data_24JT # _entry.id 24JT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.413 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 24JT pdb_000024jt 10.2210/pdb24jt/pdb WWPDB D_1300071212 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-05-20 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 24JT _pdbx_database_status.recvd_initial_deposition_date 2026-03-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email kirie@wakayama-med.ac.jp _pdbx_contact_author.name_first Katsumasa _pdbx_contact_author.name_last Irie _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-8178-1552 # _audit_author.name 'Irie, K.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0002-8178-1552 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biorxiv _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2692-8205 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'The structural dynamics and molecular coupling in the slow inactivation of a prokaryotic voltage-gated sodium channel' _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1101/2025.08.14.670348 _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Irie, K.' 1 ? primary 'Han, S.' 2 ? primary 'Applewhite, S.' 3 ? primary 'Maeda, Y.K.' 4 ? primary 'Vance, J.' 5 ? primary 'Wang, S.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ion transport protein' 26563.896 1 ? N49K ? ? 2 non-polymer syn DODECYL-BETA-D-MALTOSIDE 510.615 1 ? ? ? ? 3 non-polymer syn CHAPSO 631.884 1 ? ? ? ? 4 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MYLRITNIVESSFFTKFIIYLIVLNGITMGLETSKTFMQSFGVYTTLFKQIVITIFTIEIILRIYVHRISFFKDPWSLFD FFVVAISLVPTSSGFEILRVLRVLRLFRLVTAVPQMRKIVSALISVIPGMLSVIALMTLFFYIFAIMATQLFGERFPEWF GTLGESFYTLFQVMTLESWSMGIVRPLMEVYPYAWVFFIPFIFVVAFVMINLVVAIIVDAMAILNQKEE ; _entity_poly.pdbx_seq_one_letter_code_can ;MYLRITNIVESSFFTKFIIYLIVLNGITMGLETSKTFMQSFGVYTTLFKQIVITIFTIEIILRIYVHRISFFKDPWSLFD FFVVAISLVPTSSGFEILRVLRVLRLFRLVTAVPQMRKIVSALISVIPGMLSVIALMTLFFYIFAIMATQLFGERFPEWF GTLGESFYTLFQVMTLESWSMGIVRPLMEVYPYAWVFFIPFIFVVAFVMINLVVAIIVDAMAILNQKEE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 DODECYL-BETA-D-MALTOSIDE LMT 3 CHAPSO 1N7 4 'CALCIUM ION' CA # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 TYR n 1 3 LEU n 1 4 ARG n 1 5 ILE n 1 6 THR n 1 7 ASN n 1 8 ILE n 1 9 VAL n 1 10 GLU n 1 11 SER n 1 12 SER n 1 13 PHE n 1 14 PHE n 1 15 THR n 1 16 LYS n 1 17 PHE n 1 18 ILE n 1 19 ILE n 1 20 TYR n 1 21 LEU n 1 22 ILE n 1 23 VAL n 1 24 LEU n 1 25 ASN n 1 26 GLY n 1 27 ILE n 1 28 THR n 1 29 MET n 1 30 GLY n 1 31 LEU n 1 32 GLU n 1 33 THR n 1 34 SER n 1 35 LYS n 1 36 THR n 1 37 PHE n 1 38 MET n 1 39 GLN n 1 40 SER n 1 41 PHE n 1 42 GLY n 1 43 VAL n 1 44 TYR n 1 45 THR n 1 46 THR n 1 47 LEU n 1 48 PHE n 1 49 LYS n 1 50 GLN n 1 51 ILE n 1 52 VAL n 1 53 ILE n 1 54 THR n 1 55 ILE n 1 56 PHE n 1 57 THR n 1 58 ILE n 1 59 GLU n 1 60 ILE n 1 61 ILE n 1 62 LEU n 1 63 ARG n 1 64 ILE n 1 65 TYR n 1 66 VAL n 1 67 HIS n 1 68 ARG n 1 69 ILE n 1 70 SER n 1 71 PHE n 1 72 PHE n 1 73 LYS n 1 74 ASP n 1 75 PRO n 1 76 TRP n 1 77 SER n 1 78 LEU n 1 79 PHE n 1 80 ASP n 1 81 PHE n 1 82 PHE n 1 83 VAL n 1 84 VAL n 1 85 ALA n 1 86 ILE n 1 87 SER n 1 88 LEU n 1 89 VAL n 1 90 PRO n 1 91 THR n 1 92 SER n 1 93 SER n 1 94 GLY n 1 95 PHE n 1 96 GLU n 1 97 ILE n 1 98 LEU n 1 99 ARG n 1 100 VAL n 1 101 LEU n 1 102 ARG n 1 103 VAL n 1 104 LEU n 1 105 ARG n 1 106 LEU n 1 107 PHE n 1 108 ARG n 1 109 LEU n 1 110 VAL n 1 111 THR n 1 112 ALA n 1 113 VAL n 1 114 PRO n 1 115 GLN n 1 116 MET n 1 117 ARG n 1 118 LYS n 1 119 ILE n 1 120 VAL n 1 121 SER n 1 122 ALA n 1 123 LEU n 1 124 ILE n 1 125 SER n 1 126 VAL n 1 127 ILE n 1 128 PRO n 1 129 GLY n 1 130 MET n 1 131 LEU n 1 132 SER n 1 133 VAL n 1 134 ILE n 1 135 ALA n 1 136 LEU n 1 137 MET n 1 138 THR n 1 139 LEU n 1 140 PHE n 1 141 PHE n 1 142 TYR n 1 143 ILE n 1 144 PHE n 1 145 ALA n 1 146 ILE n 1 147 MET n 1 148 ALA n 1 149 THR n 1 150 GLN n 1 151 LEU n 1 152 PHE n 1 153 GLY n 1 154 GLU n 1 155 ARG n 1 156 PHE n 1 157 PRO n 1 158 GLU n 1 159 TRP n 1 160 PHE n 1 161 GLY n 1 162 THR n 1 163 LEU n 1 164 GLY n 1 165 GLU n 1 166 SER n 1 167 PHE n 1 168 TYR n 1 169 THR n 1 170 LEU n 1 171 PHE n 1 172 GLN n 1 173 VAL n 1 174 MET n 1 175 THR n 1 176 LEU n 1 177 GLU n 1 178 SER n 1 179 TRP n 1 180 SER n 1 181 MET n 1 182 GLY n 1 183 ILE n 1 184 VAL n 1 185 ARG n 1 186 PRO n 1 187 LEU n 1 188 MET n 1 189 GLU n 1 190 VAL n 1 191 TYR n 1 192 PRO n 1 193 TYR n 1 194 ALA n 1 195 TRP n 1 196 VAL n 1 197 PHE n 1 198 PHE n 1 199 ILE n 1 200 PRO n 1 201 PHE n 1 202 ILE n 1 203 PHE n 1 204 VAL n 1 205 VAL n 1 206 ALA n 1 207 PHE n 1 208 VAL n 1 209 MET n 1 210 ILE n 1 211 ASN n 1 212 LEU n 1 213 VAL n 1 214 VAL n 1 215 ALA n 1 216 ILE n 1 217 ILE n 1 218 VAL n 1 219 ASP n 1 220 ALA n 1 221 MET n 1 222 ALA n 1 223 ILE n 1 224 LEU n 1 225 ASN n 1 226 GLN n 1 227 LYS n 1 228 GLU n 1 229 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 229 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Abu_1752 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Aliarcobacter butzleri RM4018' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 367737 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 1N7 non-polymer . CHAPSO '2-hydroxy-N,N-dimethyl-3-sulfo-N-(3-{[(3beta,5beta,7beta,12beta)-3,7,12-trihydroxy-24-oxocholan-24-yl]amino}propyl)propan-1-aminium' 'C32 H59 N2 O8 S 1' 631.884 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LMT D-saccharide . DODECYL-BETA-D-MALTOSIDE ? 'C24 H46 O11' 510.615 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1001 1001 MET MET A . n A 1 2 TYR 2 1002 1002 TYR TYR A . n A 1 3 LEU 3 1003 1003 LEU LEU A . n A 1 4 ARG 4 1004 1004 ARG ARG A . n A 1 5 ILE 5 1005 1005 ILE ILE A . n A 1 6 THR 6 1006 1006 THR THR A . n A 1 7 ASN 7 1007 1007 ASN ASN A . n A 1 8 ILE 8 1008 1008 ILE ILE A . n A 1 9 VAL 9 1009 1009 VAL VAL A . n A 1 10 GLU 10 1010 1010 GLU GLU A . n A 1 11 SER 11 1011 1011 SER SER A . n A 1 12 SER 12 1012 1012 SER SER A . n A 1 13 PHE 13 1013 1013 PHE PHE A . n A 1 14 PHE 14 1014 1014 PHE PHE A . n A 1 15 THR 15 1015 1015 THR THR A . n A 1 16 LYS 16 1016 1016 LYS LYS A . n A 1 17 PHE 17 1017 1017 PHE PHE A . n A 1 18 ILE 18 1018 1018 ILE ILE A . n A 1 19 ILE 19 1019 1019 ILE ILE A . n A 1 20 TYR 20 1020 1020 TYR TYR A . n A 1 21 LEU 21 1021 1021 LEU LEU A . n A 1 22 ILE 22 1022 1022 ILE ILE A . n A 1 23 VAL 23 1023 1023 VAL VAL A . n A 1 24 LEU 24 1024 1024 LEU LEU A . n A 1 25 ASN 25 1025 1025 ASN ASN A . n A 1 26 GLY 26 1026 1026 GLY GLY A . n A 1 27 ILE 27 1027 1027 ILE ILE A . n A 1 28 THR 28 1028 1028 THR THR A . n A 1 29 MET 29 1029 1029 MET MET A . n A 1 30 GLY 30 1030 1030 GLY GLY A . n A 1 31 LEU 31 1031 1031 LEU LEU A . n A 1 32 GLU 32 1032 1032 GLU GLU A . n A 1 33 THR 33 1033 1033 THR THR A . n A 1 34 SER 34 1034 1034 SER SER A . n A 1 35 LYS 35 1035 1035 LYS LYS A . n A 1 36 THR 36 1036 1036 THR THR A . n A 1 37 PHE 37 1037 1037 PHE PHE A . n A 1 38 MET 38 1038 1038 MET MET A . n A 1 39 GLN 39 1039 1039 GLN GLN A . n A 1 40 SER 40 1040 1040 SER SER A . n A 1 41 PHE 41 1041 1041 PHE PHE A . n A 1 42 GLY 42 1042 1042 GLY GLY A . n A 1 43 VAL 43 1043 1043 VAL VAL A . n A 1 44 TYR 44 1044 1044 TYR TYR A . n A 1 45 THR 45 1045 1045 THR THR A . n A 1 46 THR 46 1046 1046 THR THR A . n A 1 47 LEU 47 1047 1047 LEU LEU A . n A 1 48 PHE 48 1048 1048 PHE PHE A . n A 1 49 LYS 49 1049 1049 LYS LYS A . n A 1 50 GLN 50 1050 1050 GLN GLN A . n A 1 51 ILE 51 1051 1051 ILE ILE A . n A 1 52 VAL 52 1052 1052 VAL VAL A . n A 1 53 ILE 53 1053 1053 ILE ILE A . n A 1 54 THR 54 1054 1054 THR THR A . n A 1 55 ILE 55 1055 1055 ILE ILE A . n A 1 56 PHE 56 1056 1056 PHE PHE A . n A 1 57 THR 57 1057 1057 THR THR A . n A 1 58 ILE 58 1058 1058 ILE ILE A . n A 1 59 GLU 59 1059 1059 GLU GLU A . n A 1 60 ILE 60 1060 1060 ILE ILE A . n A 1 61 ILE 61 1061 1061 ILE ILE A . n A 1 62 LEU 62 1062 1062 LEU LEU A . n A 1 63 ARG 63 1063 1063 ARG ARG A . n A 1 64 ILE 64 1064 1064 ILE ILE A . n A 1 65 TYR 65 1065 1065 TYR TYR A . n A 1 66 VAL 66 1066 1066 VAL VAL A . n A 1 67 HIS 67 1067 1067 HIS HIS A . n A 1 68 ARG 68 1068 1068 ARG ARG A . n A 1 69 ILE 69 1069 1069 ILE ILE A . n A 1 70 SER 70 1070 1070 SER SER A . n A 1 71 PHE 71 1071 1071 PHE PHE A . n A 1 72 PHE 72 1072 1072 PHE PHE A . n A 1 73 LYS 73 1073 1073 LYS LYS A . n A 1 74 ASP 74 1074 1074 ASP ASP A . n A 1 75 PRO 75 1075 1075 PRO PRO A . n A 1 76 TRP 76 1076 1076 TRP TRP A . n A 1 77 SER 77 1077 1077 SER SER A . n A 1 78 LEU 78 1078 1078 LEU LEU A . n A 1 79 PHE 79 1079 1079 PHE PHE A . n A 1 80 ASP 80 1080 1080 ASP ASP A . n A 1 81 PHE 81 1081 1081 PHE PHE A . n A 1 82 PHE 82 1082 1082 PHE PHE A . n A 1 83 VAL 83 1083 1083 VAL VAL A . n A 1 84 VAL 84 1084 1084 VAL VAL A . n A 1 85 ALA 85 1085 1085 ALA ALA A . n A 1 86 ILE 86 1086 1086 ILE ILE A . n A 1 87 SER 87 1087 1087 SER SER A . n A 1 88 LEU 88 1088 1088 LEU LEU A . n A 1 89 VAL 89 1089 1089 VAL VAL A . n A 1 90 PRO 90 1090 ? ? ? A . n A 1 91 THR 91 1091 ? ? ? A . n A 1 92 SER 92 1092 ? ? ? A . n A 1 93 SER 93 1093 ? ? ? A . n A 1 94 GLY 94 1094 ? ? ? A . n A 1 95 PHE 95 1095 ? ? ? A . n A 1 96 GLU 96 1096 ? ? ? A . n A 1 97 ILE 97 1097 1097 ILE ILE A . n A 1 98 LEU 98 1098 1098 LEU LEU A . n A 1 99 ARG 99 1099 1099 ARG ARG A . n A 1 100 VAL 100 1100 1100 VAL VAL A . n A 1 101 LEU 101 1101 1101 LEU LEU A . n A 1 102 ARG 102 1102 1102 ARG ARG A . n A 1 103 VAL 103 1103 1103 VAL VAL A . n A 1 104 LEU 104 1104 1104 LEU LEU A . n A 1 105 ARG 105 1105 1105 ARG ARG A . n A 1 106 LEU 106 1106 1106 LEU LEU A . n A 1 107 PHE 107 1107 1107 PHE PHE A . n A 1 108 ARG 108 1108 1108 ARG ARG A . n A 1 109 LEU 109 1109 1109 LEU LEU A . n A 1 110 VAL 110 1110 1110 VAL VAL A . n A 1 111 THR 111 1111 1111 THR THR A . n A 1 112 ALA 112 1112 1112 ALA ALA A . n A 1 113 VAL 113 1113 1113 VAL VAL A . n A 1 114 PRO 114 1114 1114 PRO PRO A . n A 1 115 GLN 115 1115 1115 GLN GLN A . n A 1 116 MET 116 1116 1116 MET MET A . n A 1 117 ARG 117 1117 1117 ARG ARG A . n A 1 118 LYS 118 1118 1118 LYS LYS A . n A 1 119 ILE 119 1119 1119 ILE ILE A . n A 1 120 VAL 120 1120 1120 VAL VAL A . n A 1 121 SER 121 1121 1121 SER SER A . n A 1 122 ALA 122 1122 1122 ALA ALA A . n A 1 123 LEU 123 1123 1123 LEU LEU A . n A 1 124 ILE 124 1124 1124 ILE ILE A . n A 1 125 SER 125 1125 1125 SER SER A . n A 1 126 VAL 126 1126 1126 VAL VAL A . n A 1 127 ILE 127 1127 1127 ILE ILE A . n A 1 128 PRO 128 1128 1128 PRO PRO A . n A 1 129 GLY 129 1129 1129 GLY GLY A . n A 1 130 MET 130 1130 1130 MET MET A . n A 1 131 LEU 131 1131 1131 LEU LEU A . n A 1 132 SER 132 1132 1132 SER SER A . n A 1 133 VAL 133 1133 1133 VAL VAL A . n A 1 134 ILE 134 1134 1134 ILE ILE A . n A 1 135 ALA 135 1135 1135 ALA ALA A . n A 1 136 LEU 136 1136 1136 LEU LEU A . n A 1 137 MET 137 1137 1137 MET MET A . n A 1 138 THR 138 1138 1138 THR THR A . n A 1 139 LEU 139 1139 1139 LEU LEU A . n A 1 140 PHE 140 1140 1140 PHE PHE A . n A 1 141 PHE 141 1141 1141 PHE PHE A . n A 1 142 TYR 142 1142 1142 TYR TYR A . n A 1 143 ILE 143 1143 1143 ILE ILE A . n A 1 144 PHE 144 1144 1144 PHE PHE A . n A 1 145 ALA 145 1145 1145 ALA ALA A . n A 1 146 ILE 146 1146 1146 ILE ILE A . n A 1 147 MET 147 1147 1147 MET MET A . n A 1 148 ALA 148 1148 1148 ALA ALA A . n A 1 149 THR 149 1149 1149 THR THR A . n A 1 150 GLN 150 1150 1150 GLN GLN A . n A 1 151 LEU 151 1151 1151 LEU LEU A . n A 1 152 PHE 152 1152 1152 PHE PHE A . n A 1 153 GLY 153 1153 1153 GLY GLY A . n A 1 154 GLU 154 1154 1154 GLU GLU A . n A 1 155 ARG 155 1155 1155 ARG ARG A . n A 1 156 PHE 156 1156 1156 PHE PHE A . n A 1 157 PRO 157 1157 1157 PRO PRO A . n A 1 158 GLU 158 1158 1158 GLU GLU A . n A 1 159 TRP 159 1159 1159 TRP TRP A . n A 1 160 PHE 160 1160 1160 PHE PHE A . n A 1 161 GLY 161 1161 1161 GLY GLY A . n A 1 162 THR 162 1162 1162 THR THR A . n A 1 163 LEU 163 1163 1163 LEU LEU A . n A 1 164 GLY 164 1164 1164 GLY GLY A . n A 1 165 GLU 165 1165 1165 GLU GLU A . n A 1 166 SER 166 1166 1166 SER SER A . n A 1 167 PHE 167 1167 1167 PHE PHE A . n A 1 168 TYR 168 1168 1168 TYR TYR A . n A 1 169 THR 169 1169 1169 THR THR A . n A 1 170 LEU 170 1170 1170 LEU LEU A . n A 1 171 PHE 171 1171 1171 PHE PHE A . n A 1 172 GLN 172 1172 1172 GLN GLN A . n A 1 173 VAL 173 1173 1173 VAL VAL A . n A 1 174 MET 174 1174 1174 MET MET A . n A 1 175 THR 175 1175 1175 THR THR A . n A 1 176 LEU 176 1176 1176 LEU LEU A . n A 1 177 GLU 177 1177 1177 GLU GLU A . n A 1 178 SER 178 1178 1178 SER SER A . n A 1 179 TRP 179 1179 1179 TRP TRP A . n A 1 180 SER 180 1180 1180 SER SER A . n A 1 181 MET 181 1181 1181 MET MET A . n A 1 182 GLY 182 1182 1182 GLY GLY A . n A 1 183 ILE 183 1183 1183 ILE ILE A . n A 1 184 VAL 184 1184 1184 VAL VAL A . n A 1 185 ARG 185 1185 1185 ARG ARG A . n A 1 186 PRO 186 1186 1186 PRO PRO A . n A 1 187 LEU 187 1187 1187 LEU LEU A . n A 1 188 MET 188 1188 1188 MET MET A . n A 1 189 GLU 189 1189 1189 GLU GLU A . n A 1 190 VAL 190 1190 1190 VAL VAL A . n A 1 191 TYR 191 1191 1191 TYR TYR A . n A 1 192 PRO 192 1192 1192 PRO PRO A . n A 1 193 TYR 193 1193 1193 TYR TYR A . n A 1 194 ALA 194 1194 1194 ALA ALA A . n A 1 195 TRP 195 1195 1195 TRP TRP A . n A 1 196 VAL 196 1196 1196 VAL VAL A . n A 1 197 PHE 197 1197 1197 PHE PHE A . n A 1 198 PHE 198 1198 1198 PHE PHE A . n A 1 199 ILE 199 1199 1199 ILE ILE A . n A 1 200 PRO 200 1200 1200 PRO PRO A . n A 1 201 PHE 201 1201 1201 PHE PHE A . n A 1 202 ILE 202 1202 1202 ILE ILE A . n A 1 203 PHE 203 1203 1203 PHE PHE A . n A 1 204 VAL 204 1204 1204 VAL VAL A . n A 1 205 VAL 205 1205 1205 VAL VAL A . n A 1 206 ALA 206 1206 1206 ALA ALA A . n A 1 207 PHE 207 1207 1207 PHE PHE A . n A 1 208 VAL 208 1208 1208 VAL VAL A . n A 1 209 MET 209 1209 1209 MET MET A . n A 1 210 ILE 210 1210 1210 ILE ILE A . n A 1 211 ASN 211 1211 1211 ASN ASN A . n A 1 212 LEU 212 1212 1212 LEU LEU A . n A 1 213 VAL 213 1213 1213 VAL VAL A . n A 1 214 VAL 214 1214 1214 VAL VAL A . n A 1 215 ALA 215 1215 1215 ALA ALA A . n A 1 216 ILE 216 1216 ? ? ? A . n A 1 217 ILE 217 1217 ? ? ? A . n A 1 218 VAL 218 1218 ? ? ? A . n A 1 219 ASP 219 1219 ? ? ? A . n A 1 220 ALA 220 1220 ? ? ? A . n A 1 221 MET 221 1221 ? ? ? A . n A 1 222 ALA 222 1222 ? ? ? A . n A 1 223 ILE 223 1223 ? ? ? A . n A 1 224 LEU 224 1224 ? ? ? A . n A 1 225 ASN 225 1225 ? ? ? A . n A 1 226 GLN 226 1226 ? ? ? A . n A 1 227 LYS 227 1227 ? ? ? A . n A 1 228 GLU 228 1228 ? ? ? A . n A 1 229 GLU 229 1229 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id CA _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id CA _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 LMT 1 1301 1301 LMT LMT A . C 3 1N7 1 1302 1302 1N7 1N7 A . D 4 CA 1 1303 1311 CA CA A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 1155 ? CG ? A ARG 155 CG 2 1 Y 1 A ARG 1155 ? CD ? A ARG 155 CD 3 1 Y 1 A ARG 1155 ? NE ? A ARG 155 NE 4 1 Y 1 A ARG 1155 ? CZ ? A ARG 155 CZ 5 1 Y 1 A ARG 1155 ? NH1 ? A ARG 155 NH1 6 1 Y 1 A ARG 1155 ? NH2 ? A ARG 155 NH2 7 1 N 1 A 1N7 1302 ? N2 ? C 1N7 1 N2 8 1 N 1 A 1N7 1302 ? C28 ? C 1N7 1 C28 9 1 N 1 A 1N7 1302 ? C29 ? C 1N7 1 C29 10 1 N 1 A 1N7 1302 ? C30 ? C 1N7 1 C30 11 1 N 1 A 1N7 1302 ? C31 ? C 1N7 1 C31 12 1 N 1 A 1N7 1302 ? C32 ? C 1N7 1 C32 13 1 N 1 A 1N7 1302 ? O5 ? C 1N7 1 O5 14 1 N 1 A 1N7 1302 ? S1 ? C 1N7 1 S1 15 1 N 1 A 1N7 1302 ? O7 ? C 1N7 1 O7 16 1 N 1 A 1N7 1302 ? O8 ? C 1N7 1 O8 17 1 N 1 A 1N7 1302 ? O6 ? C 1N7 1 O6 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18.2_3874 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . ? 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 24JT _cell.details ? _cell.formula_units_Z ? _cell.length_a 128.280 _cell.length_a_esd ? _cell.length_b 128.280 _cell.length_b_esd ? _cell.length_c 202.360 _cell.length_c_esd ? _cell.volume 3329987.270 _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 24JT _symmetry.cell_setting ? _symmetry.Int_Tables_number 97 _symmetry.space_group_name_Hall 'I 4 2' _symmetry.space_group_name_H-M 'I 4 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 24JT _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 7.83 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 84.30 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '7%-9% PEG 6000, 100mM sodium chloride, 100mM magnesium nitrate, 100mM cadmium nitrate, 10mM copper chloride, 100mM Tris-HCl, pH 8.4' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-11-09 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL41XU' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL41XU _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate 178.88 _reflns.entry_id 24JT _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 4.1 _reflns.d_resolution_low 45.35 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6934 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 89.27 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 103.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.31 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.0965 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 4.1 _reflns_shell.d_res_low 4.247 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 263 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.5743 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.448 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 194.81 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 24JT _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 4.10 _refine.ls_d_res_low 45.35 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6216 _refine.ls_number_reflns_R_free 290 _refine.ls_number_reflns_R_work 5926 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 89.40 _refine.ls_percent_reflns_R_free 4.67 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.3547 _refine.ls_R_factor_R_free 0.3747 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.3540 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 37.9815 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.7493 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 4.10 _refine_hist.d_res_low 45.35 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1779 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1711 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 68 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0053 ? 1830 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.8999 ? 2491 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0571 ? 309 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0057 ? 280 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 15.4000 ? 648 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 4.10 4.17 . . 3 115 35.22 . . . . 0.4566 . . . . . . . . . . . . . . . 0.5993 'X-RAY DIFFRACTION' 4.17 4.25 . . 5 141 42.82 . . . . 0.4063 . . . . . . . . . . . . . . . 0.4543 'X-RAY DIFFRACTION' 4.25 4.33 . . 11 163 53.21 . . . . 0.3684 . . . . . . . . . . . . . . . 0.5250 'X-RAY DIFFRACTION' 4.33 4.42 . . 15 237 73.68 . . . . 0.4110 . . . . . . . . . . . . . . . 0.3892 'X-RAY DIFFRACTION' 4.42 4.51 . . 19 284 88.34 . . . . 0.3862 . . . . . . . . . . . . . . . 0.4414 'X-RAY DIFFRACTION' 4.51 4.62 . . 19 301 94.96 . . . . 0.3754 . . . . . . . . . . . . . . . 0.4631 'X-RAY DIFFRACTION' 4.62 4.73 . . 11 329 100.00 . . . . 0.3388 . . . . . . . . . . . . . . . 0.4698 'X-RAY DIFFRACTION' 4.73 4.86 . . 21 318 100.00 . . . . 0.3501 . . . . . . . . . . . . . . . 0.3888 'X-RAY DIFFRACTION' 4.86 5.00 . . 11 331 100.00 . . . . 0.3780 . . . . . . . . . . . . . . . 0.5109 'X-RAY DIFFRACTION' 5.00 5.16 . . 13 328 99.71 . . . . 0.3761 . . . . . . . . . . . . . . . 0.2853 'X-RAY DIFFRACTION' 5.16 5.35 . . 14 327 99.42 . . . . 0.3564 . . . . . . . . . . . . . . . 0.3632 'X-RAY DIFFRACTION' 5.35 5.56 . . 18 314 99.70 . . . . 0.3938 . . . . . . . . . . . . . . . 0.4403 'X-RAY DIFFRACTION' 5.56 5.82 . . 18 335 100.00 . . . . 0.3272 . . . . . . . . . . . . . . . 0.2764 'X-RAY DIFFRACTION' 5.82 6.12 . . 18 331 100.00 . . . . 0.3651 . . . . . . . . . . . . . . . 0.4175 'X-RAY DIFFRACTION' 6.12 6.50 . . 10 337 99.71 . . . . 0.4421 . . . . . . . . . . . . . . . 0.4471 'X-RAY DIFFRACTION' 6.51 7.00 . . 21 327 100.00 . . . . 0.4023 . . . . . . . . . . . . . . . 0.3219 'X-RAY DIFFRACTION' 7.01 7.70 . . 14 333 100.00 . . . . 0.3242 . . . . . . . . . . . . . . . 0.2561 'X-RAY DIFFRACTION' 7.71 8.81 . . 21 341 100.00 . . . . 0.2944 . . . . . . . . . . . . . . . 0.3515 'X-RAY DIFFRACTION' 8.82 11.07 . . 14 351 99.73 . . . . 0.2443 . . . . . . . . . . . . . . . 0.2822 'X-RAY DIFFRACTION' 11.10 45.35 . . 14 383 98.27 . . . . 0.3955 . . . . . . . . . . . . . . . 0.4170 # _struct.entry_id 24JT _struct.title 'Crystal structure of voltage-gated sodium channel NavAb N49K mutant' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 24JT _struct_keywords.text 'ion channel, MEMBRANE PROTEIN' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A8EVM5_ALIB4 _struct_ref.pdbx_db_accession A8EVM5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MYLRITNIVESSFFTKFIIYLIVLNGITMGLETSKTFMQSFGVYTTLFNQIVITIFTIEIILRIYVHRISFFKDPWSLFD FFVVAISLVPTSSGFEILRVLRVLRLFRLVTAVPQMRKIVSALISVIPGMLSVIALMTLFFYIFAIMATQLFGERFPEWF GTLGESFYTLFQVMTLESWSMGIVRPLMEVYPYAWVFFIPFIFVVTFVMINLVVAIIVDAMAILNQKEE ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 24JT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 229 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A8EVM5 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 229 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1001 _struct_ref_seq.pdbx_auth_seq_align_end 1229 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 24JT LYS A 49 ? UNP A8EVM5 ASN 49 'engineered mutation' 1049 1 1 24JT ALA A 206 ? UNP A8EVM5 THR 206 conflict 1206 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 11660 ? 1 MORE -131 ? 1 'SSA (A^2)' 49030 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -y,x,z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 y,-x,z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 MET A 1 ? SER A 11 ? MET A 1001 SER A 1011 1 ? 11 HELX_P HELX_P2 AA2 SER A 11 ? SER A 34 ? SER A 1011 SER A 1034 1 ? 24 HELX_P HELX_P3 AA3 SER A 34 ? HIS A 67 ? SER A 1034 HIS A 1067 1 ? 34 HELX_P HELX_P4 AA4 ILE A 69 ? ASP A 74 ? ILE A 1069 ASP A 1074 1 ? 6 HELX_P HELX_P5 AA5 ASP A 74 ? VAL A 89 ? ASP A 1074 VAL A 1089 1 ? 16 HELX_P HELX_P6 AA6 LEU A 98 ? ARG A 102 ? LEU A 1098 ARG A 1102 1 ? 5 HELX_P HELX_P7 AA7 VAL A 103 ? ARG A 105 ? VAL A 1103 ARG A 1105 5 ? 3 HELX_P HELX_P8 AA8 LEU A 106 ? VAL A 113 ? LEU A 1106 VAL A 1113 1 ? 8 HELX_P HELX_P9 AA9 VAL A 113 ? ILE A 127 ? VAL A 1113 ILE A 1127 1 ? 15 HELX_P HELX_P10 AB1 MET A 130 ? GLY A 153 ? MET A 1130 GLY A 1153 1 ? 24 HELX_P HELX_P11 AB2 THR A 162 ? THR A 175 ? THR A 1162 THR A 1175 1 ? 14 HELX_P HELX_P12 AB3 ILE A 183 ? TYR A 191 ? ILE A 1183 TYR A 1191 1 ? 9 HELX_P HELX_P13 AB4 ALA A 194 ? ALA A 215 ? ALA A 1194 ALA A 1215 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id metalc1 _struct_conn.conn_type_id metalc _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id SER _struct_conn.ptnr1_label_seq_id 178 _struct_conn.ptnr1_label_atom_id OG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id D _struct_conn.ptnr2_label_comp_id CA _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id CA _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id SER _struct_conn.ptnr1_auth_seq_id 1178 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CA _struct_conn.ptnr2_auth_seq_id 1303 _struct_conn.ptnr2_symmetry 4_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 3.045 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_entry_details.entry_id 24JT _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 PHE _pdbx_validate_close_contact.auth_seq_id_1 1198 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 N _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ILE _pdbx_validate_close_contact.auth_seq_id_2 1202 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.10 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ILE _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 1183 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -125.27 _pdbx_validate_torsion.psi -58.96 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x,z 3 y,-x,z 4 x,-y,-z 5 -x,y,-z 6 -x,-y,z 7 y,x,-z 8 -y,-x,-z 9 x+1/2,y+1/2,z+1/2 10 -y+1/2,x+1/2,z+1/2 11 y+1/2,-x+1/2,z+1/2 12 x+1/2,-y+1/2,-z+1/2 13 -x+1/2,y+1/2,-z+1/2 14 -x+1/2,-y+1/2,z+1/2 15 y+1/2,x+1/2,-z+1/2 16 -y+1/2,-x+1/2,-z+1/2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A PRO 1090 ? A PRO 90 2 1 Y 1 A THR 1091 ? A THR 91 3 1 Y 1 A SER 1092 ? A SER 92 4 1 Y 1 A SER 1093 ? A SER 93 5 1 Y 1 A GLY 1094 ? A GLY 94 6 1 Y 1 A PHE 1095 ? A PHE 95 7 1 Y 1 A GLU 1096 ? A GLU 96 8 1 Y 1 A ILE 1216 ? A ILE 216 9 1 Y 1 A ILE 1217 ? A ILE 217 10 1 Y 1 A VAL 1218 ? A VAL 218 11 1 Y 1 A ASP 1219 ? A ASP 219 12 1 Y 1 A ALA 1220 ? A ALA 220 13 1 Y 1 A MET 1221 ? A MET 221 14 1 Y 1 A ALA 1222 ? A ALA 222 15 1 Y 1 A ILE 1223 ? A ILE 223 16 1 Y 1 A LEU 1224 ? A LEU 224 17 1 Y 1 A ASN 1225 ? A ASN 225 18 1 Y 1 A GLN 1226 ? A GLN 226 19 1 Y 1 A LYS 1227 ? A LYS 227 20 1 Y 1 A GLU 1228 ? A GLU 228 21 1 Y 1 A GLU 1229 ? A GLU 229 22 1 N 0 A CA 1303 ? D CA ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 1N7 C1 C N N 1 1N7 C2 C N S 2 1N7 C3 C N N 3 1N7 C4 C N S 4 1N7 C5 C N R 5 1N7 C6 C N S 6 1N7 C7 C N N 7 1N7 C8 C N N 8 1N7 C9 C N R 9 1N7 C10 C N N 10 1N7 C11 C N N 11 1N7 C12 C N N 12 1N7 C13 C N R 13 1N7 C14 C N N 14 1N7 C15 C N S 15 1N7 C16 C N N 16 1N7 C17 C N R 17 1N7 C18 C N R 18 1N7 C19 C N S 19 1N7 C20 C N R 20 1N7 C21 C N N 21 1N7 C22 C N N 22 1N7 C23 C N N 23 1N7 C24 C N N 24 1N7 N1 N N N 25 1N7 O1 O N N 26 1N7 O2 O N N 27 1N7 O3 O N N 28 1N7 O4 O N N 29 1N7 H1 H N N 30 1N7 H2 H N N 31 1N7 H3 H N N 32 1N7 H4 H N N 33 1N7 H5 H N N 34 1N7 H6 H N N 35 1N7 H7 H N N 36 1N7 H8 H N N 37 1N7 H9 H N N 38 1N7 H10 H N N 39 1N7 H11 H N N 40 1N7 H12 H N N 41 1N7 H13 H N N 42 1N7 H14 H N N 43 1N7 H15 H N N 44 1N7 H16 H N N 45 1N7 H17 H N N 46 1N7 H18 H N N 47 1N7 H19 H N N 48 1N7 H20 H N N 49 1N7 H21 H N N 50 1N7 H22 H N N 51 1N7 H23 H N N 52 1N7 H24 H N N 53 1N7 H25 H N N 54 1N7 H26 H N N 55 1N7 H27 H N N 56 1N7 H28 H N N 57 1N7 H29 H N N 58 1N7 H30 H N N 59 1N7 H31 H N N 60 1N7 H32 H N N 61 1N7 H33 H N N 62 1N7 H34 H N N 63 1N7 H35 H N N 64 1N7 H36 H N N 65 1N7 H41 H N N 66 1N7 H43 H N N 67 1N7 H44 H N N 68 1N7 H45 H N N 69 1N7 C25 C N N 70 1N7 C26 C N N 71 1N7 C27 C N N 72 1N7 N2 N N N 73 1N7 C28 C N N 74 1N7 C29 C N N 75 1N7 C30 C N N 76 1N7 C31 C N N 77 1N7 C32 C N N 78 1N7 O5 O N N 79 1N7 S1 S N N 80 1N7 O7 O N N 81 1N7 O8 O N N 82 1N7 O6 O N N 83 1N7 H37 H N N 84 1N7 H38 H N N 85 1N7 H39 H N N 86 1N7 H40 H N N 87 1N7 H42 H N N 88 1N7 H46 H N N 89 1N7 H47 H N N 90 1N7 H48 H N N 91 1N7 H49 H N N 92 1N7 H50 H N N 93 1N7 H51 H N N 94 1N7 H52 H N N 95 1N7 H53 H N N 96 1N7 H54 H N N 97 1N7 H55 H N N 98 1N7 H56 H N N 99 1N7 H57 H N N 100 1N7 H58 H N N 101 1N7 H59 H N N 102 ALA N N N N 103 ALA CA C N S 104 ALA C C N N 105 ALA O O N N 106 ALA CB C N N 107 ALA OXT O N N 108 ALA H H N N 109 ALA H2 H N N 110 ALA HA H N N 111 ALA HB1 H N N 112 ALA HB2 H N N 113 ALA HB3 H N N 114 ALA HXT H N N 115 ARG N N N N 116 ARG CA C N S 117 ARG C C N N 118 ARG O O N N 119 ARG CB C N N 120 ARG CG C N N 121 ARG CD C N N 122 ARG NE N N N 123 ARG CZ C N N 124 ARG NH1 N N N 125 ARG NH2 N N N 126 ARG OXT O N N 127 ARG H H N N 128 ARG H2 H N N 129 ARG HA H N N 130 ARG HB2 H N N 131 ARG HB3 H N N 132 ARG HG2 H N N 133 ARG HG3 H N N 134 ARG HD2 H N N 135 ARG HD3 H N N 136 ARG HE H N N 137 ARG HH11 H N N 138 ARG HH12 H N N 139 ARG HH21 H N N 140 ARG HH22 H N N 141 ARG HXT H N N 142 ASN N N N N 143 ASN CA C N S 144 ASN C C N N 145 ASN O O N N 146 ASN CB C N N 147 ASN CG C N N 148 ASN OD1 O N N 149 ASN ND2 N N N 150 ASN OXT O N N 151 ASN H H N N 152 ASN H2 H N N 153 ASN HA H N N 154 ASN HB2 H N N 155 ASN HB3 H N N 156 ASN HD21 H N N 157 ASN HD22 H N N 158 ASN HXT H N N 159 ASP N N N N 160 ASP CA C N S 161 ASP C C N N 162 ASP O O N N 163 ASP CB C N N 164 ASP CG C N N 165 ASP OD1 O N N 166 ASP OD2 O N N 167 ASP OXT O N N 168 ASP H H N N 169 ASP H2 H N N 170 ASP HA H N N 171 ASP HB2 H N N 172 ASP HB3 H N N 173 ASP HD2 H N N 174 ASP HXT H N N 175 CA CA CA N N 176 GLN N N N N 177 GLN CA C N S 178 GLN C C N N 179 GLN O O N N 180 GLN CB C N N 181 GLN CG C N N 182 GLN CD C N N 183 GLN OE1 O N N 184 GLN NE2 N N N 185 GLN OXT O N N 186 GLN H H N N 187 GLN H2 H N N 188 GLN HA H N N 189 GLN HB2 H N N 190 GLN HB3 H N N 191 GLN HG2 H N N 192 GLN HG3 H N N 193 GLN HE21 H N N 194 GLN HE22 H N N 195 GLN HXT H N N 196 GLU N N N N 197 GLU CA C N S 198 GLU C C N N 199 GLU O O N N 200 GLU CB C N N 201 GLU CG C N N 202 GLU CD C N N 203 GLU OE1 O N N 204 GLU OE2 O N N 205 GLU OXT O N N 206 GLU H H N N 207 GLU H2 H N N 208 GLU HA H N N 209 GLU HB2 H N N 210 GLU HB3 H N N 211 GLU HG2 H N N 212 GLU HG3 H N N 213 GLU HE2 H N N 214 GLU HXT H N N 215 GLY N N N N 216 GLY CA C N N 217 GLY C C N N 218 GLY O O N N 219 GLY OXT O N N 220 GLY H H N N 221 GLY H2 H N N 222 GLY HA2 H N N 223 GLY HA3 H N N 224 GLY HXT H N N 225 HIS N N N N 226 HIS CA C N S 227 HIS C C N N 228 HIS O O N N 229 HIS CB C N N 230 HIS CG C Y N 231 HIS ND1 N Y N 232 HIS CD2 C Y N 233 HIS CE1 C Y N 234 HIS NE2 N Y N 235 HIS OXT O N N 236 HIS H H N N 237 HIS H2 H N N 238 HIS HA H N N 239 HIS HB2 H N N 240 HIS HB3 H N N 241 HIS HD1 H N N 242 HIS HD2 H N N 243 HIS HE1 H N N 244 HIS HE2 H N N 245 HIS HXT H N N 246 ILE N N N N 247 ILE CA C N S 248 ILE C C N N 249 ILE O O N N 250 ILE CB C N S 251 ILE CG1 C N N 252 ILE CG2 C N N 253 ILE CD1 C N N 254 ILE OXT O N N 255 ILE H H N N 256 ILE H2 H N N 257 ILE HA H N N 258 ILE HB H N N 259 ILE HG12 H N N 260 ILE HG13 H N N 261 ILE HG21 H N N 262 ILE HG22 H N N 263 ILE HG23 H N N 264 ILE HD11 H N N 265 ILE HD12 H N N 266 ILE HD13 H N N 267 ILE HXT H N N 268 LEU N N N N 269 LEU CA C N S 270 LEU C C N N 271 LEU O O N N 272 LEU CB C N N 273 LEU CG C N N 274 LEU CD1 C N N 275 LEU CD2 C N N 276 LEU OXT O N N 277 LEU H H N N 278 LEU H2 H N N 279 LEU HA H N N 280 LEU HB2 H N N 281 LEU HB3 H N N 282 LEU HG H N N 283 LEU HD11 H N N 284 LEU HD12 H N N 285 LEU HD13 H N N 286 LEU HD21 H N N 287 LEU HD22 H N N 288 LEU HD23 H N N 289 LEU HXT H N N 290 LMT C1B C N R 291 LMT C2B C N R 292 LMT C3B C N S 293 LMT C4B C N S 294 LMT C5B C N R 295 LMT C6B C N N 296 LMT O1B O N N 297 LMT O2B O N N 298 LMT O3B O N N 299 LMT "O4'" O N N 300 LMT O5B O N N 301 LMT O6B O N N 302 LMT "C1'" C N R 303 LMT "C2'" C N R 304 LMT "C3'" C N R 305 LMT "C4'" C N S 306 LMT "C5'" C N R 307 LMT "C6'" C N N 308 LMT "O1'" O N N 309 LMT "O2'" O N N 310 LMT "O3'" O N N 311 LMT "O5'" O N N 312 LMT "O6'" O N N 313 LMT C1 C N N 314 LMT C2 C N N 315 LMT C3 C N N 316 LMT C4 C N N 317 LMT C5 C N N 318 LMT C6 C N N 319 LMT C7 C N N 320 LMT C8 C N N 321 LMT C9 C N N 322 LMT C10 C N N 323 LMT C11 C N N 324 LMT C12 C N N 325 LMT H1B H N N 326 LMT H2B H N N 327 LMT H3B H N N 328 LMT H4B H N N 329 LMT H5B H N N 330 LMT "H6'2" H N N 331 LMT "H6'1" H N N 332 LMT H2O1 H N N 333 LMT H3O1 H N N 334 LMT H4O1 H N N 335 LMT H6B H N N 336 LMT "H1'" H N N 337 LMT "H2'" H N N 338 LMT "H3'" H N N 339 LMT "H4'" H N N 340 LMT "H5'" H N N 341 LMT H6D H N N 342 LMT H6E H N N 343 LMT H2O2 H N N 344 LMT H3O2 H N N 345 LMT "H6'" H N N 346 LMT H12 H N N 347 LMT H11 H N N 348 LMT H22 H N N 349 LMT H21 H N N 350 LMT H32 H N N 351 LMT H31 H N N 352 LMT H42 H N N 353 LMT H41 H N N 354 LMT H52 H N N 355 LMT H51 H N N 356 LMT H62 H N N 357 LMT H61 H N N 358 LMT H72 H N N 359 LMT H71 H N N 360 LMT H82 H N N 361 LMT H81 H N N 362 LMT H92 H N N 363 LMT H91 H N N 364 LMT H102 H N N 365 LMT H101 H N N 366 LMT H112 H N N 367 LMT H111 H N N 368 LMT H123 H N N 369 LMT H122 H N N 370 LMT H121 H N N 371 LYS N N N N 372 LYS CA C N S 373 LYS C C N N 374 LYS O O N N 375 LYS CB C N N 376 LYS CG C N N 377 LYS CD C N N 378 LYS CE C N N 379 LYS NZ N N N 380 LYS OXT O N N 381 LYS H H N N 382 LYS H2 H N N 383 LYS HA H N N 384 LYS HB2 H N N 385 LYS HB3 H N N 386 LYS HG2 H N N 387 LYS HG3 H N N 388 LYS HD2 H N N 389 LYS HD3 H N N 390 LYS HE2 H N N 391 LYS HE3 H N N 392 LYS HZ1 H N N 393 LYS HZ2 H N N 394 LYS HZ3 H N N 395 LYS HXT H N N 396 MET N N N N 397 MET CA C N S 398 MET C C N N 399 MET O O N N 400 MET CB C N N 401 MET CG C N N 402 MET SD S N N 403 MET CE C N N 404 MET OXT O N N 405 MET H H N N 406 MET H2 H N N 407 MET HA H N N 408 MET HB2 H N N 409 MET HB3 H N N 410 MET HG2 H N N 411 MET HG3 H N N 412 MET HE1 H N N 413 MET HE2 H N N 414 MET HE3 H N N 415 MET HXT H N N 416 PHE N N N N 417 PHE CA C N S 418 PHE C C N N 419 PHE O O N N 420 PHE CB C N N 421 PHE CG C Y N 422 PHE CD1 C Y N 423 PHE CD2 C Y N 424 PHE CE1 C Y N 425 PHE CE2 C Y N 426 PHE CZ C Y N 427 PHE OXT O N N 428 PHE H H N N 429 PHE H2 H N N 430 PHE HA H N N 431 PHE HB2 H N N 432 PHE HB3 H N N 433 PHE HD1 H N N 434 PHE HD2 H N N 435 PHE HE1 H N N 436 PHE HE2 H N N 437 PHE HZ H N N 438 PHE HXT H N N 439 PRO N N N N 440 PRO CA C N S 441 PRO C C N N 442 PRO O O N N 443 PRO CB C N N 444 PRO CG C N N 445 PRO CD C N N 446 PRO OXT O N N 447 PRO H H N N 448 PRO HA H N N 449 PRO HB2 H N N 450 PRO HB3 H N N 451 PRO HG2 H N N 452 PRO HG3 H N N 453 PRO HD2 H N N 454 PRO HD3 H N N 455 PRO HXT H N N 456 SER N N N N 457 SER CA C N S 458 SER C C N N 459 SER O O N N 460 SER CB C N N 461 SER OG O N N 462 SER OXT O N N 463 SER H H N N 464 SER H2 H N N 465 SER HA H N N 466 SER HB2 H N N 467 SER HB3 H N N 468 SER HG H N N 469 SER HXT H N N 470 THR N N N N 471 THR CA C N S 472 THR C C N N 473 THR O O N N 474 THR CB C N R 475 THR OG1 O N N 476 THR CG2 C N N 477 THR OXT O N N 478 THR H H N N 479 THR H2 H N N 480 THR HA H N N 481 THR HB H N N 482 THR HG1 H N N 483 THR HG21 H N N 484 THR HG22 H N N 485 THR HG23 H N N 486 THR HXT H N N 487 TRP N N N N 488 TRP CA C N S 489 TRP C C N N 490 TRP O O N N 491 TRP CB C N N 492 TRP CG C Y N 493 TRP CD1 C Y N 494 TRP CD2 C Y N 495 TRP NE1 N Y N 496 TRP CE2 C Y N 497 TRP CE3 C Y N 498 TRP CZ2 C Y N 499 TRP CZ3 C Y N 500 TRP CH2 C Y N 501 TRP OXT O N N 502 TRP H H N N 503 TRP H2 H N N 504 TRP HA H N N 505 TRP HB2 H N N 506 TRP HB3 H N N 507 TRP HD1 H N N 508 TRP HE1 H N N 509 TRP HE3 H N N 510 TRP HZ2 H N N 511 TRP HZ3 H N N 512 TRP HH2 H N N 513 TRP HXT H N N 514 TYR N N N N 515 TYR CA C N S 516 TYR C C N N 517 TYR O O N N 518 TYR CB C N N 519 TYR CG C Y N 520 TYR CD1 C Y N 521 TYR CD2 C Y N 522 TYR CE1 C Y N 523 TYR CE2 C Y N 524 TYR CZ C Y N 525 TYR OH O N N 526 TYR OXT O N N 527 TYR H H N N 528 TYR H2 H N N 529 TYR HA H N N 530 TYR HB2 H N N 531 TYR HB3 H N N 532 TYR HD1 H N N 533 TYR HD2 H N N 534 TYR HE1 H N N 535 TYR HE2 H N N 536 TYR HH H N N 537 TYR HXT H N N 538 VAL N N N N 539 VAL CA C N S 540 VAL C C N N 541 VAL O O N N 542 VAL CB C N N 543 VAL CG1 C N N 544 VAL CG2 C N N 545 VAL OXT O N N 546 VAL H H N N 547 VAL H2 H N N 548 VAL HA H N N 549 VAL HB H N N 550 VAL HG11 H N N 551 VAL HG12 H N N 552 VAL HG13 H N N 553 VAL HG21 H N N 554 VAL HG22 H N N 555 VAL HG23 H N N 556 VAL HXT H N N 557 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 1N7 N1 C24 sing N N 1 1N7 C24 O1 doub N N 2 1N7 C24 C23 sing N N 3 1N7 C23 C22 sing N N 4 1N7 O2 C13 sing N N 5 1N7 O4 C4 sing N N 6 1N7 O3 C17 sing N N 7 1N7 C22 C20 sing N N 8 1N7 C21 C20 sing N N 9 1N7 C9 C8 sing N N 10 1N7 C9 C20 sing N N 11 1N7 C9 C5 sing N N 12 1N7 C8 C7 sing N N 13 1N7 C13 C14 sing N N 14 1N7 C13 C12 sing N N 15 1N7 C14 C15 sing N N 16 1N7 C6 C7 sing N N 17 1N7 C6 C5 sing N N 18 1N7 C6 C18 sing N N 19 1N7 C4 C5 sing N N 20 1N7 C4 C3 sing N N 21 1N7 C12 C1 sing N N 22 1N7 C5 C10 sing N N 23 1N7 C17 C18 sing N N 24 1N7 C17 C16 sing N N 25 1N7 C19 C3 sing N N 26 1N7 C19 C18 sing N N 27 1N7 C19 C2 sing N N 28 1N7 C15 C16 sing N N 29 1N7 C15 C2 sing N N 30 1N7 C1 C2 sing N N 31 1N7 C2 C11 sing N N 32 1N7 C1 H1 sing N N 33 1N7 C1 H2 sing N N 34 1N7 C3 H3 sing N N 35 1N7 C3 H4 sing N N 36 1N7 C4 H5 sing N N 37 1N7 C6 H6 sing N N 38 1N7 C7 H7 sing N N 39 1N7 C7 H8 sing N N 40 1N7 C8 H9 sing N N 41 1N7 C8 H10 sing N N 42 1N7 C9 H11 sing N N 43 1N7 C10 H12 sing N N 44 1N7 C10 H13 sing N N 45 1N7 C10 H14 sing N N 46 1N7 C11 H15 sing N N 47 1N7 C11 H16 sing N N 48 1N7 C11 H17 sing N N 49 1N7 C12 H18 sing N N 50 1N7 C12 H19 sing N N 51 1N7 C13 H20 sing N N 52 1N7 C14 H21 sing N N 53 1N7 C14 H22 sing N N 54 1N7 C15 H23 sing N N 55 1N7 C16 H24 sing N N 56 1N7 C16 H25 sing N N 57 1N7 C17 H26 sing N N 58 1N7 C18 H27 sing N N 59 1N7 C19 H28 sing N N 60 1N7 C20 H29 sing N N 61 1N7 C21 H30 sing N N 62 1N7 C21 H31 sing N N 63 1N7 C21 H32 sing N N 64 1N7 C22 H33 sing N N 65 1N7 C22 H34 sing N N 66 1N7 C23 H35 sing N N 67 1N7 C23 H36 sing N N 68 1N7 N1 H41 sing N N 69 1N7 O2 H43 sing N N 70 1N7 O3 H44 sing N N 71 1N7 O4 H45 sing N N 72 1N7 N1 C25 sing N N 73 1N7 C25 C26 sing N N 74 1N7 C26 C27 sing N N 75 1N7 C27 N2 sing N N 76 1N7 N2 C28 sing N N 77 1N7 N2 C29 sing N N 78 1N7 N2 C30 sing N N 79 1N7 C28 C31 sing N N 80 1N7 C31 C32 sing N N 81 1N7 C31 O5 sing N N 82 1N7 C32 S1 sing N N 83 1N7 S1 O7 doub N N 84 1N7 S1 O8 sing N N 85 1N7 S1 O6 doub N N 86 1N7 C25 H37 sing N N 87 1N7 C25 H38 sing N N 88 1N7 C26 H39 sing N N 89 1N7 C26 H40 sing N N 90 1N7 C27 H42 sing N N 91 1N7 C27 H46 sing N N 92 1N7 C28 H47 sing N N 93 1N7 C28 H48 sing N N 94 1N7 C29 H49 sing N N 95 1N7 C29 H50 sing N N 96 1N7 C29 H51 sing N N 97 1N7 C30 H52 sing N N 98 1N7 C30 H53 sing N N 99 1N7 C30 H54 sing N N 100 1N7 C31 H55 sing N N 101 1N7 C32 H56 sing N N 102 1N7 C32 H57 sing N N 103 1N7 O5 H58 sing N N 104 1N7 O8 H59 sing N N 105 ALA N CA sing N N 106 ALA N H sing N N 107 ALA N H2 sing N N 108 ALA CA C sing N N 109 ALA CA CB sing N N 110 ALA CA HA sing N N 111 ALA C O doub N N 112 ALA C OXT sing N N 113 ALA CB HB1 sing N N 114 ALA CB HB2 sing N N 115 ALA CB HB3 sing N N 116 ALA OXT HXT sing N N 117 ARG N CA sing N N 118 ARG N H sing N N 119 ARG N H2 sing N N 120 ARG CA C sing N N 121 ARG CA CB sing N N 122 ARG CA HA sing N N 123 ARG C O doub N N 124 ARG C OXT sing N N 125 ARG CB CG sing N N 126 ARG CB HB2 sing N N 127 ARG CB HB3 sing N N 128 ARG CG CD sing N N 129 ARG CG HG2 sing N N 130 ARG CG HG3 sing N N 131 ARG CD NE sing N N 132 ARG CD HD2 sing N N 133 ARG CD HD3 sing N N 134 ARG NE CZ sing N N 135 ARG NE HE sing N N 136 ARG CZ NH1 sing N N 137 ARG CZ NH2 doub N N 138 ARG NH1 HH11 sing N N 139 ARG NH1 HH12 sing N N 140 ARG NH2 HH21 sing N N 141 ARG NH2 HH22 sing N N 142 ARG OXT HXT sing N N 143 ASN N CA sing N N 144 ASN N H sing N N 145 ASN N H2 sing N N 146 ASN CA C sing N N 147 ASN CA CB sing N N 148 ASN CA HA sing N N 149 ASN C O doub N N 150 ASN C OXT sing N N 151 ASN CB CG sing N N 152 ASN CB HB2 sing N N 153 ASN CB HB3 sing N N 154 ASN CG OD1 doub N N 155 ASN CG ND2 sing N N 156 ASN ND2 HD21 sing N N 157 ASN ND2 HD22 sing N N 158 ASN OXT HXT sing N N 159 ASP N CA sing N N 160 ASP N H sing N N 161 ASP N H2 sing N N 162 ASP CA C sing N N 163 ASP CA CB sing N N 164 ASP CA HA sing N N 165 ASP C O doub N N 166 ASP C OXT sing N N 167 ASP CB CG sing N N 168 ASP CB HB2 sing N N 169 ASP CB HB3 sing N N 170 ASP CG OD1 doub N N 171 ASP CG OD2 sing N N 172 ASP OD2 HD2 sing N N 173 ASP OXT HXT sing N N 174 GLN N CA sing N N 175 GLN N H sing N N 176 GLN N H2 sing N N 177 GLN CA C sing N N 178 GLN CA CB sing N N 179 GLN CA HA sing N N 180 GLN C O doub N N 181 GLN C OXT sing N N 182 GLN CB CG sing N N 183 GLN CB HB2 sing N N 184 GLN CB HB3 sing N N 185 GLN CG CD sing N N 186 GLN CG HG2 sing N N 187 GLN CG HG3 sing N N 188 GLN CD OE1 doub N N 189 GLN CD NE2 sing N N 190 GLN NE2 HE21 sing N N 191 GLN NE2 HE22 sing N N 192 GLN OXT HXT sing N N 193 GLU N CA sing N N 194 GLU N H sing N N 195 GLU N H2 sing N N 196 GLU CA C sing N N 197 GLU CA CB sing N N 198 GLU CA HA sing N N 199 GLU C O doub N N 200 GLU C OXT sing N N 201 GLU CB CG sing N N 202 GLU CB HB2 sing N N 203 GLU CB HB3 sing N N 204 GLU CG CD sing N N 205 GLU CG HG2 sing N N 206 GLU CG HG3 sing N N 207 GLU CD OE1 doub N N 208 GLU CD OE2 sing N N 209 GLU OE2 HE2 sing N N 210 GLU OXT HXT sing N N 211 GLY N CA sing N N 212 GLY N H sing N N 213 GLY N H2 sing N N 214 GLY CA C sing N N 215 GLY CA HA2 sing N N 216 GLY CA HA3 sing N N 217 GLY C O doub N N 218 GLY C OXT sing N N 219 GLY OXT HXT sing N N 220 HIS N CA sing N N 221 HIS N H sing N N 222 HIS N H2 sing N N 223 HIS CA C sing N N 224 HIS CA CB sing N N 225 HIS CA HA sing N N 226 HIS C O doub N N 227 HIS C OXT sing N N 228 HIS CB CG sing N N 229 HIS CB HB2 sing N N 230 HIS CB HB3 sing N N 231 HIS CG ND1 sing Y N 232 HIS CG CD2 doub Y N 233 HIS ND1 CE1 doub Y N 234 HIS ND1 HD1 sing N N 235 HIS CD2 NE2 sing Y N 236 HIS CD2 HD2 sing N N 237 HIS CE1 NE2 sing Y N 238 HIS CE1 HE1 sing N N 239 HIS NE2 HE2 sing N N 240 HIS OXT HXT sing N N 241 ILE N CA sing N N 242 ILE N H sing N N 243 ILE N H2 sing N N 244 ILE CA C sing N N 245 ILE CA CB sing N N 246 ILE CA HA sing N N 247 ILE C O doub N N 248 ILE C OXT sing N N 249 ILE CB CG1 sing N N 250 ILE CB CG2 sing N N 251 ILE CB HB sing N N 252 ILE CG1 CD1 sing N N 253 ILE CG1 HG12 sing N N 254 ILE CG1 HG13 sing N N 255 ILE CG2 HG21 sing N N 256 ILE CG2 HG22 sing N N 257 ILE CG2 HG23 sing N N 258 ILE CD1 HD11 sing N N 259 ILE CD1 HD12 sing N N 260 ILE CD1 HD13 sing N N 261 ILE OXT HXT sing N N 262 LEU N CA sing N N 263 LEU N H sing N N 264 LEU N H2 sing N N 265 LEU CA C sing N N 266 LEU CA CB sing N N 267 LEU CA HA sing N N 268 LEU C O doub N N 269 LEU C OXT sing N N 270 LEU CB CG sing N N 271 LEU CB HB2 sing N N 272 LEU CB HB3 sing N N 273 LEU CG CD1 sing N N 274 LEU CG CD2 sing N N 275 LEU CG HG sing N N 276 LEU CD1 HD11 sing N N 277 LEU CD1 HD12 sing N N 278 LEU CD1 HD13 sing N N 279 LEU CD2 HD21 sing N N 280 LEU CD2 HD22 sing N N 281 LEU CD2 HD23 sing N N 282 LEU OXT HXT sing N N 283 LMT C1B C2B sing N N 284 LMT C1B O1B sing N N 285 LMT C1B O5B sing N N 286 LMT C1B H1B sing N N 287 LMT C2B C3B sing N N 288 LMT C2B O2B sing N N 289 LMT C2B H2B sing N N 290 LMT C3B C4B sing N N 291 LMT C3B O3B sing N N 292 LMT C3B H3B sing N N 293 LMT C4B C5B sing N N 294 LMT C4B "O4'" sing N N 295 LMT C4B H4B sing N N 296 LMT C5B C6B sing N N 297 LMT C5B O5B sing N N 298 LMT C5B H5B sing N N 299 LMT C6B O6B sing N N 300 LMT C6B "H6'2" sing N N 301 LMT C6B "H6'1" sing N N 302 LMT O1B "C4'" sing N N 303 LMT O2B H2O1 sing N N 304 LMT O3B H3O1 sing N N 305 LMT "O4'" H4O1 sing N N 306 LMT O6B H6B sing N N 307 LMT "C1'" "C2'" sing N N 308 LMT "C1'" "O1'" sing N N 309 LMT "C1'" "O5'" sing N N 310 LMT "C1'" "H1'" sing N N 311 LMT "C2'" "C3'" sing N N 312 LMT "C2'" "O2'" sing N N 313 LMT "C2'" "H2'" sing N N 314 LMT "C3'" "C4'" sing N N 315 LMT "C3'" "O3'" sing N N 316 LMT "C3'" "H3'" sing N N 317 LMT "C4'" "C5'" sing N N 318 LMT "C4'" "H4'" sing N N 319 LMT "C5'" "C6'" sing N N 320 LMT "C5'" "O5'" sing N N 321 LMT "C5'" "H5'" sing N N 322 LMT "C6'" "O6'" sing N N 323 LMT "C6'" H6D sing N N 324 LMT "C6'" H6E sing N N 325 LMT "O1'" C1 sing N N 326 LMT "O2'" H2O2 sing N N 327 LMT "O3'" H3O2 sing N N 328 LMT "O6'" "H6'" sing N N 329 LMT C1 C2 sing N N 330 LMT C1 H12 sing N N 331 LMT C1 H11 sing N N 332 LMT C2 C3 sing N N 333 LMT C2 H22 sing N N 334 LMT C2 H21 sing N N 335 LMT C3 C4 sing N N 336 LMT C3 H32 sing N N 337 LMT C3 H31 sing N N 338 LMT C4 C5 sing N N 339 LMT C4 H42 sing N N 340 LMT C4 H41 sing N N 341 LMT C5 C6 sing N N 342 LMT C5 H52 sing N N 343 LMT C5 H51 sing N N 344 LMT C6 C7 sing N N 345 LMT C6 H62 sing N N 346 LMT C6 H61 sing N N 347 LMT C7 C8 sing N N 348 LMT C7 H72 sing N N 349 LMT C7 H71 sing N N 350 LMT C8 C9 sing N N 351 LMT C8 H82 sing N N 352 LMT C8 H81 sing N N 353 LMT C9 C10 sing N N 354 LMT C9 H92 sing N N 355 LMT C9 H91 sing N N 356 LMT C10 C11 sing N N 357 LMT C10 H102 sing N N 358 LMT C10 H101 sing N N 359 LMT C11 C12 sing N N 360 LMT C11 H112 sing N N 361 LMT C11 H111 sing N N 362 LMT C12 H123 sing N N 363 LMT C12 H122 sing N N 364 LMT C12 H121 sing N N 365 LYS N CA sing N N 366 LYS N H sing N N 367 LYS N H2 sing N N 368 LYS CA C sing N N 369 LYS CA CB sing N N 370 LYS CA HA sing N N 371 LYS C O doub N N 372 LYS C OXT sing N N 373 LYS CB CG sing N N 374 LYS CB HB2 sing N N 375 LYS CB HB3 sing N N 376 LYS CG CD sing N N 377 LYS CG HG2 sing N N 378 LYS CG HG3 sing N N 379 LYS CD CE sing N N 380 LYS CD HD2 sing N N 381 LYS CD HD3 sing N N 382 LYS CE NZ sing N N 383 LYS CE HE2 sing N N 384 LYS CE HE3 sing N N 385 LYS NZ HZ1 sing N N 386 LYS NZ HZ2 sing N N 387 LYS NZ HZ3 sing N N 388 LYS OXT HXT sing N N 389 MET N CA sing N N 390 MET N H sing N N 391 MET N H2 sing N N 392 MET CA C sing N N 393 MET CA CB sing N N 394 MET CA HA sing N N 395 MET C O doub N N 396 MET C OXT sing N N 397 MET CB CG sing N N 398 MET CB HB2 sing N N 399 MET CB HB3 sing N N 400 MET CG SD sing N N 401 MET CG HG2 sing N N 402 MET CG HG3 sing N N 403 MET SD CE sing N N 404 MET CE HE1 sing N N 405 MET CE HE2 sing N N 406 MET CE HE3 sing N N 407 MET OXT HXT sing N N 408 PHE N CA sing N N 409 PHE N H sing N N 410 PHE N H2 sing N N 411 PHE CA C sing N N 412 PHE CA CB sing N N 413 PHE CA HA sing N N 414 PHE C O doub N N 415 PHE C OXT sing N N 416 PHE CB CG sing N N 417 PHE CB HB2 sing N N 418 PHE CB HB3 sing N N 419 PHE CG CD1 doub Y N 420 PHE CG CD2 sing Y N 421 PHE CD1 CE1 sing Y N 422 PHE CD1 HD1 sing N N 423 PHE CD2 CE2 doub Y N 424 PHE CD2 HD2 sing N N 425 PHE CE1 CZ doub Y N 426 PHE CE1 HE1 sing N N 427 PHE CE2 CZ sing Y N 428 PHE CE2 HE2 sing N N 429 PHE CZ HZ sing N N 430 PHE OXT HXT sing N N 431 PRO N CA sing N N 432 PRO N CD sing N N 433 PRO N H sing N N 434 PRO CA C sing N N 435 PRO CA CB sing N N 436 PRO CA HA sing N N 437 PRO C O doub N N 438 PRO C OXT sing N N 439 PRO CB CG sing N N 440 PRO CB HB2 sing N N 441 PRO CB HB3 sing N N 442 PRO CG CD sing N N 443 PRO CG HG2 sing N N 444 PRO CG HG3 sing N N 445 PRO CD HD2 sing N N 446 PRO CD HD3 sing N N 447 PRO OXT HXT sing N N 448 SER N CA sing N N 449 SER N H sing N N 450 SER N H2 sing N N 451 SER CA C sing N N 452 SER CA CB sing N N 453 SER CA HA sing N N 454 SER C O doub N N 455 SER C OXT sing N N 456 SER CB OG sing N N 457 SER CB HB2 sing N N 458 SER CB HB3 sing N N 459 SER OG HG sing N N 460 SER OXT HXT sing N N 461 THR N CA sing N N 462 THR N H sing N N 463 THR N H2 sing N N 464 THR CA C sing N N 465 THR CA CB sing N N 466 THR CA HA sing N N 467 THR C O doub N N 468 THR C OXT sing N N 469 THR CB OG1 sing N N 470 THR CB CG2 sing N N 471 THR CB HB sing N N 472 THR OG1 HG1 sing N N 473 THR CG2 HG21 sing N N 474 THR CG2 HG22 sing N N 475 THR CG2 HG23 sing N N 476 THR OXT HXT sing N N 477 TRP N CA sing N N 478 TRP N H sing N N 479 TRP N H2 sing N N 480 TRP CA C sing N N 481 TRP CA CB sing N N 482 TRP CA HA sing N N 483 TRP C O doub N N 484 TRP C OXT sing N N 485 TRP CB CG sing N N 486 TRP CB HB2 sing N N 487 TRP CB HB3 sing N N 488 TRP CG CD1 doub Y N 489 TRP CG CD2 sing Y N 490 TRP CD1 NE1 sing Y N 491 TRP CD1 HD1 sing N N 492 TRP CD2 CE2 doub Y N 493 TRP CD2 CE3 sing Y N 494 TRP NE1 CE2 sing Y N 495 TRP NE1 HE1 sing N N 496 TRP CE2 CZ2 sing Y N 497 TRP CE3 CZ3 doub Y N 498 TRP CE3 HE3 sing N N 499 TRP CZ2 CH2 doub Y N 500 TRP CZ2 HZ2 sing N N 501 TRP CZ3 CH2 sing Y N 502 TRP CZ3 HZ3 sing N N 503 TRP CH2 HH2 sing N N 504 TRP OXT HXT sing N N 505 TYR N CA sing N N 506 TYR N H sing N N 507 TYR N H2 sing N N 508 TYR CA C sing N N 509 TYR CA CB sing N N 510 TYR CA HA sing N N 511 TYR C O doub N N 512 TYR C OXT sing N N 513 TYR CB CG sing N N 514 TYR CB HB2 sing N N 515 TYR CB HB3 sing N N 516 TYR CG CD1 doub Y N 517 TYR CG CD2 sing Y N 518 TYR CD1 CE1 sing Y N 519 TYR CD1 HD1 sing N N 520 TYR CD2 CE2 doub Y N 521 TYR CD2 HD2 sing N N 522 TYR CE1 CZ doub Y N 523 TYR CE1 HE1 sing N N 524 TYR CE2 CZ sing Y N 525 TYR CE2 HE2 sing N N 526 TYR CZ OH sing N N 527 TYR OH HH sing N N 528 TYR OXT HXT sing N N 529 VAL N CA sing N N 530 VAL N H sing N N 531 VAL N H2 sing N N 532 VAL CA C sing N N 533 VAL CA CB sing N N 534 VAL CA HA sing N N 535 VAL C O doub N N 536 VAL C OXT sing N N 537 VAL CB CG1 sing N N 538 VAL CB CG2 sing N N 539 VAL CB HB sing N N 540 VAL CG1 HG11 sing N N 541 VAL CG1 HG12 sing N N 542 VAL CG1 HG13 sing N N 543 VAL CG2 HG21 sing N N 544 VAL CG2 HG22 sing N N 545 VAL CG2 HG23 sing N N 546 VAL OXT HXT sing N N 547 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Japan Society for the Promotion of Science (JSPS)' Japan 17K17795 1 'Japan Society for the Promotion of Science (JSPS)' Japan 20K09193 2 'Japan Society for the Promotion of Science (JSPS)' Japan 24K02168 3 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5yuc _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'I 4 2 2' _space_group.name_Hall 'I 4 2' _space_group.IT_number 97 _space_group.crystal_system tetragonal _space_group.id 1 # _atom_sites.entry_id 24JT _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.007795 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007795 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004942 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 5.96793 ? ? ? 14.89577 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CA ? ? 16.26893 3.65395 ? ? 3.58509 77.28589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 6.96715 ? ? ? 11.43723 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 15.91112 ? ? ? 10.84690 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #