? CE ? C LYS 10 CE 119 1 Y 1 C LYS 21 ? NZ ? C LYS 10 NZ 120 1 Y 1 C LYS 38 ? CG ? C LYS 27 CG 121 1 Y 1 C LYS 38 ? CD ? C LYS 27 CD 122 1 Y 1 C LYS 38 ? CE ? C LYS 27 CE 123 1 Y 1 C LYS 38 ? NZ ? C LYS 27 NZ 124 1 Y 1 C LYS 49 ? CG ? C LYS 38 CG 125 1 Y 1 C LYS 49 ? CD ? C LYS 38 CD 126 1 Y 1 C LYS 49 ? CE ? C LYS 38 CE 127 1 Y 1 C LYS 49 ? NZ ? C LYS 38 NZ 128 1 Y 1 C LYS 69 ? CG ? C LYS 58 CG 129 1 Y 1 C LYS 69 ? CD ? C LYS 58 CD 130 1 Y 1 C LYS 69 ? CE ? C LYS 58 CE 131 1 Y 1 C LYS 69 ? NZ ? C LYS 58 NZ 132 1 Y 1 C LYS 90 ? CG ? C LYS 79 CG 133 1 Y 1 C LYS 90 ? CD ? C LYS 79 CD 134 1 Y 1 C LYS 90 ? CE ? C LYS 79 CE 135 1 Y 1 C LYS 90 ? NZ ? C LYS 79 NZ 136 1 Y 1 C LYS 106 ? CG ? C LYS 95 CG 137 1 Y 1 C LYS 106 ? CD ? C LYS 95 CD 138 1 Y 1 C LYS 106 ? CE ? C LYS 95 CE 139 1 Y 1 C LYS 106 ? NZ ? C LYS 95 NZ 140 1 Y 1 C LYS 109 ? CG ? C LYS 98 CG 141 1 Y 1 C LYS 109 ? CD ? C LYS 98 CD 142 1 Y 1 C LYS 109 ? CE ? C LYS 98 CE 143 1 Y 1 C LYS 109 ? NZ ? C LYS 98 NZ 144 1 Y 1 C LYS 117 ? CG ? C LYS 106 CG 145 1 Y 1 C LYS 117 ? CD ? C LYS 106 CD 146 1 Y 1 C LYS 117 ? CE ? C LYS 106 CE 147 1 Y 1 C LYS 117 ? NZ ? C LYS 106 NZ 148 1 Y 1 C LYS 145 ? CD ? C LYS 134 CD 149 1 Y 1 C LYS 145 ? CE ? C LYS 134 CE 150 1 Y 1 C LYS 145 ? NZ ? C LYS 134 NZ 151 1 Y 1 C LYS 149 ? CG ? C LYS 138 CG 152 1 Y 1 C LYS 149 ? CD ? C LYS 138 CD 153 1 Y 1 C LYS 149 ? CE ? C LYS 138 CE 154 1 Y 1 C LYS 149 ? NZ ? C LYS 138 NZ 155 1 Y 1 C ASP 154 ? CG ? C ASP 143 CG 156 1 Y 1 C ASP 154 ? OD1 ? C ASP 143 OD1 157 1 Y 1 C ASP 154 ? OD2 ? C ASP 143 OD2 158 1 Y 1 C LYS 158 ? CG ? C LYS 147 CG 159 1 Y 1 C LYS 158 ? CD ? C LYS 147 CD 160 1 Y 1 C LYS 158 ? CE ? C LYS 147 CE 161 1 Y 1 C LYS 158 ? NZ ? C LYS 147 NZ 162 1 Y 1 C ASP 173 ? CG ? C ASP 162 CG 163 1 Y 1 C ASP 173 ? OD1 ? C ASP 162 OD1 164 1 Y 1 C ASP 173 ? OD2 ? C ASP 162 OD2 165 1 Y 1 C LYS 175 ? CG ? C LYS 164 CG 166 1 Y 1 C LYS 175 ? CD ? C LYS 164 CD 167 1 Y 1 C LYS 175 ? CE ? C LYS 164 CE 168 1 Y 1 C LYS 175 ? NZ ? C LYS 164 NZ 169 1 Y 1 C LYS 176 ? CG ? C LYS 165 CG 170 1 Y 1 C LYS 176 ? CD ? C LYS 165 CD 171 1 Y 1 C LYS 176 ? CE ? C LYS 165 CE 172 1 Y 1 C LYS 176 ? NZ ? C LYS 165 NZ 173 1 Y 1 C TYR 184 ? CG ? C TYR 173 CG 174 1 Y 1 C TYR 184 ? CD1 ? C TYR 173 CD1 175 1 Y 1 C TYR 184 ? CD2 ? C TYR 173 CD2 176 1 Y 1 C TYR 184 ? CE1 ? C TYR 173 CE1 177 1 Y 1 C TYR 184 ? CE2 ? C TYR 173 CE2 178 1 Y 1 C TYR 184 ? CZ ? C TYR 173 CZ 179 1 Y 1 C TYR 184 ? OH ? C TYR 173 OH 180 1 Y 1 C LYS 202 ? CG ? C LYS 191 CG 181 1 Y 1 C LYS 202 ? CD ? C LYS 191 CD 182 1 Y 1 C LYS 202 ? CE ? C LYS 191 CE 183 1 Y 1 C LYS 202 ? NZ ? C LYS 191 NZ 184 1 Y 1 C GLU 203 ? CG ? C GLU 192 CG 185 1 Y 1 C GLU 203 ? CD ? C GLU 192 CD 186 1 Y 1 C GLU 203 ? OE1 ? C GLU 192 OE1 187 1 Y 1 C GLU 203 ? OE2 ? C GLU 192 OE2 188 1 Y 1 C LYS 221 ? CD ? C LYS 210 CD 189 1 Y 1 C LYS 221 ? CE ? C LYS 210 CE 190 1 Y 1 C LYS 221 ? NZ ? C LYS 210 NZ 191 1 Y 1 C ASP 222 ? CG ? C ASP 211 CG 192 1 Y 1 C ASP 222 ? OD1 ? C ASP 211 OD1 193 1 Y 1 C ASP 222 ? OD2 ? C ASP 211 OD2 194 1 Y 1 C ASP 241 ? CG ? C ASP 230 CG 195 1 Y 1 C ASP 241 ? OD1 ? C ASP 230 OD1 196 1 Y 1 C ASP 241 ? OD2 ? C ASP 230 OD2 197 1 Y 1 C SER 245 ? OG ? C SER 234 OG 198 1 Y 1 D SER 18 ? OG ? D SER 7 OG 199 1 Y 1 D LYS 21 ? CD ? D LYS 10 CD 200 1 Y 1 D LYS 21 ? CE ? D LYS 10 CE 201 1 Y 1 D LYS 21 ? NZ ? D LYS 10 NZ 202 1 Y 1 D LYS 38 ? CG ? D LYS 27 CG 203 1 Y 1 D LYS 38 ? CD ? D LYS 27 CD 204 1 Y 1 D LYS 38 ? CE ? D LYS 27 CE 205 1 Y 1 D LYS 38 ? NZ ? D LYS 27 NZ 206 1 Y 1 D LYS 49 ? CD ? D LYS 38 CD 207 1 Y 1 D LYS 49 ? CE ? D LYS 38 CE 208 1 Y 1 D LYS 49 ? NZ ? D LYS 38 NZ 209 1 Y 1 D LYS 69 ? CG ? D LYS 58 CG 210 1 Y 1 D LYS 69 ? CD ? D LYS 58 CD 211 1 Y 1 D LYS 69 ? CE ? D LYS 58 CE 212 1 Y 1 D LYS 69 ? NZ ? D LYS 58 NZ 213 1 Y 1 D LYS 90 ? CG ? D LYS 79 CG 214 1 Y 1 D LYS 90 ? CD ? D LYS 79 CD 215 1 Y 1 D LYS 90 ? CE ? D LYS 79 CE 216 1 Y 1 D LYS 90 ? NZ ? D LYS 79 NZ 217 1 Y 1 D LYS 106 ? CG ? D LYS 95 CG 218 1 Y 1 D LYS 106 ? CD ? D LYS 95 CD 219 1 Y 1 D LYS 106 ? CE ? D LYS 95 CE 220 1 Y 1 D LYS 106 ? NZ ? D LYS 95 NZ 221 1 Y 1 D LYS 149 ? CG ? D LYS 138 CG 222 1 Y 1 D LYS 149 ? CD ? D LYS 138 CD 223 1 Y 1 D LYS 149 ? CE ? D LYS 138 CE 224 1 Y 1 D LYS 149 ? NZ ? D LYS 138 NZ 225 1 Y 1 D GLN 152 ? CG ? D GLN 141 CG 226 1 Y 1 D GLN 152 ? CD ? D GLN 141 CD 227 1 Y 1 D GLN 152 ? OE1 ? D GLN 141 OE1 228 1 Y 1 D GLN 152 ? NE2 ? D GLN 141 NE2 229 1 Y 1 D LYS 175 ? CG ? D LYS 164 CG 230 1 Y 1 D LYS 175 ? CD ? D LYS 164 CD 231 1 Y 1 D LYS 175 ? CE ? D LYS 164 CE 232 1 Y 1 D LYS 175 ? NZ ? D LYS 164 NZ 233 1 Y 1 D LYS 176 ? CD ? D LYS 165 CD 234 1 Y 1 D LYS 176 ? CE ? D LYS 165 CE 235 1 Y 1 D LYS 176 ? NZ ? D LYS 165 NZ 236 1 Y 1 D HIS 177 ? CG ? D HIS 166 CG 237 1 Y 1 D HIS 177 ? ND1 ? D HIS 166 ND1 238 1 Y 1 D HIS 177 ? CD2 ? D HIS 166 CD2 239 1 Y 1 D HIS 177 ? CE1 ? D HIS 166 CE1 240 1 Y 1 D HIS 177 ? NE2 ? D HIS 166 NE2 241 1 Y 1 D VAL 189 ? CG1 ? D VAL 178 CG1 242 1 Y 1 D VAL 189 ? CG2 ? D VAL 178 CG2 243 1 Y 1 D LYS 202 ? CE ? D LYS 191 CE 244 1 Y 1 D LYS 202 ? NZ ? D LYS 191 NZ 245 1 Y 1 D ASP 241 ? CG ? D ASP 230 CG 246 1 Y 1 D ASP 241 ? OD1 ? D ASP 230 OD1 247 1 Y 1 D ASP 241 ? OD2 ? D ASP 230 OD2 248 1 Y 1 D LYS 244 ? CG ? D LYS 233 CG 249 1 Y 1 D LYS 244 ? CD ? D LYS 233 CD 250 1 Y 1 D LYS 244 ? CE ? D LYS 233 CE 251 1 Y 1 D LYS 244 ? NZ ? D LYS 233 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.15.2_3472 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 97.543 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 22GW _cell.details ? _cell.formula_units_Z ? _cell.length_a 80.760 _cell.length_a_esd ? _cell.length_b 56.396 _cell.length_b_esd ? _cell.length_c 121.024 _cell.length_c_esd ? _cell.volume 546438.948 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 22GW _symmetry.cell_setting ? _symmetry.Int_Tables_number 3 _symmetry.space_group_name_Hall 'P 2y' _symmetry.space_group_name_H-M 'P 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 22GW _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.23 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.89 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'Jeffamine, HEPES, EDTA' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 S 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2025-09-29 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97934 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 7A (6B, 6C1)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97934 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '7A (6B, 6C1)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate 26.76 _reflns.entry_id 22GW _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2 _reflns.d_resolution_low 30 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 70660 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.2 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.990 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2 _reflns_shell.d_res_low 2.03 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.2 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2961 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.8 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.694 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 81.2 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 41.53 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 22GW _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.00 _refine.ls_d_res_low 29.99 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 70627 _refine.ls_number_reflns_R_free 3555 _refine.ls_number_reflns_R_work 67072 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.42 _refine.ls_percent_reflns_R_free 5.03 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1886 _refine.ls_R_factor_R_free 0.2261 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1866 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 22GV _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 25.2009 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2412 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 29.99 _refine_hist.number_atoms_solvent 246 _refine_hist.number_atoms_total 8365 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 8119 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0073 ? 8279 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.9749 ? 11218 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.4267 ? 1284 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0061 ? 1428 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 23.2320 ? 3006 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.00 2.03 . . 114 2167 78.22 . . . . 0.2847 . . . . . . . . . . . . . . . 0.3492 'X-RAY DIFFRACTION' 2.03 2.06 . . 118 2342 84.36 . . . . 0.2684 . . . . . . . . . . . . . . . 0.2989 'X-RAY DIFFRACTION' 2.06 2.09 . . 130 2415 86.95 . . . . 0.2492 . . . . . . . . . . . . . . . 0.3177 'X-RAY DIFFRACTION' 2.09 2.12 . . 113 2474 90.17 . . . . 0.2392 . . . . . . . . . . . . . . . 0.3119 'X-RAY DIFFRACTION' 2.12 2.16 . . 155 2572 93.97 . . . . 0.2323 . . . . . . . . . . . . . . . 0.2669 'X-RAY DIFFRACTION' 2.16 2.19 . . 141 2626 94.37 . . . . 0.2273 . . . . . . . . . . . . . . . 0.2276 'X-RAY DIFFRACTION' 2.19 2.23 . . 130 2688 96.44 . . . . 0.2161 . . . . . . . . . . . . . . . 0.2520 'X-RAY DIFFRACTION' 2.23 2.28 . . 134 2696 97.86 . . . . 0.2161 . . . . . . . . . . . . . . . 0.2600 'X-RAY DIFFRACTION' 2.28 2.32 . . 133 2719 98.51 . . . . 0.2154 . . . . . . . . . . . . . . . 0.2617 'X-RAY DIFFRACTION' 2.32 2.37 . . 147 2750 98.67 . . . . 0.2035 . . . . . . . . . . . . . . . 0.2467 'X-RAY DIFFRACTION' 2.37 2.43 . . 148 2727 99.21 . . . . 0.2081 . . . . . . . . . . . . . . . 0.2591 'X-RAY DIFFRACTION' 2.43 2.49 . . 151 2729 99.31 . . . . 0.2005 . . . . . . . . . . . . . . . 0.2619 'X-RAY DIFFRACTION' 2.49 2.56 . . 156 2752 99.22 . . . . 0.2022 . . . . . . . . . . . . . . . 0.2375 'X-RAY DIFFRACTION' 2.56 2.63 . . 137 2753 99.24 . . . . 0.2054 . . . . . . . . . . . . . . . 0.2737 'X-RAY DIFFRACTION' 2.63 2.72 . . 147 2776 99.25 . . . . 0.2180 . . . . . . . . . . . . . . . 0.2718 'X-RAY DIFFRACTION' 2.72 2.81 . . 141 2785 99.46 . . . . 0.2129 . . . . . . . . . . . . . . . 0.2373 'X-RAY DIFFRACTION' 2.81 2.93 . . 150 2716 99.44 . . . . 0.2227 . . . . . . . . . . . . . . . 0.2577 'X-RAY DIFFRACTION' 2.93 3.06 . . 133 2777 99.42 . . . . 0.2213 . . . . . . . . . . . . . . . 0.2777 'X-RAY DIFFRACTION' 3.06 3.22 . . 155 2769 99.56 . . . . 0.2074 . . . . . . . . . . . . . . . 0.2481 'X-RAY DIFFRACTION' 3.22 3.42 . . 164 2770 99.69 . . . . 0.1923 . . . . . . . . . . . . . . . 0.2447 'X-RAY DIFFRACTION' 3.42 3.69 . . 146 2805 99.56 . . . . 0.1700 . . . . . . . . . . . . . . . 0.2058 'X-RAY DIFFRACTION' 3.69 4.06 . . 155 2791 99.70 . . . . 0.1518 . . . . . . . . . . . . . . . 0.1937 'X-RAY DIFFRACTION' 4.06 4.64 . . 141 2783 99.25 . . . . 0.1206 . . . . . . . . . . . . . . . 0.1660 'X-RAY DIFFRACTION' 4.64 5.84 . . 163 2796 99.26 . . . . 0.1402 . . . . . . . . . . . . . . . 0.1562 'X-RAY DIFFRACTION' 5.84 29.99 . . 153 2894 98.99 . . . . 0.1726 . . . . . . . . . . . . . . . 0.1974 # loop_ _struct_ncs_dom.id _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.details 1 1 ? 2 1 ? 3 1 ? 4 1 ? # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A LEU 9 . A THR 66 . A LEU 20 A THR 77 ? ;(chain 'A' and (resid 20 or (resid 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 77 or resid 79 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB or name CG )) or resid 146 through 148 or (resid 149 and (name N or name CA or name C or name O or name CB )) or resid 150 through 153 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 162 or (resid 163 and (name N or name CA or name C or name O or name CB )) or resid 164 through 172 or (resid 173 through 176 and (name N or name CA or name C or name O or name CB )) or resid 178 through 183 or (resid 184 and (name N or name CA or name C or name O or name CB )) or resid 185 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB )) or resid 204 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 222 and (name N or name CA or name C or name O or name CB )) or resid 223 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or (resid 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 263 or (resid 264 and (name N or name CA or name C or name O or name CB )) or resid 265 through 282)) ; 1 1 2 A LEU 68 . A LYS 164 . A LEU 79 A LYS 175 ? ;(chain 'A' and (resid 20 or (resid 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 77 or resid 79 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB or name CG )) or resid 146 through 148 or (resid 149 and (name N or name CA or name C or name O or name CB )) or resid 150 through 153 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 162 or (resid 163 and (name N or name CA or name C or name O or name CB )) or resid 164 through 172 or (resid 173 through 176 and (name N or name CA or name C or name O or name CB )) or resid 178 through 183 or (resid 184 and (name N or name CA or name C or name O or name CB )) or resid 185 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB )) or resid 204 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 222 and (name N or name CA or name C or name O or name CB )) or resid 223 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or (resid 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 263 or (resid 264 and (name N or name CA or name C or name O or name CB )) or resid 265 through 282)) ; 1 1 3 A LYS 167 . A THR 190 . A LYS 178 A THR 201 ? ;(chain 'A' and (resid 20 or (resid 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 77 or resid 79 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB or name CG )) or resid 146 through 148 or (resid 149 and (name N or name CA or name C or name O or name CB )) or resid 150 through 153 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 162 or (resid 163 and (name N or name CA or name C or name O or name CB )) or resid 164 through 172 or (resid 173 through 176 and (name N or name CA or name C or name O or name CB )) or resid 178 through 183 or (resid 184 and (name N or name CA or name C or name O or name CB )) or resid 185 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB )) or resid 204 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 222 and (name N or name CA or name C or name O or name CB )) or resid 223 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or (resid 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 263 or (resid 264 and (name N or name CA or name C or name O or name CB )) or resid 265 through 282)) ; 1 1 4 A LEU 193 . A LEU 229 . A LEU 204 A LEU 240 ? ;(chain 'A' and (resid 20 or (resid 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 77 or resid 79 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB or name CG )) or resid 146 through 148 or (resid 149 and (name N or name CA or name C or name O or name CB )) or resid 150 through 153 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 162 or (resid 163 and (name N or name CA or name C or name O or name CB )) or resid 164 through 172 or (resid 173 through 176 and (name N or name CA or name C or name O or name CB )) or resid 178 through 183 or (resid 184 and (name N or name CA or name C or name O or name CB )) or resid 185 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB )) or resid 204 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 222 and (name N or name CA or name C or name O or name CB )) or resid 223 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or (resid 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 263 or (resid 264 and (name N or name CA or name C or name O or name CB )) or resid 265 through 282)) ; 1 1 5 A SER 234 . A ASN 271 . A SER 245 A ASN 282 ? ;(chain 'A' and (resid 20 or (resid 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 77 or resid 79 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB or name CG )) or resid 146 through 148 or (resid 149 and (name N or name CA or name C or name O or name CB )) or resid 150 through 153 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 162 or (resid 163 and (name N or name CA or name C or name O or name CB )) or resid 164 through 172 or (resid 173 through 176 and (name N or name CA or name C or name O or name CB )) or resid 178 through 183 or (resid 184 and (name N or name CA or name C or name O or name CB )) or resid 185 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB )) or resid 204 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 222 and (name N or name CA or name C or name O or name CB )) or resid 223 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or (resid 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 263 or (resid 264 and (name N or name CA or name C or name O or name CB )) or resid 265 through 282)) ; 1 2 1 B LEU 9 . B THR 66 . B LEU 20 B THR 77 ? ;(chain 'B' and (resid 20 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 77 or resid 79 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB or name CG )) or resid 146 through 148 or (resid 149 and (name N or name CA or name C or name O or name CB )) or resid 150 through 153 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 172 or (resid 173 through 176 and (name N or name CA or name C or name O or name CB )) or resid 178 through 183 or (resid 184 and (name N or name CA or name C or name O or name CB )) or resid 185 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB )) or resid 204 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 222 and (name N or name CA or name C or name O or name CB )) or resid 223 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or (resid 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 282)) ; 1 2 2 B LEU 68 . B LYS 164 . B LEU 79 B LYS 175 ? ;(chain 'B' and (resid 20 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 77 or resid 79 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB or name CG )) or resid 146 through 148 or (resid 149 and (name N or name CA or name C or name O or name CB )) or resid 150 through 153 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 172 or (resid 173 through 176 and (name N or name CA or name C or name O or name CB )) or resid 178 through 183 or (resid 184 and (name N or name CA or name C or name O or name CB )) or resid 185 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB )) or resid 204 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 222 and (name N or name CA or name C or name O or name CB )) or resid 223 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or (resid 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 282)) ; 1 2 3 B LYS 167 . B THR 190 . B LYS 178 B THR 201 ? ;(chain 'B' and (resid 20 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 77 or resid 79 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB or name CG )) or resid 146 through 148 or (resid 149 and (name N or name CA or name C or name O or name CB )) or resid 150 through 153 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 172 or (resid 173 through 176 and (name N or name CA or name C or name O or name CB )) or resid 178 through 183 or (resid 184 and (name N or name CA or name C or name O or name CB )) or resid 185 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB )) or resid 204 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 222 and (name N or name CA or name C or name O or name CB )) or resid 223 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or (resid 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 282)) ; 1 2 4 B LEU 193 . B LEU 229 . B LEU 204 B LEU 240 ? ;(chain 'B' and (resid 20 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 77 or resid 79 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB or name CG )) or resid 146 through 148 or (resid 149 and (name N or name CA or name C or name O or name CB )) or resid 150 through 153 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 172 or (resid 173 through 176 and (name N or name CA or name C or name O or name CB )) or resid 178 through 183 or (resid 184 and (name N or name CA or name C or name O or name CB )) or resid 185 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB )) or resid 204 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 222 and (name N or name CA or name C or name O or name CB )) or resid 223 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or (resid 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 282)) ; 1 2 5 B SER 234 . B ASN 271 . B SER 245 B ASN 282 ? ;(chain 'B' and (resid 20 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 77 or resid 79 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB or name CG )) or resid 146 through 148 or (resid 149 and (name N or name CA or name C or name O or name CB )) or resid 150 through 153 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 172 or (resid 173 through 176 and (name N or name CA or name C or name O or name CB )) or resid 178 through 183 or (resid 184 and (name N or name CA or name C or name O or name CB )) or resid 185 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB )) or resid 204 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 222 and (name N or name CA or name C or name O or name CB )) or resid 223 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or (resid 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 282)) ; 1 3 1 C LEU 9 . C THR 66 . C LEU 20 C THR 77 ? ;(chain 'C' and (resid 20 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 77 or resid 79 through 151 or (resid 152 and (name N or name CA or name C or name O or name CB )) or resid 153 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 162 or (resid 163 and (name N or name CA or name C or name O or name CB )) or resid 164 through 173 or (resid 174 through 176 and (name N or name CA or name C or name O or name CB )) or resid 178 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 202 or resid 204 through 263 or (resid 264 and (name N or name CA or name C or name O or name CB )) or resid 265 through 282)) ; 1 3 2 C LEU 68 . C LYS 164 . C LEU 79 C LYS 175 ? ;(chain 'C' and (resid 20 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 77 or resid 79 through 151 or (resid 152 and (name N or name CA or name C or name O or name CB )) or resid 153 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 162 or (resid 163 and (name N or name CA or name C or name O or name CB )) or resid 164 through 173 or (resid 174 through 176 and (name N or name CA or name C or name O or name CB )) or resid 178 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 202 or resid 204 through 263 or (resid 264 and (name N or name CA or name C or name O or name CB )) or resid 265 through 282)) ; 1 3 3 C LYS 167 . C THR 190 . C LYS 178 C THR 201 ? ;(chain 'C' and (resid 20 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 77 or resid 79 through 151 or (resid 152 and (name N or name CA or name C or name O or name CB )) or resid 153 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 162 or (resid 163 and (name N or name CA or name C or name O or name CB )) or resid 164 through 173 or (resid 174 through 176 and (name N or name CA or name C or name O or name CB )) or resid 178 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 202 or resid 204 through 263 or (resid 264 and (name N or name CA or name C or name O or name CB )) or resid 265 through 282)) ; 1 3 4 C LEU 193 . C LEU 229 . C LEU 204 C LEU 240 ? ;(chain 'C' and (resid 20 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 77 or resid 79 through 151 or (resid 152 and (name N or name CA or name C or name O or name CB )) or resid 153 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 162 or (resid 163 and (name N or name CA or name C or name O or name CB )) or resid 164 through 173 or (resid 174 through 176 and (name N or name CA or name C or name O or name CB )) or resid 178 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 202 or resid 204 through 263 or (resid 264 and (name N or name CA or name C or name O or name CB )) or resid 265 through 282)) ; 1 3 5 C SER 234 . C ASN 271 . C SER 245 C ASN 282 ? ;(chain 'C' and (resid 20 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 77 or resid 79 through 151 or (resid 152 and (name N or name CA or name C or name O or name CB )) or resid 153 through 154 or (resid 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 162 or (resid 163 and (name N or name CA or name C or name O or name CB )) or resid 164 through 173 or (resid 174 through 176 and (name N or name CA or name C or name O or name CB )) or resid 178 through 188 or (resid 189 and (name N or name CA or name C or name O or name CB )) or resid 190 through 202 or resid 204 through 263 or (resid 264 and (name N or name CA or name C or name O or name CB )) or resid 265 through 282)) ; 1 4 1 D LEU 9 . D THR 66 . D LEU 20 D THR 77 ? ;(chain 'D' and (resid 20 or (resid 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 77 or resid 79 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB or name CG )) or resid 146 through 153 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 162 or (resid 163 and (name N or name CA or name C or name O or name CB )) or resid 164 through 172 or (resid 173 through 176 and (name N or name CA or name C or name O or name CB )) or resid 178 through 183 or (resid 184 and (name N or name CA or name C or name O or name CB )) or resid 185 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB )) or resid 204 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 222 and (name N or name CA or name C or name O or name CB )) or resid 223 through 241 or (resid 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 263 or (resid 264 and (name N or name CA or name C or name O or name CB )) or resid 265 through 282)) ; 1 4 2 D LEU 68 . D LYS 164 . D LEU 79 D LYS 175 ? ;(chain 'D' and (resid 20 or (resid 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 77 or resid 79 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB or name CG )) or resid 146 through 153 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 162 or (resid 163 and (name N or name CA or name C or name O or name CB )) or resid 164 through 172 or (resid 173 through 176 and (name N or name CA or name C or name O or name CB )) or resid 178 through 183 or (resid 184 and (name N or name CA or name C or name O or name CB )) or resid 185 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB )) or resid 204 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 222 and (name N or name CA or name C or name O or name CB )) or resid 223 through 241 or (resid 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 263 or (resid 264 and (name N or name CA or name C or name O or name CB )) or resid 265 through 282)) ; 1 4 3 D LYS 167 . D THR 190 . D LYS 178 D THR 201 ? ;(chain 'D' and (resid 20 or (resid 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 77 or resid 79 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB or name CG )) or resid 146 through 153 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 162 or (resid 163 and (name N or name CA or name C or name O or name CB )) or resid 164 through 172 or (resid 173 through 176 and (name N or name CA or name C or name O or name CB )) or resid 178 through 183 or (resid 184 and (name N or name CA or name C or name O or name CB )) or resid 185 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB )) or resid 204 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 222 and (name N or name CA or name C or name O or name CB )) or resid 223 through 241 or (resid 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 263 or (resid 264 and (name N or name CA or name C or name O or name CB )) or resid 265 through 282)) ; 1 4 4 D LEU 193 . D LEU 229 . D LEU 204 D LEU 240 ? ;(chain 'D' and (resid 20 or (resid 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 77 or resid 79 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB or name CG )) or resid 146 through 153 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 162 or (resid 163 and (name N or name CA or name C or name O or name CB )) or resid 164 through 172 or (resid 173 through 176 and (name N or name CA or name C or name O or name CB )) or resid 178 through 183 or (resid 184 and (name N or name CA or name C or name O or name CB )) or resid 185 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB )) or resid 204 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 222 and (name N or name CA or name C or name O or name CB )) or resid 223 through 241 or (resid 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 263 or (resid 264 and (name N or name CA or name C or name O or name CB )) or resid 265 through 282)) ; 1 4 5 D SER 234 . D ASN 271 . D SER 245 D ASN 282 ? ;(chain 'D' and (resid 20 or (resid 21 and (name N or name CA or name C or name O or name CB )) or resid 22 through 47 or (resid 48 through 49 and (name N or name CA or name C or name O or name CB )) or resid 50 or (resid 51 and (name N or name CA or name C or name O or name CB )) or resid 52 through 77 or resid 79 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 116 or (resid 117 and (name N or name CA or name C or name O or name CB )) or resid 118 through 144 or (resid 145 and (name N or name CA or name C or name O or name CB or name CG )) or resid 146 through 153 or (resid 154 through 155 and (name N or name CA or name C or name O or name CB )) or resid 156 through 157 or (resid 158 and (name N or name CA or name C or name O or name CB )) or resid 159 through 162 or (resid 163 and (name N or name CA or name C or name O or name CB )) or resid 164 through 172 or (resid 173 through 176 and (name N or name CA or name C or name O or name CB )) or resid 178 through 183 or (resid 184 and (name N or name CA or name C or name O or name CB )) or resid 185 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB )) or resid 204 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 222 and (name N or name CA or name C or name O or name CB )) or resid 223 through 241 or (resid 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 263 or (resid 264 and (name N or name CA or name C or name O or name CB )) or resid 265 through 282)) ; # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 22GW _struct.title 'Crystal structure of the CJ1041C protein from Campylobacter jejuni in the apo form in space group P2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 22GW _struct_keywords.text 'Metal-binding protein, Ca2+, beta propeller, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 22GW _struct_ref.pdbx_db_accession 22GW _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 22GW A 1 ? 272 ? 22GW 12 ? 283 ? 12 283 2 1 22GW B 1 ? 272 ? 22GW 12 ? 283 ? 12 283 3 1 22GW C 1 ? 272 ? 22GW 12 ? 283 ? 12 283 4 1 22GW D 1 ? 272 ? 22GW 12 ? 283 ? 12 283 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 author_defined_assembly ? monomeric 1 3 author_defined_assembly ? monomeric 1 4 author_defined_assembly ? monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,E 2 1 B,F 3 1 C,G 4 1 D,H # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 149 ? GLY A 154 ? ASP A 160 GLY A 165 1 ? 6 HELX_P HELX_P2 AA2 ASP B 149 ? GLY B 154 ? ASP B 160 GLY B 165 1 ? 6 HELX_P HELX_P3 AA3 ARG B 163 ? LYS B 165 ? ARG B 174 LYS B 176 5 ? 3 HELX_P HELX_P4 AA4 ASP C 149 ? GLY C 154 ? ASP C 160 GLY C 165 1 ? 6 HELX_P HELX_P5 AA5 ARG C 163 ? LYS C 165 ? ARG C 174 LYS C 176 5 ? 3 HELX_P HELX_P6 AA6 ASP D 149 ? GLY D 154 ? ASP D 160 GLY D 165 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? AA3 ? 4 ? AA4 ? 4 ? AA5 ? 4 ? AA6 ? 4 ? AA7 ? 4 ? AA8 ? 4 ? AA9 ? 4 ? AB1 ? 4 ? AB2 ? 4 ? AB3 ? 4 ? AB4 ? 4 ? AB5 ? 4 ? AB6 ? 4 ? AB7 ? 4 ? AB8 ? 4 ? AB9 ? 4 ? AC1 ? 4 ? AC2 ? 4 ? AC3 ? 4 ? AC4 ? 4 ? AC5 ? 4 ? AC6 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA5 3 4 ? anti-parallel AA6 1 2 ? anti-parallel AA6 2 3 ? anti-parallel AA6 3 4 ? anti-parallel AA7 1 2 ? anti-parallel AA7 2 3 ? anti-parallel AA7 3 4 ? anti-parallel AA8 1 2 ? anti-parallel AA8 2 3 ? anti-parallel AA8 3 4 ? anti-parallel AA9 1 2 ? anti-parallel AA9 2 3 ? anti-parallel AA9 3 4 ? anti-parallel AB1 1 2 ? anti-parallel AB1 2 3 ? anti-parallel AB1 3 4 ? anti-parallel AB2 1 2 ? anti-parallel AB2 2 3 ? anti-parallel AB2 3 4 ? anti-parallel AB3 1 2 ? anti-parallel AB3 2 3 ? anti-parallel AB3 3 4 ? anti-parallel AB4 1 2 ? anti-parallel AB4 2 3 ? anti-parallel AB4 3 4 ? anti-parallel AB5 1 2 ? anti-parallel AB5 2 3 ? anti-parallel AB5 3 4 ? anti-parallel AB6 1 2 ? anti-parallel AB6 2 3 ? anti-parallel AB6 3 4 ? anti-parallel AB7 1 2 ? anti-parallel AB7 2 3 ? anti-parallel AB7 3 4 ? anti-parallel AB8 1 2 ? anti-parallel AB8 2 3 ? anti-parallel AB8 3 4 ? anti-parallel AB9 1 2 ? anti-parallel AB9 2 3 ? anti-parallel AB9 3 4 ? anti-parallel AC1 1 2 ? anti-parallel AC1 2 3 ? anti-parallel AC1 3 4 ? anti-parallel AC2 1 2 ? anti-parallel AC2 2 3 ? anti-parallel AC2 3 4 ? anti-parallel AC3 1 2 ? anti-parallel AC3 2 3 ? anti-parallel AC3 3 4 ? anti-parallel AC4 1 2 ? anti-parallel AC4 2 3 ? anti-parallel AC4 3 4 ? anti-parallel AC5 1 2 ? anti-parallel AC5 2 3 ? anti-parallel AC5 3 4 ? anti-parallel AC6 1 2 ? anti-parallel AC6 2 3 ? anti-parallel AC6 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 11 ? ASP A 15 ? TYR A 22 ASP A 26 AA1 2 LYS A 264 ? GLU A 269 ? LYS A 275 GLU A 280 AA1 3 ILE A 254 ? LYS A 259 ? ILE A 265 LYS A 270 AA1 4 PHE A 249 ? GLU A 251 ? PHE A 260 GLU A 262 AA2 1 PRO A 20 ? VAL A 25 ? PRO A 31 VAL A 36 AA2 2 VAL A 30 ? ASN A 34 ? VAL A 41 ASN A 45 AA2 3 GLY A 48 ? LEU A 53 ? GLY A 59 LEU A 64 AA2 4 VAL A 59 ? LEU A 68 ? VAL A 70 LEU A 79 AA3 1 PRO A 71 ? ILE A 77 ? PRO A 82 ILE A 88 AA3 2 THR A 80 ? ASP A 85 ? THR A 91 ASP A 96 AA3 3 VAL A 88 ? ASP A 93 ? VAL A 99 ASP A 104 AA3 4 GLU A 99 ? PRO A 104 ? GLU A 110 PRO A 115 AA4 1 LEU A 111 ? ASP A 118 ? LEU A 122 ASP A 129 AA4 2 THR A 121 ? ASP A 126 ? THR A 132 ASP A 137 AA4 3 LEU A 131 ? ASP A 136 ? LEU A 142 ASP A 147 AA4 4 GLN A 141 ? LYS A 147 ? GLN A 152 LYS A 158 AA5 1 GLY A 155 ? ASP A 162 ? GLY A 166 ASP A 173 AA5 2 LYS A 167 ? TYR A 173 ? LYS A 178 TYR A 184 AA5 3 GLY A 181 ? ASP A 187 ? GLY A 192 ASP A 198 AA5 4 LEU A 193 ? GLU A 201 ? LEU A 204 GLU A 212 AA6 1 TYR A 203 ? TYR A 209 ? TYR A 214 TYR A 220 AA6 2 GLY A 212 ? ASN A 220 ? GLY A 223 ASN A 231 AA6 3 ASN A 223 ? LEU A 229 ? ASN A 234 LEU A 240 AA6 4 SER A 234 ? LYS A 236 ? SER A 245 LYS A 247 AA7 1 TYR B 11 ? ASP B 15 ? TYR B 22 ASP B 26 AA7 2 LYS B 264 ? GLU B 269 ? LYS B 275 GLU B 280 AA7 3 ILE B 254 ? LYS B 259 ? ILE B 265 LYS B 270 AA7 4 PHE B 249 ? GLU B 251 ? PHE B 260 GLU B 262 AA8 1 PRO B 20 ? VAL B 25 ? PRO B 31 VAL B 36 AA8 2 VAL B 30 ? ASN B 34 ? VAL B 41 ASN B 45 AA8 3 GLY B 48 ? LEU B 53 ? GLY B 59 LEU B 64 AA8 4 VAL B 59 ? LEU B 68 ? VAL B 70 LEU B 79 AA9 1 PRO B 71 ? ILE B 77 ? PRO B 82 ILE B 88 AA9 2 THR B 80 ? ASP B 85 ? THR B 91 ASP B 96 AA9 3 VAL B 88 ? ASP B 93 ? VAL B 99 ASP B 104 AA9 4 GLU B 99 ? PRO B 104 ? GLU B 110 PRO B 115 AB1 1 LEU B 111 ? ASP B 118 ? LEU B 122 ASP B 129 AB1 2 THR B 121 ? ASP B 126 ? THR B 132 ASP B 137 AB1 3 LEU B 131 ? ASP B 136 ? LEU B 142 ASP B 147 AB1 4 GLN B 141 ? LYS B 147 ? GLN B 152 LYS B 158 AB2 1 GLY B 155 ? ASP B 162 ? GLY B 166 ASP B 173 AB2 2 LYS B 167 ? TYR B 173 ? LYS B 178 TYR B 184 AB2 3 GLY B 181 ? ASP B 187 ? GLY B 192 ASP B 198 AB2 4 LEU B 193 ? GLU B 201 ? LEU B 204 GLU B 212 AB3 1 TYR B 203 ? TYR B 209 ? TYR B 214 TYR B 220 AB3 2 GLY B 212 ? ASN B 220 ? GLY B 223 ASN B 231 AB3 3 ASN B 223 ? LEU B 229 ? ASN B 234 LEU B 240 AB3 4 SER B 234 ? LYS B 236 ? SER B 245 LYS B 247 AB4 1 LYS C 10 ? PHE C 14 ? LYS C 21 PHE C 25 AB4 2 LYS C 264 ? GLU C 269 ? LYS C 275 GLU C 280 AB4 3 ILE C 254 ? LYS C 259 ? ILE C 265 LYS C 270 AB4 4 PHE C 249 ? GLU C 251 ? PHE C 260 GLU C 262 AB5 1 PRO C 20 ? VAL C 25 ? PRO C 31 VAL C 36 AB5 2 VAL C 30 ? ASN C 34 ? VAL C 41 ASN C 45 AB5 3 GLY C 48 ? LEU C 53 ? GLY C 59 LEU C 64 AB5 4 VAL C 59 ? LEU C 68 ? VAL C 70 LEU C 79 AB6 1 PRO C 71 ? ILE C 77 ? PRO C 82 ILE C 88 AB6 2 THR C 80 ? ASP C 85 ? THR C 91 ASP C 96 AB6 3 VAL C 88 ? ASP C 93 ? VAL C 99 ASP C 104 AB6 4 GLU C 99 ? PRO C 104 ? GLU C 110 PRO C 115 AB7 1 LEU C 111 ? ASP C 118 ? LEU C 122 ASP C 129 AB7 2 THR C 121 ? ASP C 126 ? THR C 132 ASP C 137 AB7 3 LEU C 131 ? ASP C 136 ? LEU C 142 ASP C 147 AB7 4 GLN C 141 ? LYS C 147 ? GLN C 152 LYS C 158 AB8 1 GLY C 155 ? LEU C 161 ? GLY C 166 LEU C 172 AB8 2 LYS C 167 ? TYR C 173 ? LYS C 178 TYR C 184 AB8 3 GLY C 181 ? ASP C 187 ? GLY C 192 ASP C 198 AB8 4 GLU C 192 ? GLU C 201 ? GLU C 203 GLU C 212 AB9 1 TYR C 203 ? TYR C 209 ? TYR C 214 TYR C 220 AB9 2 GLY C 212 ? ASN C 220 ? GLY C 223 ASN C 231 AB9 3 ASN C 223 ? LEU C 229 ? ASN C 234 LEU C 240 AB9 4 VAL C 235 ? LYS C 236 ? VAL C 246 LYS C 247 AC1 1 TYR D 11 ? ASP D 15 ? TYR D 22 ASP D 26 AC1 2 LYS D 264 ? GLU D 269 ? LYS D 275 GLU D 280 AC1 3 ILE D 254 ? LYS D 259 ? ILE D 265 LYS D 270 AC1 4 PHE D 249 ? GLU D 251 ? PHE D 260 GLU D 262 AC2 1 PRO D 20 ? VAL D 25 ? PRO D 31 VAL D 36 AC2 2 VAL D 30 ? ASN D 34 ? VAL D 41 ASN D 45 AC2 3 GLY D 48 ? LEU D 53 ? GLY D 59 LEU D 64 AC2 4 VAL D 59 ? LEU D 68 ? VAL D 70 LEU D 79 AC3 1 PRO D 71 ? ILE D 77 ? PRO D 82 ILE D 88 AC3 2 THR D 80 ? ASP D 85 ? THR D 91 ASP D 96 AC3 3 VAL D 88 ? ASP D 93 ? VAL D 99 ASP D 104 AC3 4 GLU D 99 ? PRO D 104 ? GLU D 110 PRO D 115 AC4 1 LEU D 111 ? ASP D 118 ? LEU D 122 ASP D 129 AC4 2 THR D 121 ? ASP D 126 ? THR D 132 ASP D 137 AC4 3 LEU D 131 ? ASP D 136 ? LEU D 142 ASP D 147 AC4 4 GLN D 141 ? LYS D 147 ? GLN D 152 LYS D 158 AC5 1 GLY D 155 ? ASP D 162 ? GLY D 166 ASP D 173 AC5 2 LYS D 167 ? TYR D 173 ? LYS D 178 TYR D 184 AC5 3 GLY D 181 ? ASP D 187 ? GLY D 192 ASP D 198 AC5 4 LEU D 193 ? GLU D 201 ? LEU D 204 GLU D 212 AC6 1 TYR D 203 ? TYR D 209 ? TYR D 214 TYR D 220 AC6 2 GLY D 212 ? ASN D 220 ? GLY D 223 ASN D 231 AC6 3 ASN D 223 ? LEU D 229 ? ASN D 234 LEU D 240 AC6 4 VAL D 235 ? LYS D 236 ? VAL D 246 LYS D 247 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLN A 12 ? N GLN A 23 O LYS A 267 ? O LYS A 278 AA1 2 3 O VAL A 268 ? O VAL A 279 N LEU A 255 ? N LEU A 266 AA1 3 4 O TRP A 256 ? O TRP A 267 N PHE A 249 ? N PHE A 260 AA2 1 2 N PHE A 24 ? N PHE A 35 O TYR A 31 ? O TYR A 42 AA2 2 3 N VAL A 30 ? N VAL A 41 O LEU A 53 ? O LEU A 64 AA2 3 4 N ILE A 50 ? N ILE A 61 O LEU A 65 ? O LEU A 76 AA3 1 2 N MET A 75 ? N MET A 86 O TYR A 82 ? O TYR A 93 AA3 2 3 N VAL A 83 ? N VAL A 94 O ARG A 90 ? O ARG A 101 AA3 3 4 N LEU A 89 ? N LEU A 100 O LEU A 103 ? O LEU A 114 AA4 1 2 N GLU A 115 ? N GLU A 126 O LEU A 123 ? O LEU A 134 AA4 2 3 N VAL A 124 ? N VAL A 135 O LEU A 133 ? O LEU A 144 AA4 3 4 N ILE A 132 ? N ILE A 143 O LEU A 145 ? O LEU A 156 AA5 1 2 N TYR A 160 ? N TYR A 171 O PHE A 169 ? O PHE A 180 AA5 2 3 N ILE A 170 ? N ILE A 181 O MET A 184 ? O MET A 195 AA5 3 4 N GLY A 181 ? N GLY A 192 O GLU A 201 ? O GLU A 212 AA6 1 2 N VAL A 207 ? N VAL A 218 O LEU A 214 ? O LEU A 225 AA6 2 3 N VAL A 215 ? N VAL A 226 O TYR A 227 ? O TYR A 238 AA6 3 4 N ASN A 228 ? N ASN A 239 O VAL A 235 ? O VAL A 246 AA7 1 2 N PHE B 14 ? N PHE B 25 O ILE B 265 ? O ILE B 276 AA7 2 3 O LYS B 264 ? O LYS B 275 N LYS B 259 ? N LYS B 270 AA7 3 4 O TRP B 256 ? O TRP B 267 N PHE B 249 ? N PHE B 260 AA8 1 2 N PHE B 24 ? N PHE B 35 O TYR B 31 ? O TYR B 42 AA8 2 3 N VAL B 30 ? N VAL B 41 O LEU B 53 ? O LEU B 64 AA8 3 4 N LYS B 52 ? N LYS B 63 O GLU B 61 ? O GLU B 72 AA9 1 2 N MET B 75 ? N MET B 86 O TYR B 82 ? O TYR B 93 AA9 2 3 N VAL B 83 ? N VAL B 94 O ARG B 90 ? O ARG B 101 AA9 3 4 N LEU B 89 ? N LEU B 100 O LEU B 103 ? O LEU B 114 AB1 1 2 N GLU B 115 ? N GLU B 126 O LEU B 123 ? O LEU B 134 AB1 2 3 N VAL B 124 ? N VAL B 135 O LEU B 133 ? O LEU B 144 AB1 3 4 N ILE B 132 ? N ILE B 143 O LEU B 145 ? O LEU B 156 AB2 1 2 N TYR B 160 ? N TYR B 171 O PHE B 169 ? O PHE B 180 AB2 2 3 N ILE B 170 ? N ILE B 181 O MET B 184 ? O MET B 195 AB2 3 4 N GLY B 181 ? N GLY B 192 O GLU B 201 ? O GLU B 212 AB3 1 2 N TYR B 209 ? N TYR B 220 O GLY B 212 ? O GLY B 223 AB3 2 3 N VAL B 215 ? N VAL B 226 O TYR B 227 ? O TYR B 238 AB3 3 4 N ASN B 228 ? N ASN B 239 O VAL B 235 ? O VAL B 246 AB4 1 2 N LYS C 10 ? N LYS C 21 O GLU C 269 ? O GLU C 280 AB4 2 3 O LYS C 264 ? O LYS C 275 N LYS C 259 ? N LYS C 270 AB4 3 4 O TRP C 256 ? O TRP C 267 N PHE C 249 ? N PHE C 260 AB5 1 2 N PHE C 24 ? N PHE C 35 O TYR C 31 ? O TYR C 42 AB5 2 3 N ASN C 34 ? N ASN C 45 O PHE C 49 ? O PHE C 60 AB5 3 4 N LYS C 52 ? N LYS C 63 O LEU C 60 ? O LEU C 71 AB6 1 2 N MET C 75 ? N MET C 86 O TYR C 82 ? O TYR C 93 AB6 2 3 N VAL C 83 ? N VAL C 94 O ARG C 90 ? O ARG C 101 AB6 3 4 N LEU C 89 ? N LEU C 100 O LEU C 103 ? O LEU C 114 AB7 1 2 N GLU C 115 ? N GLU C 126 O LEU C 123 ? O LEU C 134 AB7 2 3 N VAL C 124 ? N VAL C 135 O LEU C 133 ? O LEU C 144 AB7 3 4 N ILE C 132 ? N ILE C 143 O LEU C 145 ? O LEU C 156 AB8 1 2 N TYR C 160 ? N TYR C 171 O PHE C 169 ? O PHE C 180 AB8 2 3 N ILE C 170 ? N ILE C 181 O MET C 184 ? O MET C 195 AB8 3 4 N GLY C 181 ? N GLY C 192 O GLU C 201 ? O GLU C 212 AB9 1 2 N TYR C 209 ? N TYR C 220 O GLY C 212 ? O GLY C 223 AB9 2 3 N VAL C 215 ? N VAL C 226 O TYR C 227 ? O TYR C 238 AB9 3 4 N ASN C 228 ? N ASN C 239 O VAL C 235 ? O VAL C 246 AC1 1 2 N GLN D 12 ? N GLN D 23 O LYS D 267 ? O LYS D 278 AC1 2 3 O LYS D 264 ? O LYS D 275 N LYS D 259 ? N LYS D 270 AC1 3 4 O TRP D 256 ? O TRP D 267 N PHE D 249 ? N PHE D 260 AC2 1 2 N PHE D 24 ? N PHE D 35 O TYR D 31 ? O TYR D 42 AC2 2 3 N VAL D 30 ? N VAL D 41 O LEU D 53 ? O LEU D 64 AC2 3 4 N LYS D 52 ? N LYS D 63 O LEU D 60 ? O LEU D 71 AC3 1 2 N MET D 75 ? N MET D 86 O TYR D 82 ? O TYR D 93 AC3 2 3 N ASP D 85 ? N ASP D 96 O VAL D 88 ? O VAL D 99 AC3 3 4 N GLY D 91 ? N GLY D 102 O ILE D 100 ? O ILE D 111 AC4 1 2 N GLU D 115 ? N GLU D 126 O LEU D 123 ? O LEU D 134 AC4 2 3 N LEU D 122 ? N LEU D 133 O VAL D 135 ? O VAL D 146 AC4 3 4 N ASP D 136 ? N ASP D 147 O GLN D 141 ? O GLN D 152 AC5 1 2 N TYR D 160 ? N TYR D 171 O PHE D 169 ? O PHE D 180 AC5 2 3 N ILE D 170 ? N ILE D 181 O MET D 184 ? O MET D 195 AC5 3 4 N GLY D 181 ? N GLY D 192 O GLU D 201 ? O GLU D 212 AC6 1 2 N TYR D 209 ? N TYR D 220 O GLY D 212 ? O GLY D 223 AC6 2 3 N VAL D 215 ? N VAL D 226 O TYR D 227 ? O TYR D 238 AC6 3 4 N ASN D 228 ? N ASN D 239 O VAL D 235 ? O VAL D 246 # _pdbx_entry_details.entry_id 22GW _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 37 ? ? -105.67 -161.51 2 1 LYS A 74 ? ? -112.32 72.91 3 1 ASN A 80 ? ? -89.89 -71.52 4 1 LYS A 83 ? ? -131.98 -113.64 5 1 ILE A 97 ? ? 71.43 -71.48 6 1 ASN A 123 ? ? -127.41 -62.65 7 1 ASN A 168 ? ? -121.96 -91.62 8 1 VAL A 189 ? ? -132.64 -33.65 9 1 ASP A 215 ? ? -139.83 -91.14 10 1 LYS A 221 ? ? 51.58 -122.87 11 1 ALA A 257 ? ? -106.66 -122.23 12 1 ASP B 37 ? ? -104.18 -162.17 13 1 ASN B 57 ? ? 58.44 16.93 14 1 LYS B 74 ? ? -112.00 73.36 15 1 ASN B 80 ? ? -87.98 -72.06 16 1 LYS B 83 ? ? -131.93 -112.26 17 1 ILE B 97 ? ? 71.92 -72.62 18 1 ASN B 123 ? ? -125.31 -63.59 19 1 ASN B 168 ? ? -120.91 -91.73 20 1 VAL B 189 ? ? -134.66 -32.77 21 1 ASP B 215 ? ? -140.16 -91.55 22 1 LYS B 221 ? ? 52.77 -122.71 23 1 ALA B 257 ? ? -108.41 -121.72 24 1 ASP C 37 ? ? -103.99 -161.39 25 1 LYS C 74 ? ? -112.59 72.94 26 1 THR C 77 ? ? -121.82 -169.30 27 1 ASN C 80 ? ? -92.06 -69.74 28 1 LYS C 83 ? ? -128.51 -114.46 29 1 ILE C 97 ? ? 70.00 -72.53 30 1 ASN C 123 ? ? -126.91 -63.07 31 1 ASN C 168 ? ? -120.61 -92.24 32 1 VAL C 189 ? ? -133.73 -31.19 33 1 ASP C 215 ? ? -138.55 -91.71 34 1 LYS C 221 ? ? 52.07 -123.13 35 1 ALA C 257 ? ? -106.67 -119.57 36 1 ASP D 37 ? ? -106.03 -161.54 37 1 ASN D 57 ? ? 57.21 19.91 38 1 LYS D 74 ? ? -110.53 75.28 39 1 THR D 77 ? ? -123.40 -157.58 40 1 ASN D 80 ? ? -94.17 -71.06 41 1 LYS D 83 ? ? -130.23 -113.79 42 1 ILE D 97 ? ? 71.58 -73.89 43 1 ASN D 123 ? ? -125.59 -62.20 44 1 ASN D 168 ? ? -120.71 -90.33 45 1 VAL D 189 ? ? -133.47 -32.40 46 1 ASP D 215 ? ? -139.11 -90.56 47 1 LYS D 221 ? ? 52.54 -124.07 48 1 SER D 245 ? ? -168.82 109.49 49 1 ALA D 257 ? ? -107.47 -119.16 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id D _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 398 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id H _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -x,y,-z # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 7.8229657342 49.948731294 47.3878505749 1.00953689118 ? 0.0122128226619 ? 0.177707335902 ? 0.278990906611 ? -0.0238557000379 ? 0.341198528784 ? 1.2348912968 ? -0.0240895733873 ? -1.32730715483 ? 0.347039830073 ? 0.301107563279 ? 1.97792516761 ? 0.357427789119 ? 0.181170347741 ? 0.359687230061 ? 0.1088770782 ? 0.0074133004316 ? 0.145271209495 ? -0.867702246642 ? -0.117426394121 ? -0.247484797888 ? 2 'X-RAY DIFFRACTION' ? refined 58.2804080277 5.66735276279 49.8405219329 0.874875432712 ? 0.0754119539893 ? 0.23079792479 ? 0.366697704106 ? 0.0723198630904 ? 0.397059956818 ? 3.10481437968 ? -1.13409048476 ? -1.01720219676 ? 1.94925983229 ? 0.940585726776 ? 2.19010449564 ? -0.0495060087787 ? 0.0311623793371 ? -0.183599343886 ? 0.344508812869 ? 0.00918727830434 ? -0.182580955281 ? -0.0348381815184 ? 0.0505239939287 ? 0.0489137614017 ? 3 'X-RAY DIFFRACTION' ? refined 54.9303270521 16.0043850507 48.2294175006 0.875276059511 ? 0.048916461308 ? 0.232820448116 ? 0.3513049713 ? 0.0735696259518 ? 0.397843261564 ? 1.66033175547 ? -0.457397500188 ? 0.472892873778 ? 1.66349282538 ? -0.518558110722 ? 2.06092307874 ? -0.012845530544 ? 0.0747913071976 ? 0.176520700761 ? 0.195561989748 ? -0.0258023793268 ? -0.046316698585 ? -0.188891247173 ? 0.00910441158315 ? 0.0244511869362 ? 4 'X-RAY DIFFRACTION' ? refined 40.4023670737 11.9713812325 38.7193264256 0.93767569192 ? 0.0991793554507 ? 0.212711718034 ? 0.47999545645 ? 0.133732282272 ? 0.477900991013 ? 3.26875025718 ? 0.850409692785 ? 1.64937936252 ? 3.75311089838 ? -1.21825930373 ? 2.0216708698 ? -0.148166576853 ? 0.439643321935 ? 0.240557227081 ? -0.664433580274 ? 0.0635293332637 ? 0.178058435573 ? -0.0821440764723 ? -0.272029974945 ? 0.0659119712148 ? 5 'X-RAY DIFFRACTION' ? refined 48.6520926128 -3.29213099554 40.825605795 1.00733838658 ? 0.0386499043627 ? 0.196207981152 ? 0.341030464139 ? 0.0349741236995 ? 0.401364894363 ? 3.82766202791 ? -0.221058976692 ? 1.15220895528 ? 1.27469883727 ? -0.614581480281 ? 2.79409478019 ? 0.0770648505223 ? 0.14429060854 ? -0.354814321223 ? -0.145914682304 ? 0.0539075039227 ? 0.0920448612677 ? 0.305255360179 ? -0.162314468725 ? -0.12377698779 ? 6 'X-RAY DIFFRACTION' ? refined 57.4405457022 38.896564561 9.6746917079 0.146793989555 ? 0.0542643108086 ? -0.00603432224593 ? 0.18822472798 ? -0.0040423497601 ? 0.170912181012 ? 1.87218449065 ? 0.878897770719 ? -0.337348040852 ? 3.04624963853 ? -0.755136129571 ? 2.26012743419 ? -0.0708378237913 ? -0.111661431521 ? 0.0733538839082 ? 0.142127588064 ? 0.0679257889267 ? 0.208976956456 ? -0.221191241612 ? -0.265168066904 ? 0.00692647673929 ? 7 'X-RAY DIFFRACTION' ? refined 72.8844093164 45.4046760384 13.1569677262 0.236131286197 ? -0.0411462665954 ? -0.0535042320488 ? 0.18359723841 ? -0.0119301936495 ? 0.263751336168 ? 2.35262188279 ? -0.763350670627 ? -0.0827867764202 ? 3.64438672056 ? -0.328918818713 ? 2.59783802311 ? -0.150642805548 ? -0.103939613817 ? 0.147504398236 ? 0.323944960157 ? 0.0635219280407 ? -0.534832629924 ? -0.293846709087 ? 0.291778989835 ? 0.0791493168546 ? 8 'X-RAY DIFFRACTION' ? refined 75.5522467661 28.4323775929 18.4693725952 0.20472392806 ? 0.0243793685494 ? -0.0854909013933 ? 0.228894298507 ? 0.014099290734 ? 0.272236220448 ? 5.66916685626 ? 0.776717553943 ? 0.278278542811 ? 3.80397577738 ? -0.414257738492 ? 1.56529539674 ? -0.086715989953 ? -0.183726432371 ? 0.070298801193 ? 0.355674101804 ? -0.03819536456 ? -0.631277444207 ? -0.0322263896389 ? 0.338099314146 ? 0.0988263122593 ? 9 'X-RAY DIFFRACTION' ? refined 60.2234268695 23.3828806098 15.411162762 0.154527783105 ? 0.00998515152649 ? -0.0179036284542 ? 0.161160602281 ? 0.0222168088752 ? 0.147344708146 ? 2.55986485253 ? -0.477342082128 ? -0.807212530323 ? 4.41193249521 ? 0.626935963231 ? 4.63629530339 ? -0.0323277549055 ? -0.175740829487 ? -0.134432869023 ? 0.341367436424 ? 0.0966755675408 ? 0.136066965159 ? 0.21268875077 ? -0.0265772922006 ? -0.0465241586024 ? 10 'X-RAY DIFFRACTION' ? refined 31.9110658048 17.2542524327 7.98171956735 0.102290929413 ? -0.00226081653996 ? 0.00852892382625 ? 0.225966281227 ? 0.0132570292719 ? 0.224629654417 ? 1.58982123645 ? 0.117079208896 ? 0.377583189447 ? 2.94950988047 ? 1.3908602419 ? 2.93190286779 ? -0.0101044069648 ? -0.0502466968484 ? 0.225178069055 ? -0.220742073573 ? 0.0916255859392 ? -0.166713745023 ? -0.168645564322 ? 0.23744687054 ? -0.0968773087119 ? 11 'X-RAY DIFFRACTION' ? refined 26.0614708704 6.89572148654 2.93117914437 0.133194573144 ? 0.012268566091 ? 0.0520313304401 ? 0.113408203636 ? 0.0063126507921 ? 0.136545934852 ? 5.38093152657 ? 0.800914225443 ? 2.22986394579 ? 3.54966696431 ? 0.884176961979 ? 4.66354814335 ? -0.0817099254049 ? 0.0165551636032 ? 0.040703076645 ? -0.180520319048 ? 0.00251096836738 ? 0.195498767867 ? 0.186067037454 ? -0.00598472805195 ? 0.0986598095274 ? 12 'X-RAY DIFFRACTION' ? refined 27.362318752 1.05886617111 7.76771606837 0.144783788024 ? 0.0306201485684 ? 0.00914857916418 ? 0.146276236845 ? 0.00869198423774 ? 0.16921406877 ? 2.33106020779 ? 1.18067229236 ? -1.41262059796 ? 3.14336162187 ? -0.273978310555 ? 2.04671091197 ? -0.163364069885 ? -0.147309512241 ? -0.156869794706 ? -0.099915935352 ? 0.0464810919437 ? -0.221566048388 ? 0.229180699792 ? 0.150667934523 ? 0.114416934759 ? 13 'X-RAY DIFFRACTION' ? refined 16.0301102283 -1.31302638826 19.5929132274 0.23783106037 ? 0.00436002592741 ? 0.0921880541156 ? 0.193326667976 ? 0.0490580744359 ? 0.257970636835 ? 2.02802604827 ? -0.950031002295 ? -0.155841305504 ? 6.39288710605 ? -0.237133543407 ? 3.46171102248 ? -0.226873354952 ? -0.187673678317 ? -0.314413858543 ? 0.322372577105 ? 0.155810616328 ? 0.275026983289 ? 0.394219675765 ? -0.181316720035 ? 0.0686118007628 ? 14 'X-RAY DIFFRACTION' ? refined 14.589531165 10.8832978845 23.5356406599 0.177023849443 ? 0.0277327149689 ? 0.0676539310954 ? 0.124320152355 ? 0.0478170514958 ? 0.193544675842 ? 6.76146444939 ? -0.462087981389 ? 1.64335286736 ? 6.13820191082 ? 1.08194544272 ? 6.26500358406 ? 0.032644830674 ? -0.275607523915 ? -0.09599535383 ? 0.329628619094 ? 0.127823081193 ? 0.290562839098 ? 0.165709492415 ? -0.0203119010224 ? -0.184513490336 ? 15 'X-RAY DIFFRACTION' ? refined 10.2147409798 12.9099545659 21.1136073494 0.199561399516 ? 0.0615293166361 ? 0.0682118050408 ? 0.20408888799 ? -0.00275252559158 ? 0.253480198813 ? 4.80602478635 ? -0.240509987228 ? 2.22550393639 ? 8.16324908339 ? -2.57990973736 ? 5.77284617785 ? 0.132239706569 ? -0.0509468627694 ? -0.0849090348708 ? 0.432239942169 ? 0.189449868857 ? 0.755904691693 ? 0.00515575148303 ? 0.0421387279171 ? -0.330054586297 ? 16 'X-RAY DIFFRACTION' ? refined 17.9355892219 19.6358617238 21.7714255434 0.237933757922 ? 0.0500790583623 ? -0.00482323502166 ? 0.144114604322 ? -0.00668599690646 ? 0.146848322028 ? 5.95802731514 ? -0.273017735426 ? -1.02579709495 ? 4.15688273227 ? -1.31928931375 ? 4.16540698353 ? -0.0984319036319 ? -0.181285746152 ? 0.14121767184 ? 0.332794962739 ? 0.0924407250038 ? 0.155769335012 ? -0.403168855148 ? -0.0298822218322 ? 0.0398870895347 ? 17 'X-RAY DIFFRACTION' ? refined 26.0293671467 22.2630894258 14.2987259447 0.16245617694 ? 0.0103536190328 ? -0.0102033834123 ? 0.116667481476 ? -0.0115559899655 ? 0.159568158955 ? 2.21660268079 ? -0.448753010155 ? -0.593832435583 ? 3.16124629953 ? 0.417062637319 ? 4.4481723926 ? -0.0602002614536 ? -0.112053763926 ? 0.229899442043 ? 0.257046537951 ? 0.0748062471433 ? -0.033593151927 ? -0.36683886151 ? 0.0424597953508 ? -0.0263086480115 ? 18 'X-RAY DIFFRACTION' ? refined 3.99366649031 38.7942016384 55.8222573836 0.731016898989 ? -0.0135592577924 ? 0.194459026359 ? 0.343101778476 ? -0.0245706925191 ? 0.296283262823 ? 1.57116508912 ? -0.428358633027 ? 0.2950995093 ? 1.9135441624 ? -0.648944760388 ? 3.07420988198 ? -0.00477640055142 ? -0.0135135548059 ? 0.117724671412 ? 0.350925807904 ? 0.00237460337535 ? -0.040404538306 ? -0.545511568187 ? -0.352424744512 ? -0.0284219785235 ? 19 'X-RAY DIFFRACTION' ? refined 11.6978836976 29.8934221049 48.0551357898 0.619360808667 ? -0.042621520621 ? 0.163114432999 ? 0.27446114468 ? -0.0435613281061 ? 0.321810941 ? 2.04229941101 ? -0.49750209003 ? -1.00686993223 ? 2.23421816124 ? 0.364124259789 ? 2.98221550279 ? -0.0983859981141 ? -0.000150959191905 ? -0.1717862237 ? -0.100852860801 ? 0.0724973224232 ? -0.174683244453 ? 0.140144585575 ? 0.173097524718 ? 0.0263337883844 ? 20 'X-RAY DIFFRACTION' ? refined 19.8841925482 44.0912876141 41.4583174253 0.879992704659 ? -0.20261948076 ? 0.261663573564 ? 0.449524093851 ? -0.107518919067 ? 0.435180851161 ? 3.29854199992 ? 0.356272653475 ? -1.29159251897 ? 4.54309718733 ? -0.399136100653 ? 3.78064375924 ? 0.394261699438 ? -0.153340123771 ? 0.055492179328 ? -0.594041011855 ? 0.121024216092 ? -1.07674883176 ? -1.12498763546 ? 0.686241333926 ? -0.362304467174 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 229 through 282 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 19 through 59 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 60 through 124 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 125 through 182 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 183 through 282 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? ? ? ? ? ? ? ? ? ? ;chain 'D' and (resid 18 through 104 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? ? ? ? ? ? ? ? ? ? ;chain 'D' and (resid 105 through 158 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? ? ? ? ? ? ? ? ? ? ;chain 'D' and (resid 159 through 228 ) ; 9 'X-RAY DIFFRACTION' 9 ? ? ? ? ? ? ? ? ? ? ? ;chain 'D' and (resid 229 through 282 ) ; 10 'X-RAY DIFFRACTION' 10 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 19 through 36 ) ; 11 'X-RAY DIFFRACTION' 11 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 37 through 59 ) ; 12 'X-RAY DIFFRACTION' 12 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 60 through 124 ) ; 13 'X-RAY DIFFRACTION' 13 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 125 through 158 ) ; 14 'X-RAY DIFFRACTION' 14 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 159 through 182 ) ; 15 'X-RAY DIFFRACTION' 15 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 183 through 203 ) ; 16 'X-RAY DIFFRACTION' 16 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 204 through 228 ) ; 17 'X-RAY DIFFRACTION' 17 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 229 through 282 ) ; 18 'X-RAY DIFFRACTION' 18 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 20 through 59 ) ; 19 'X-RAY DIFFRACTION' 19 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 60 through 182 ) ; 20 'X-RAY DIFFRACTION' 20 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 183 through 228 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 12 ? A GLY 1 2 1 Y 1 A SER 13 ? A SER 2 3 1 Y 1 A ALA 14 ? A ALA 3 4 1 Y 1 A LYS 15 ? A LYS 4 5 1 Y 1 A ASP 16 ? A ASP 5 6 1 Y 1 A PRO 17 ? A PRO 6 7 1 Y 1 A SER 18 ? A SER 7 8 1 Y 1 A LYS 283 ? A LYS 272 9 1 Y 1 B GLY 12 ? B GLY 1 10 1 Y 1 B SER 13 ? B SER 2 11 1 Y 1 B ALA 14 ? B ALA 3 12 1 Y 1 B LYS 15 ? B LYS 4 13 1 Y 1 B ASP 16 ? B ASP 5 14 1 Y 1 B PRO 17 ? B PRO 6 15 1 Y 1 B SER 18 ? B SER 7 16 1 Y 1 B GLU 19 ? B GLU 8 17 1 Y 1 B LYS 283 ? B LYS 272 18 1 Y 1 C GLY 12 ? C GLY 1 19 1 Y 1 C SER 13 ? C SER 2 20 1 Y 1 C ALA 14 ? C ALA 3 21 1 Y 1 C LYS 15 ? C LYS 4 22 1 Y 1 C ASP 16 ? C ASP 5 23 1 Y 1 C PRO 17 ? C PRO 6 24 1 Y 1 C SER 18 ? C SER 7 25 1 Y 1 C ASN 242 ? C ASN 231 26 1 Y 1 C VAL 243 ? C VAL 232 27 1 Y 1 C LYS 244 ? C LYS 233 28 1 Y 1 C LYS 283 ? C LYS 272 29 1 Y 1 D GLY 12 ? D GLY 1 30 1 Y 1 D SER 13 ? D SER 2 31 1 Y 1 D ALA 14 ? D ALA 3 32 1 Y 1 D LYS 15 ? D LYS 4 33 1 Y 1 D ASP 16 ? D ASP 5 34 1 Y 1 D PRO 17 ? D PRO 6 35 1 Y 1 D ASN 242 ? D ASN 231 36 1 Y 1 D VAL 243 ? D VAL 232 37 1 Y 1 D LYS 283 ? D LYS 272 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 THR N N N N 290 THR CA C N S 291 THR C C N N 292 THR O O N N 293 THR CB C N R 294 THR OG1 O N N 295 THR CG2 C N N 296 THR OXT O N N 297 THR H H N N 298 THR H2 H N N 299 THR HA H N N 300 THR HB H N N 301 THR HG1 H N N 302 THR HG21 H N N 303 THR HG22 H N N 304 THR HG23 H N N 305 THR HXT H N N 306 TRP N N N N 307 TRP CA C N S 308 TRP C C N N 309 TRP O O N N 310 TRP CB C N N 311 TRP CG C Y N 312 TRP CD1 C Y N 313 TRP CD2 C Y N 314 TRP NE1 N Y N 315 TRP CE2 C Y N 316 TRP CE3 C Y N 317 TRP CZ2 C Y N 318 TRP CZ3 C Y N 319 TRP CH2 C Y N 320 TRP OXT O N N 321 TRP H H N N 322 TRP H2 H N N 323 TRP HA H N N 324 TRP HB2 H N N 325 TRP HB3 H N N 326 TRP HD1 H N N 327 TRP HE1 H N N 328 TRP HE3 H N N 329 TRP HZ2 H N N 330 TRP HZ3 H N N 331 TRP HH2 H N N 332 TRP HXT H N N 333 TYR N N N N 334 TYR CA C N S 335 TYR C C N N 336 TYR O O N N 337 TYR CB C N N 338 TYR CG C Y N 339 TYR CD1 C Y N 340 TYR CD2 C Y N 341 TYR CE1 C Y N 342 TYR CE2 C Y N 343 TYR CZ C Y N 344 TYR OH O N N 345 TYR OXT O N N 346 TYR H H N N 347 TYR H2 H N N 348 TYR HA H N N 349 TYR HB2 H N N 350 TYR HB3 H N N 351 TYR HD1 H N N 352 TYR HD2 H N N 353 TYR HE1 H N N 354 TYR HE2 H N N 355 TYR HH H N N 356 TYR HXT H N N 357 VAL N N N N 358 VAL CA C N S 359 VAL C C N N 360 VAL O O N N 361 VAL CB C N N 362 VAL CG1 C N N 363 VAL CG2 C N N 364 VAL OXT O N N 365 VAL H H N N 366 VAL H2 H N N 367 VAL HA H N N 368 VAL HB H N N 369 VAL HG11 H N N 370 VAL HG12 H N N 371 VAL HG13 H N N 372 VAL HG21 H N N 373 VAL HG22 H N N 374 VAL HG23 H N N 375 VAL HXT H N N 376 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TRP N CA sing N N 293 TRP N H sing N N 294 TRP N H2 sing N N 295 TRP CA C sing N N 296 TRP CA CB sing N N 297 TRP CA HA sing N N 298 TRP C O doub N N 299 TRP C OXT sing N N 300 TRP CB CG sing N N 301 TRP CB HB2 sing N N 302 TRP CB HB3 sing N N 303 TRP CG CD1 doub Y N 304 TRP CG CD2 sing Y N 305 TRP CD1 NE1 sing Y N 306 TRP CD1 HD1 sing N N 307 TRP CD2 CE2 doub Y N 308 TRP CD2 CE3 sing Y N 309 TRP NE1 CE2 sing Y N 310 TRP NE1 HE1 sing N N 311 TRP CE2 CZ2 sing Y N 312 TRP CE3 CZ3 doub Y N 313 TRP CE3 HE3 sing N N 314 TRP CZ2 CH2 doub Y N 315 TRP CZ2 HZ2 sing N N 316 TRP CZ3 CH2 sing Y N 317 TRP CZ3 HZ3 sing N N 318 TRP CH2 HH2 sing N N 319 TRP OXT HXT sing N N 320 TYR N CA sing N N 321 TYR N H sing N N 322 TYR N H2 sing N N 323 TYR CA C sing N N 324 TYR CA CB sing N N 325 TYR CA HA sing N N 326 TYR C O doub N N 327 TYR C OXT sing N N 328 TYR CB CG sing N N 329 TYR CB HB2 sing N N 330 TYR CB HB3 sing N N 331 TYR CG CD1 doub Y N 332 TYR CG CD2 sing Y N 333 TYR CD1 CE1 sing Y N 334 TYR CD1 HD1 sing N N 335 TYR CD2 CE2 doub Y N 336 TYR CD2 HD2 sing N N 337 TYR CE1 CZ doub Y N 338 TYR CE1 HE1 sing N N 339 TYR CE2 CZ sing Y N 340 TYR CE2 HE2 sing N N 341 TYR CZ OH sing N N 342 TYR OH HH sing N N 343 TYR OXT HXT sing N N 344 VAL N CA sing N N 345 VAL N H sing N N 346 VAL N H2 sing N N 347 VAL CA C sing N N 348 VAL CA CB sing N N 349 VAL CA HA sing N N 350 VAL C O doub N N 351 VAL C OXT sing N N 352 VAL CB CG1 sing N N 353 VAL CB CG2 sing N N 354 VAL CB HB sing N N 355 VAL CG1 HG11 sing N N 356 VAL CG1 HG12 sing N N 357 VAL CG1 HG13 sing N N 358 VAL CG2 HG21 sing N N 359 VAL CG2 HG22 sing N N 360 VAL CG2 HG23 sing N N 361 VAL OXT HXT sing N N 362 # _pdbx_audit_support.funding_organization 'National Research Foundation (NRF, Korea)' _pdbx_audit_support.country 'Korea, Republic Of' _pdbx_audit_support.grant_number RS-2023-00208153 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 22GV _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 1 2 1' _space_group.name_Hall 'P 2y' _space_group.IT_number 3 _space_group.crystal_system monoclinic _space_group.id 1 # _atom_sites.entry_id 22GW _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.012382 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.001640 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017732 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008335 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #