data_23RI # _entry.id 23RI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.410 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 23RI pdb_000023ri 10.2210/pdb23ri/pdb WWPDB D_1300070255 ? ? BMRB 36831 ? 10.13018/BMR36831 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-02-25 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 23RI _pdbx_database_status.recvd_initial_deposition_date 2026-02-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'CRYSTAL STRUCTURE OF THE ENZYMATICALLY ACTIVE DOMAIN OF THE LISTERIA MONOCYTOGENES BACTERIOPHAGE 500 ENDOLYSIN PLY500' 2VO9 unspecified PDB 'Bacteriophage T5 l-alanoyl-d-glutamate peptidase comlpex with Zn2+' 2MXZ unspecified PDB 'Bacteriophage T5 l-alanoyl-d-glutamate peptidase Zn2+/Ca2+ form' 8P3A unspecified PDB 'X-ray structure of LysECD7 endolysin against Gram-negative bacteria' 8Q2G unspecified PDB 'Crystal structure of Serratia marcescens L-Ala D-Glu endopeptidase ChiX' 5OPZ unspecified PDB 'Crystal structure of LysB4, the endolysin from Bacillus cereus-targeting bacteriophage B4' 6AKV unspecified BMRB 'l-alanoyl-d-glutamate peptidase bacteriophage RB49 comlpex with Zn2+' 36831 unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email mikulinskaya@bibch.ru _pdbx_contact_author.name_first Galina _pdbx_contact_author.name_last Mikoulinskaia _pdbx_contact_author.name_mi V. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-0596-0003 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Prokhorov, D.A.' 1 0000-0002-9366-1216 'Mikoulinskaia, G.V.' 2 0000-0003-0596-0003 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Spatial structure of L-alanoyl-D-glutamate peptidase of bacteriophage RB49' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Prokhorov, D.A.' 1 0000-0002-9366-1216 primary 'Mikoulinskaia, G.V.' 2 0000-0003-0596-0003 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Peptidase M15C domain-containing protein' 14780.025 1 ? ? ? 'Zn2+ containing form.' 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'l-alanoyl-d-glutamate peptidase (endolysin) bacteriophage RB49' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MFKLSQRSKDRLVGVHPDLVKVVHRALELTPVDFGITEGVRSLETQKKYVAEGKSKTMKSRHLHGFAVDVVAYPKDKDTW NMKYYRMIADAFKQAGRELGVPVEWGGDWTSFKDGPHLQLPHSKYPDPK ; _entity_poly.pdbx_seq_one_letter_code_can ;MFKLSQRSKDRLVGVHPDLVKVVHRALELTPVDFGITEGVRSLETQKKYVAEGKSKTMKSRHLHGFAVDVVAYPKDKDTW NMKYYRMIADAFKQAGRELGVPVEWGGDWTSFKDGPHLQLPHSKYPDPK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PHE n 1 3 LYS n 1 4 LEU n 1 5 SER n 1 6 GLN n 1 7 ARG n 1 8 SER n 1 9 LYS n 1 10 ASP n 1 11 ARG n 1 12 LEU n 1 13 VAL n 1 14 GLY n 1 15 VAL n 1 16 HIS n 1 17 PRO n 1 18 ASP n 1 19 LEU n 1 20 VAL n 1 21 LYS n 1 22 VAL n 1 23 VAL n 1 24 HIS n 1 25 ARG n 1 26 ALA n 1 27 LEU n 1 28 GLU n 1 29 LEU n 1 30 THR n 1 31 PRO n 1 32 VAL n 1 33 ASP n 1 34 PHE n 1 35 GLY n 1 36 ILE n 1 37 THR n 1 38 GLU n 1 39 GLY n 1 40 VAL n 1 41 ARG n 1 42 SER n 1 43 LEU n 1 44 GLU n 1 45 THR n 1 46 GLN n 1 47 LYS n 1 48 LYS n 1 49 TYR n 1 50 VAL n 1 51 ALA n 1 52 GLU n 1 53 GLY n 1 54 LYS n 1 55 SER n 1 56 LYS n 1 57 THR n 1 58 MET n 1 59 LYS n 1 60 SER n 1 61 ARG n 1 62 HIS n 1 63 LEU n 1 64 HIS n 1 65 GLY n 1 66 PHE n 1 67 ALA n 1 68 VAL n 1 69 ASP n 1 70 VAL n 1 71 VAL n 1 72 ALA n 1 73 TYR n 1 74 PRO n 1 75 LYS n 1 76 ASP n 1 77 LYS n 1 78 ASP n 1 79 THR n 1 80 TRP n 1 81 ASN n 1 82 MET n 1 83 LYS n 1 84 TYR n 1 85 TYR n 1 86 ARG n 1 87 MET n 1 88 ILE n 1 89 ALA n 1 90 ASP n 1 91 ALA n 1 92 PHE n 1 93 LYS n 1 94 GLN n 1 95 ALA n 1 96 GLY n 1 97 ARG n 1 98 GLU n 1 99 LEU n 1 100 GLY n 1 101 VAL n 1 102 PRO n 1 103 VAL n 1 104 GLU n 1 105 TRP n 1 106 GLY n 1 107 GLY n 1 108 ASP n 1 109 TRP n 1 110 THR n 1 111 SER n 1 112 PHE n 1 113 LYS n 1 114 ASP n 1 115 GLY n 1 116 PRO n 1 117 HIS n 1 118 LEU n 1 119 GLN n 1 120 LEU n 1 121 PRO n 1 122 HIS n 1 123 SER n 1 124 LYS n 1 125 TYR n 1 126 PRO n 1 127 ASP n 1 128 PRO n 1 129 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 129 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene RB49ORF102c _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia phage RB49' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 50948 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli B' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 37762 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 HIS 16 16 16 HIS HIS A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 MET 58 58 58 MET MET A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 HIS 62 62 62 HIS HIS A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 TRP 80 80 80 TRP TRP A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 MET 82 82 82 MET MET A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 MET 87 87 87 MET MET A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 PHE 92 92 92 PHE PHE A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 GLN 94 94 94 GLN GLN A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 TRP 105 105 105 TRP TRP A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 TRP 109 109 109 TRP TRP A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 PRO 116 116 116 PRO PRO A . n A 1 117 HIS 117 117 117 HIS HIS A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 GLN 119 119 119 GLN GLN A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 PRO 121 121 121 PRO PRO A . n A 1 122 HIS 122 122 122 HIS HIS A . n A 1 123 SER 123 123 123 SER SER A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 TYR 125 125 125 TYR TYR A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 PRO 128 128 128 PRO PRO A . n A 1 129 LYS 129 129 129 LYS LYS A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ZN _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ZN _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 155 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 23RI _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.000 _cell.length_a_esd ? _cell.length_b 1.000 _cell.length_b_esd ? _cell.length_c 1.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 23RI _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 23RI _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _database_PDB_matrix.entry_id 23RI _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 23RI _struct.title 'l-alanoyl-d-glutamate peptidase bacteriophage RB49 comlpex with Zn2+' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 23RI _struct_keywords.text 'l-alanoyl-d-glutamate peptidase, bacteriophage RB49, endolysin, Zn2+ containing form, antimicrobial protein' _struct_keywords.pdbx_keywords 'ANTIMICROBIAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q7Y3Q4_BPRB4 _struct_ref.pdbx_db_accession Q7Y3Q4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MFKLSQRSKDRLVGVHPDLVKVVHRALELTPVDFGITEGVRSLETQKKYVAEGKSKTMKSRHLHGFAVDVVAYPKDKDTW NMKYYRMIADAFKQAGRELGVPVEWGGDWTSFKDGPHLQLPHSKYPDPK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 23RI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 129 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q7Y3Q4 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 129 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 129 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 5 ? LEU A 12 ? SER A 5 LEU A 12 1 ? 8 HELX_P HELX_P2 AA2 HIS A 16 ? LEU A 29 ? HIS A 16 LEU A 29 1 ? 14 HELX_P HELX_P3 AA3 SER A 42 ? GLU A 52 ? SER A 42 GLU A 52 1 ? 11 HELX_P HELX_P4 AA4 SER A 60 ? GLY A 65 ? SER A 60 GLY A 65 5 ? 6 HELX_P HELX_P5 AA5 ASN A 81 ? GLY A 100 ? ASN A 81 GLY A 100 1 ? 20 HELX_P HELX_P6 AA6 PRO A 121 ? TYR A 125 ? PRO A 121 TYR A 125 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 34 ? GLY A 39 ? PHE A 34 GLY A 39 AA1 2 ALA A 67 ? ALA A 72 ? ALA A 67 ALA A 72 AA1 3 LEU A 118 ? GLN A 119 ? LEU A 118 GLN A 119 AA1 4 GLU A 104 ? TRP A 105 ? GLU A 104 TRP A 105 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 38 ? N GLU A 38 O ASP A 69 ? O ASP A 69 AA1 2 3 N VAL A 68 ? N VAL A 68 O LEU A 118 ? O LEU A 118 AA1 3 4 O GLN A 119 ? O GLN A 119 N GLU A 104 ? N GLU A 104 # _pdbx_entry_details.entry_id 23RI _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 59 ? ? -93.04 42.84 2 1 ASP A 78 ? ? -100.78 64.79 3 1 ASP A 108 ? ? -133.76 -35.06 4 1 LYS A 113 ? ? 28.97 57.07 5 1 PRO A 116 ? ? -69.78 68.27 6 2 ASP A 78 ? ? -100.85 65.76 7 2 LYS A 113 ? ? 36.06 49.06 8 2 PRO A 116 ? ? -69.81 70.19 9 3 LYS A 59 ? ? -149.01 56.71 10 3 ASP A 78 ? ? -100.85 66.63 11 3 ASP A 108 ? ? -130.92 -33.02 12 3 LYS A 113 ? ? 33.64 56.69 13 3 PRO A 116 ? ? -69.76 71.95 14 4 ASP A 78 ? ? -100.04 64.98 15 4 ASP A 108 ? ? -130.01 -30.71 16 4 LYS A 113 ? ? 34.85 56.11 17 4 PRO A 116 ? ? -69.72 71.57 18 4 TYR A 125 ? ? -115.58 77.95 19 5 ASP A 108 ? ? -131.63 -32.56 20 5 LYS A 113 ? ? 33.31 50.52 21 5 PRO A 116 ? ? -69.84 70.22 22 6 LYS A 59 ? ? -143.74 54.21 23 6 ASP A 78 ? ? -100.97 68.07 24 6 LYS A 113 ? ? 36.36 48.41 25 6 PRO A 116 ? ? -69.75 69.80 26 7 LYS A 59 ? ? -105.67 54.44 27 7 ASP A 78 ? ? -100.87 65.35 28 7 LYS A 113 ? ? 34.48 48.85 29 7 PRO A 116 ? ? -69.79 71.35 30 8 ASP A 78 ? ? -101.06 67.89 31 8 ASP A 108 ? ? -135.68 -35.65 32 8 LYS A 113 ? ? 26.56 56.92 33 8 PRO A 116 ? ? -69.67 70.32 34 9 LYS A 59 ? ? -94.69 39.22 35 9 ASP A 78 ? ? -100.10 65.47 36 9 LYS A 113 ? ? 37.54 58.81 37 9 ASP A 114 ? ? -106.11 74.51 38 9 PRO A 116 ? ? -69.75 70.11 39 10 ASP A 78 ? ? -101.29 70.78 40 10 ASP A 108 ? ? -132.47 -32.91 41 10 LYS A 113 ? ? 33.48 52.86 42 10 PRO A 116 ? ? -69.74 71.66 43 10 TYR A 125 ? ? -116.64 77.91 44 11 ASP A 78 ? ? -100.70 65.29 45 11 ASP A 108 ? ? -130.23 -30.90 46 11 LYS A 113 ? ? 34.04 49.20 47 11 PRO A 116 ? ? -69.71 71.33 48 12 LYS A 59 ? ? -100.95 57.99 49 12 ASP A 78 ? ? -100.99 65.75 50 12 LYS A 113 ? ? 36.84 60.36 51 12 ASP A 114 ? ? -108.43 74.42 52 12 PRO A 116 ? ? -69.81 68.27 53 12 TYR A 125 ? ? -112.56 78.02 54 13 ASP A 78 ? ? -100.62 65.22 55 13 LYS A 113 ? ? 37.58 57.78 56 13 ASP A 114 ? ? -102.44 74.46 57 13 PRO A 116 ? ? -69.77 70.86 58 14 ASP A 78 ? ? -101.27 70.71 59 14 ASP A 108 ? ? -132.72 -31.96 60 14 LYS A 113 ? ? 35.18 51.75 61 14 PRO A 116 ? ? -69.75 69.04 62 15 ASP A 78 ? ? -100.65 65.15 63 15 ASP A 108 ? ? -135.18 -33.02 64 15 LYS A 113 ? ? 33.07 51.01 65 15 PRO A 116 ? ? -69.78 67.11 66 15 TYR A 125 ? ? -112.32 78.10 67 16 LYS A 59 ? ? -104.96 44.09 68 16 ASP A 78 ? ? -100.56 65.52 69 16 ASP A 108 ? ? -130.19 -30.38 70 16 LYS A 113 ? ? 34.84 48.03 71 16 PRO A 116 ? ? -69.79 70.32 72 16 TYR A 125 ? ? -117.86 78.07 73 17 ASP A 108 ? ? -130.54 -30.41 74 17 LYS A 113 ? ? 34.60 48.41 75 17 PRO A 116 ? ? -69.70 71.57 76 18 ASP A 78 ? ? -100.50 64.91 77 18 LYS A 113 ? ? 34.61 49.69 78 18 PRO A 116 ? ? -69.74 70.54 79 19 LYS A 59 ? ? -118.73 50.03 80 19 ASP A 78 ? ? -100.68 67.93 81 19 ASP A 108 ? ? -137.56 -36.38 82 19 LYS A 113 ? ? 30.20 59.45 83 19 ASP A 114 ? ? -100.80 74.55 84 19 PRO A 116 ? ? -69.72 71.03 85 20 LYS A 59 ? ? -105.93 47.89 86 20 LYS A 113 ? ? 37.77 59.10 87 20 ASP A 114 ? ? -108.34 74.86 88 20 PRO A 116 ? ? -69.81 71.22 # _pdbx_nmr_ensemble.entry_id 23RI _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 23RI _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;0.8 mM [U-100% 13C; U-100% 15N] l-alanoyl-d-glutamate peptidase, 25 mM [U-100% 2H] sodium acetate, 1 mM Zn(NO3)2, 0.03 % w/w sodium azide, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 'endo_RB49 - Zn2+' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'l-alanoyl-d-glutamate peptidase' 0.8 ? mM '[U-100% 13C; U-100% 15N]' 1 'sodium acetate' 25 ? mM '[U-100% 2H]' 1 'Zn(NO3)2' 1 ? mM 'natural abundance' 1 'sodium azide' 0.03 ? '% w/w' 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units Pa _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 4.05 _pdbx_nmr_exptl_sample_conditions.ionic_strength 28 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err 0.05 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err 0.2 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 7 1 1 '2D 1H-13C HSQC-ali' 1 isotropic 6 1 1 '3D BEST TROSY HNCACB' 1 isotropic 5 1 1 '3D BEST TROSY HN(CO)CACB' 1 isotropic 4 1 1 '3D BEST TROSY HNCO' 1 isotropic 3 1 1 '3D BEST TROSY HN(CA)CO' 1 isotropic 2 1 1 '3D BEST TROSY (H)N(COCA)NH' 1 isotropic 8 1 1 '3D H(C)CH-TOCSY ali' 1 isotropic 12 1 1 '3D (H)CCH-TOCSY ali' 1 isotropic 11 1 1 '3D TROSY-(H)CCH-COSY aro' 1 isotropic 10 1 1 '2D (Hb)Cb(CgCC-TOCSY)Har' 1 isotropic 9 1 1 '3D 1H-15N TOCSY' 1 isotropic 15 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 14 1 1 '3D 1H-13C NOESY aromatic' 1 isotropic 13 1 1 '3D 1H-15N NOESY' 1 isotropic # _pdbx_nmr_refine.entry_id 23RI _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'structure calculation' CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' 2 refinement CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' CARA 'Release: 1.8.4.2' 'Keller and Wuthrich' 4 processing TopSpin 2.1 'Bruker Biospin' 5 'peak picking' TopSpin 2.1 'Bruker Biospin' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 ZN ZN ZN N N 374 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # _pdbx_audit_support.funding_organization 'Other government' _pdbx_audit_support.country 'Russian Federation' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details 'TXI probehead' # _atom_sites.entry_id 23RI _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S ZN # loop_ #