data_24KU # _entry.id 24KU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.413 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 24KU pdb_000024ku 10.2210/pdb24ku/pdb WWPDB D_1300071341 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-06-10 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 24KU _pdbx_database_status.recvd_initial_deposition_date 2026-03-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 24JD _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email takujio@yamanashi.ac.jp _pdbx_contact_author.name_first Takuji _pdbx_contact_author.name_last Oyama _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-3411-7608 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Oyama, T.' 1 0000-0002-3411-7608 'Ishino, Y.' 2 ? # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_patent _citation.unpublished_flag ? ? ? ? ? ? ? US ? ? primary 'Acta Crystallogr.,Sect.F' ACSFEN ? 2053-230X ? ? 82 ? 216 221 'Crystal structures of PCNA1 and PCNA2 from Aeropyrum pernix: implications for a distorted heterotrimeric sliding clamp.' 2026 ? 10.1107/S2053230X26003687 42153239 ? ? ? ? ? ? ? ? ? US ? ? 1 J.Bacteriol. JOBAAY 0353 1098-5530 ? ? ? ? ? ? ;Three proliferating cell nuclear antigen-like proteins found in the hyperthermophilic archaeon Aeropyrum pernix: interactions with the two DNA polymerases. ; 2002 ? 10.1128/JB.184.3.687-694.2002 11790738 ? ? ? ? ? ? ? ? ? UK ? ? 2 Mol.Microbiol. MOMIEE 0353 1365-2958 ? ? ? ? ? ? 'Specific interactions of three proliferating cell nuclear antigens with replication-related proteins in Aeropyrum pernix.' 2007 ? 10.1111/j.1365-2958.2007.05645.x 17493121 ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, T.' 1 ? primary 'Ishino, S.' 2 ? primary 'Ishino, Y.' 3 0000-0001-9419-0826 primary 'Oyama, T.' 4 0000-0002-3411-7608 1 'Daimon, K.' 5 ? 1 'Kawarabayasi, Y.' 6 ? 1 'Kikuchi, H.' 7 ? 1 'Sako, Y.' 8 ? 1 'Ishino, Y.' 9 ? 2 'Imamura, K.' 10 ? 2 'Fukunaga, K.' 11 ? 2 'Kawarabayasi, Y.' 12 ? 2 'Ishino, Y.' 13 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DNA polymerase sliding clamp' 29479.850 1 ? ? ? ? 2 water nat water 18.015 89 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Proliferating cell nuclear antigen homolog,PCNA' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSSEATLDSEFTDYKAMFRYEAKVFKELVDSVSKILDEGLFIITGEGLRLRGMDPARVALVDIEIPSSSFFDFYMAGDVE RVELGVNMETLKGVVARAKKGDQLEVRVREDKVLFIVESVVLRRYLLPNLEVIVDVPEDISLEFDATATVIADVVKKTLR DVELVGDIVEFDAGEDYLSIRSVGPERRRVETRLTRESPALIDLEVKEPATSRYDVGYLKRMLGVAKIAESIELSFSTDK PLKMVFKSPDGSRVTYLLAPSTG ; _entity_poly.pdbx_seq_one_letter_code_can ;MSSEATLDSEFTDYKAMFRYEAKVFKELVDSVSKILDEGLFIITGEGLRLRGMDPARVALVDIEIPSSSFFDFYMAGDVE RVELGVNMETLKGVVARAKKGDQLEVRVREDKVLFIVESVVLRRYLLPNLEVIVDVPEDISLEFDATATVIADVVKKTLR DVELVGDIVEFDAGEDYLSIRSVGPERRRVETRLTRESPALIDLEVKEPATSRYDVGYLKRMLGVAKIAESIELSFSTDK PLKMVFKSPDGSRVTYLLAPSTG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 SER n 1 4 GLU n 1 5 ALA n 1 6 THR n 1 7 LEU n 1 8 ASP n 1 9 SER n 1 10 GLU n 1 11 PHE n 1 12 THR n 1 13 ASP n 1 14 TYR n 1 15 LYS n 1 16 ALA n 1 17 MET n 1 18 PHE n 1 19 ARG n 1 20 TYR n 1 21 GLU n 1 22 ALA n 1 23 LYS n 1 24 VAL n 1 25 PHE n 1 26 LYS n 1 27 GLU n 1 28 LEU n 1 29 VAL n 1 30 ASP n 1 31 SER n 1 32 VAL n 1 33 SER n 1 34 LYS n 1 35 ILE n 1 36 LEU n 1 37 ASP n 1 38 GLU n 1 39 GLY n 1 40 LEU n 1 41 PHE n 1 42 ILE n 1 43 ILE n 1 44 THR n 1 45 GLY n 1 46 GLU n 1 47 GLY n 1 48 LEU n 1 49 ARG n 1 50 LEU n 1 51 ARG n 1 52 GLY n 1 53 MET n 1 54 ASP n 1 55 PRO n 1 56 ALA n 1 57 ARG n 1 58 VAL n 1 59 ALA n 1 60 LEU n 1 61 VAL n 1 62 ASP n 1 63 ILE n 1 64 GLU n 1 65 ILE n 1 66 PRO n 1 67 SER n 1 68 SER n 1 69 SER n 1 70 PHE n 1 71 PHE n 1 72 ASP n 1 73 PHE n 1 74 TYR n 1 75 MET n 1 76 ALA n 1 77 GLY n 1 78 ASP n 1 79 VAL n 1 80 GLU n 1 81 ARG n 1 82 VAL n 1 83 GLU n 1 84 LEU n 1 85 GLY n 1 86 VAL n 1 87 ASN n 1 88 MET n 1 89 GLU n 1 90 THR n 1 91 LEU n 1 92 LYS n 1 93 GLY n 1 94 VAL n 1 95 VAL n 1 96 ALA n 1 97 ARG n 1 98 ALA n 1 99 LYS n 1 100 LYS n 1 101 GLY n 1 102 ASP n 1 103 GLN n 1 104 LEU n 1 105 GLU n 1 106 VAL n 1 107 ARG n 1 108 VAL n 1 109 ARG n 1 110 GLU n 1 111 ASP n 1 112 LYS n 1 113 VAL n 1 114 LEU n 1 115 PHE n 1 116 ILE n 1 117 VAL n 1 118 GLU n 1 119 SER n 1 120 VAL n 1 121 VAL n 1 122 LEU n 1 123 ARG n 1 124 ARG n 1 125 TYR n 1 126 LEU n 1 127 LEU n 1 128 PRO n 1 129 ASN n 1 130 LEU n 1 131 GLU n 1 132 VAL n 1 133 ILE n 1 134 VAL n 1 135 ASP n 1 136 VAL n 1 137 PRO n 1 138 GLU n 1 139 ASP n 1 140 ILE n 1 141 SER n 1 142 LEU n 1 143 GLU n 1 144 PHE n 1 145 ASP n 1 146 ALA n 1 147 THR n 1 148 ALA n 1 149 THR n 1 150 VAL n 1 151 ILE n 1 152 ALA n 1 153 ASP n 1 154 VAL n 1 155 VAL n 1 156 LYS n 1 157 LYS n 1 158 THR n 1 159 LEU n 1 160 ARG n 1 161 ASP n 1 162 VAL n 1 163 GLU n 1 164 LEU n 1 165 VAL n 1 166 GLY n 1 167 ASP n 1 168 ILE n 1 169 VAL n 1 170 GLU n 1 171 PHE n 1 172 ASP n 1 173 ALA n 1 174 GLY n 1 175 GLU n 1 176 ASP n 1 177 TYR n 1 178 LEU n 1 179 SER n 1 180 ILE n 1 181 ARG n 1 182 SER n 1 183 VAL n 1 184 GLY n 1 185 PRO n 1 186 GLU n 1 187 ARG n 1 188 ARG n 1 189 ARG n 1 190 VAL n 1 191 GLU n 1 192 THR n 1 193 ARG n 1 194 LEU n 1 195 THR n 1 196 ARG n 1 197 GLU n 1 198 SER n 1 199 PRO n 1 200 ALA n 1 201 LEU n 1 202 ILE n 1 203 ASP n 1 204 LEU n 1 205 GLU n 1 206 VAL n 1 207 LYS n 1 208 GLU n 1 209 PRO n 1 210 ALA n 1 211 THR n 1 212 SER n 1 213 ARG n 1 214 TYR n 1 215 ASP n 1 216 VAL n 1 217 GLY n 1 218 TYR n 1 219 LEU n 1 220 LYS n 1 221 ARG n 1 222 MET n 1 223 LEU n 1 224 GLY n 1 225 VAL n 1 226 ALA n 1 227 LYS n 1 228 ILE n 1 229 ALA n 1 230 GLU n 1 231 SER n 1 232 ILE n 1 233 GLU n 1 234 LEU n 1 235 SER n 1 236 PHE n 1 237 SER n 1 238 THR n 1 239 ASP n 1 240 LYS n 1 241 PRO n 1 242 LEU n 1 243 LYS n 1 244 MET n 1 245 VAL n 1 246 PHE n 1 247 LYS n 1 248 SER n 1 249 PRO n 1 250 ASP n 1 251 GLY n 1 252 SER n 1 253 ARG n 1 254 VAL n 1 255 THR n 1 256 TYR n 1 257 LEU n 1 258 LEU n 1 259 ALA n 1 260 PRO n 1 261 SER n 1 262 THR n 1 263 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 263 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'pcn, apy_13070' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Aeropyrum pernix' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 56636 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 SER 9 9 ? ? ? A . n A 1 10 GLU 10 10 ? ? ? A . n A 1 11 PHE 11 11 ? ? ? A . n A 1 12 THR 12 12 ? ? ? A . n A 1 13 ASP 13 13 ? ? ? A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 MET 17 17 17 MET MET A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 MET 53 53 53 MET MET A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 MET 75 75 75 MET MET A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 MET 88 88 88 MET MET A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 GLN 103 103 103 GLN GLN A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 PHE 115 115 115 PHE PHE A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 ARG 123 123 123 ARG ARG A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 TYR 125 125 125 TYR TYR A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 PRO 128 128 128 PRO PRO A . n A 1 129 ASN 129 129 129 ASN ASN A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 PRO 137 137 137 PRO PRO A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 PHE 144 144 144 PHE PHE A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 THR 147 147 147 THR THR A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 THR 149 149 149 THR THR A . n A 1 150 VAL 150 150 150 VAL VAL A . n A 1 151 ILE 151 151 151 ILE ILE A . n A 1 152 ALA 152 152 152 ALA ALA A . n A 1 153 ASP 153 153 153 ASP ASP A . n A 1 154 VAL 154 154 154 VAL VAL A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 LYS 156 156 156 LYS LYS A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 THR 158 158 158 THR THR A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 ARG 160 160 160 ARG ARG A . n A 1 161 ASP 161 161 161 ASP ASP A . n A 1 162 VAL 162 162 162 VAL VAL A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 VAL 165 165 165 VAL VAL A . n A 1 166 GLY 166 166 166 GLY GLY A . n A 1 167 ASP 167 167 167 ASP ASP A . n A 1 168 ILE 168 168 168 ILE ILE A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 GLU 170 170 170 GLU GLU A . n A 1 171 PHE 171 171 171 PHE PHE A . n A 1 172 ASP 172 172 172 ASP ASP A . n A 1 173 ALA 173 173 173 ALA ALA A . n A 1 174 GLY 174 174 174 GLY GLY A . n A 1 175 GLU 175 175 175 GLU GLU A . n A 1 176 ASP 176 176 176 ASP ASP A . n A 1 177 TYR 177 177 177 TYR TYR A . n A 1 178 LEU 178 178 178 LEU LEU A . n A 1 179 SER 179 179 179 SER SER A . n A 1 180 ILE 180 180 180 ILE ILE A . n A 1 181 ARG 181 181 181 ARG ARG A . n A 1 182 SER 182 182 182 SER SER A . n A 1 183 VAL 183 183 183 VAL VAL A . n A 1 184 GLY 184 184 184 GLY GLY A . n A 1 185 PRO 185 185 185 PRO PRO A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 ARG 187 187 187 ARG ARG A . n A 1 188 ARG 188 188 188 ARG ARG A . n A 1 189 ARG 189 189 189 ARG ARG A . n A 1 190 VAL 190 190 190 VAL VAL A . n A 1 191 GLU 191 191 191 GLU GLU A . n A 1 192 THR 192 192 192 THR THR A . n A 1 193 ARG 193 193 193 ARG ARG A . n A 1 194 LEU 194 194 194 LEU LEU A . n A 1 195 THR 195 195 195 THR THR A . n A 1 196 ARG 196 196 196 ARG ARG A . n A 1 197 GLU 197 197 197 GLU GLU A . n A 1 198 SER 198 198 198 SER SER A . n A 1 199 PRO 199 199 199 PRO PRO A . n A 1 200 ALA 200 200 200 ALA ALA A . n A 1 201 LEU 201 201 201 LEU LEU A . n A 1 202 ILE 202 202 202 ILE ILE A . n A 1 203 ASP 203 203 203 ASP ASP A . n A 1 204 LEU 204 204 204 LEU LEU A . n A 1 205 GLU 205 205 205 GLU GLU A . n A 1 206 VAL 206 206 206 VAL VAL A . n A 1 207 LYS 207 207 207 LYS LYS A . n A 1 208 GLU 208 208 208 GLU GLU A . n A 1 209 PRO 209 209 209 PRO PRO A . n A 1 210 ALA 210 210 210 ALA ALA A . n A 1 211 THR 211 211 211 THR THR A . n A 1 212 SER 212 212 212 SER SER A . n A 1 213 ARG 213 213 213 ARG ARG A . n A 1 214 TYR 214 214 214 TYR TYR A . n A 1 215 ASP 215 215 215 ASP ASP A . n A 1 216 VAL 216 216 216 VAL VAL A . n A 1 217 GLY 217 217 217 GLY GLY A . n A 1 218 TYR 218 218 218 TYR TYR A . n A 1 219 LEU 219 219 219 LEU LEU A . n A 1 220 LYS 220 220 220 LYS LYS A . n A 1 221 ARG 221 221 221 ARG ARG A . n A 1 222 MET 222 222 222 MET MET A . n A 1 223 LEU 223 223 223 LEU LEU A . n A 1 224 GLY 224 224 224 GLY GLY A . n A 1 225 VAL 225 225 225 VAL VAL A . n A 1 226 ALA 226 226 226 ALA ALA A . n A 1 227 LYS 227 227 227 LYS LYS A . n A 1 228 ILE 228 228 228 ILE ILE A . n A 1 229 ALA 229 229 229 ALA ALA A . n A 1 230 GLU 230 230 230 GLU GLU A . n A 1 231 SER 231 231 231 SER SER A . n A 1 232 ILE 232 232 232 ILE ILE A . n A 1 233 GLU 233 233 233 GLU GLU A . n A 1 234 LEU 234 234 234 LEU LEU A . n A 1 235 SER 235 235 235 SER SER A . n A 1 236 PHE 236 236 236 PHE PHE A . n A 1 237 SER 237 237 237 SER SER A . n A 1 238 THR 238 238 238 THR THR A . n A 1 239 ASP 239 239 239 ASP ASP A . n A 1 240 LYS 240 240 240 LYS LYS A . n A 1 241 PRO 241 241 241 PRO PRO A . n A 1 242 LEU 242 242 242 LEU LEU A . n A 1 243 LYS 243 243 243 LYS LYS A . n A 1 244 MET 244 244 244 MET MET A . n A 1 245 VAL 245 245 245 VAL VAL A . n A 1 246 PHE 246 246 246 PHE PHE A . n A 1 247 LYS 247 247 247 LYS LYS A . n A 1 248 SER 248 248 248 SER SER A . n A 1 249 PRO 249 249 249 PRO PRO A . n A 1 250 ASP 250 250 250 ASP ASP A . n A 1 251 GLY 251 251 251 GLY GLY A . n A 1 252 SER 252 252 252 SER SER A . n A 1 253 ARG 253 253 253 ARG ARG A . n A 1 254 VAL 254 254 254 VAL VAL A . n A 1 255 THR 255 255 255 THR THR A . n A 1 256 TYR 256 256 256 TYR TYR A . n A 1 257 LEU 257 257 257 LEU LEU A . n A 1 258 LEU 258 258 258 LEU LEU A . n A 1 259 ALA 259 259 259 ALA ALA A . n A 1 260 PRO 260 260 260 PRO PRO A . n A 1 261 SER 261 261 261 SER SER A . n A 1 262 THR 262 262 262 THR THR A . n A 1 263 GLY 263 263 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 83 HOH HOH A . B 2 HOH 2 302 82 HOH HOH A . B 2 HOH 3 303 45 HOH HOH A . B 2 HOH 4 304 86 HOH HOH A . B 2 HOH 5 305 28 HOH HOH A . B 2 HOH 6 306 33 HOH HOH A . B 2 HOH 7 307 75 HOH HOH A . B 2 HOH 8 308 80 HOH HOH A . B 2 HOH 9 309 51 HOH HOH A . B 2 HOH 10 310 32 HOH HOH A . B 2 HOH 11 311 42 HOH HOH A . B 2 HOH 12 312 37 HOH HOH A . B 2 HOH 13 313 12 HOH HOH A . B 2 HOH 14 314 46 HOH HOH A . B 2 HOH 15 315 2 HOH HOH A . B 2 HOH 16 316 84 HOH HOH A . B 2 HOH 17 317 54 HOH HOH A . B 2 HOH 18 318 47 HOH HOH A . B 2 HOH 19 319 34 HOH HOH A . B 2 HOH 20 320 57 HOH HOH A . B 2 HOH 21 321 49 HOH HOH A . B 2 HOH 22 322 53 HOH HOH A . B 2 HOH 23 323 31 HOH HOH A . B 2 HOH 24 324 18 HOH HOH A . B 2 HOH 25 325 10 HOH HOH A . B 2 HOH 26 326 65 HOH HOH A . B 2 HOH 27 327 85 HOH HOH A . B 2 HOH 28 328 71 HOH HOH A . B 2 HOH 29 329 26 HOH HOH A . B 2 HOH 30 330 6 HOH HOH A . B 2 HOH 31 331 22 HOH HOH A . B 2 HOH 32 332 87 HOH HOH A . B 2 HOH 33 333 25 HOH HOH A . B 2 HOH 34 334 61 HOH HOH A . B 2 HOH 35 335 36 HOH HOH A . B 2 HOH 36 336 30 HOH HOH A . B 2 HOH 37 337 58 HOH HOH A . B 2 HOH 38 338 8 HOH HOH A . B 2 HOH 39 339 43 HOH HOH A . B 2 HOH 40 340 11 HOH HOH A . B 2 HOH 41 341 3 HOH HOH A . B 2 HOH 42 342 81 HOH HOH A . B 2 HOH 43 343 38 HOH HOH A . B 2 HOH 44 344 7 HOH HOH A . B 2 HOH 45 345 15 HOH HOH A . B 2 HOH 46 346 39 HOH HOH A . B 2 HOH 47 347 16 HOH HOH A . B 2 HOH 48 348 27 HOH HOH A . B 2 HOH 49 349 60 HOH HOH A . B 2 HOH 50 350 13 HOH HOH A . B 2 HOH 51 351 89 HOH HOH A . B 2 HOH 52 352 14 HOH HOH A . B 2 HOH 53 353 23 HOH HOH A . B 2 HOH 54 354 40 HOH HOH A . B 2 HOH 55 355 66 HOH HOH A . B 2 HOH 56 356 59 HOH HOH A . B 2 HOH 57 357 1 HOH HOH A . B 2 HOH 58 358 41 HOH HOH A . B 2 HOH 59 359 63 HOH HOH A . B 2 HOH 60 360 73 HOH HOH A . B 2 HOH 61 361 20 HOH HOH A . B 2 HOH 62 362 72 HOH HOH A . B 2 HOH 63 363 48 HOH HOH A . B 2 HOH 64 364 74 HOH HOH A . B 2 HOH 65 365 50 HOH HOH A . B 2 HOH 66 366 21 HOH HOH A . B 2 HOH 67 367 52 HOH HOH A . B 2 HOH 68 368 77 HOH HOH A . B 2 HOH 69 369 24 HOH HOH A . B 2 HOH 70 370 4 HOH HOH A . B 2 HOH 71 371 5 HOH HOH A . B 2 HOH 72 372 17 HOH HOH A . B 2 HOH 73 373 55 HOH HOH A . B 2 HOH 74 374 62 HOH HOH A . B 2 HOH 75 375 9 HOH HOH A . B 2 HOH 76 376 29 HOH HOH A . B 2 HOH 77 377 35 HOH HOH A . B 2 HOH 78 378 79 HOH HOH A . B 2 HOH 79 379 19 HOH HOH A . B 2 HOH 80 380 67 HOH HOH A . B 2 HOH 81 381 78 HOH HOH A . B 2 HOH 82 382 70 HOH HOH A . B 2 HOH 83 383 69 HOH HOH A . B 2 HOH 84 384 88 HOH HOH A . B 2 HOH 85 385 56 HOH HOH A . B 2 HOH 86 386 76 HOH HOH A . B 2 HOH 87 387 68 HOH HOH A . B 2 HOH 88 388 44 HOH HOH A . B 2 HOH 89 389 64 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 138 ? CG ? A GLU 138 CG 2 1 Y 1 A GLU 138 ? CD ? A GLU 138 CD 3 1 Y 1 A GLU 138 ? OE1 ? A GLU 138 OE1 4 1 Y 1 A GLU 138 ? OE2 ? A GLU 138 OE2 5 1 Y 1 A ASP 139 ? CG ? A ASP 139 CG 6 1 Y 1 A ASP 139 ? OD1 ? A ASP 139 OD1 7 1 Y 1 A ASP 139 ? OD2 ? A ASP 139 OD2 8 1 Y 1 A GLU 143 ? CG ? A GLU 143 CG 9 1 Y 1 A GLU 143 ? CD ? A GLU 143 CD 10 1 Y 1 A GLU 143 ? OE1 ? A GLU 143 OE1 11 1 Y 1 A GLU 143 ? OE2 ? A GLU 143 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 24KU _cell.details ? _cell.formula_units_Z ? _cell.length_a 68.927 _cell.length_a_esd ? _cell.length_b 68.927 _cell.length_b_esd ? _cell.length_c 120.165 _cell.length_c_esd ? _cell.volume 570895.663 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 24KU _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall 'P 4nw 2abw' _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 24KU _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.42 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.19 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M citrate (pH 4.5), 1.8 M ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU JUPITER 210' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2006-10-13 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'FIXED EXIT SI 111 DOUBLE CRYSTAL' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL38B1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL38B1 _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate 16.49 _reflns.entry_id 24KU _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.60 _reflns.d_resolution_low 45.3 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 72556 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.6 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 20.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.074 _reflns.pdbx_Rpim_I_all 0.031 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.067 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.60 _reflns_shell.d_res_low 1.63 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.4 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 3706 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 7.8 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.429 _reflns_shell.pdbx_Rpim_I_all 0.195 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.916 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 97.7 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.368 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 22.98 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 24KU _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.60 _refine.ls_d_res_low 34.63 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 72556 _refine.ls_number_reflns_R_free 1913 _refine.ls_number_reflns_R_work 68988 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.41 _refine.ls_percent_reflns_R_free 4.92 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1989 _refine.ls_R_factor_R_free 0.2175 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1979 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.07 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.7005 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1842 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.60 _refine_hist.d_res_low 34.63 _refine_hist.number_atoms_solvent 89 _refine_hist.number_atoms_total 2083 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1994 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0072 ? 2035 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.8823 ? 2754 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0583 ? 329 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0079 ? 352 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 21.3622 ? 782 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.60 1.62 . . 165 2605 95.29 . . . . 0.2463 . . . . . . . . . . . . . . . 0.2683 'X-RAY DIFFRACTION' 1.62 1.65 . . 138 2698 95.97 . . . . 0.2339 . . . . . . . . . . . . . . . 0.2851 'X-RAY DIFFRACTION' 1.65 1.67 . . 118 2786 99.73 . . . . 0.2205 . . . . . . . . . . . . . . . 0.2491 'X-RAY DIFFRACTION' 1.67 1.70 . . 140 2743 100.00 . . . . 0.2226 . . . . . . . . . . . . . . . 0.2183 'X-RAY DIFFRACTION' 1.70 1.72 . . 155 2786 99.93 . . . . 0.2301 . . . . . . . . . . . . . . . 0.2753 'X-RAY DIFFRACTION' 1.72 1.75 . . 166 2740 99.97 . . . . 0.2329 . . . . . . . . . . . . . . . 0.3008 'X-RAY DIFFRACTION' 1.75 1.79 . . 116 2779 99.93 . . . . 0.2228 . . . . . . . . . . . . . . . 0.2365 'X-RAY DIFFRACTION' 1.79 1.82 . . 155 2777 99.76 . . . . 0.2336 . . . . . . . . . . . . . . . 0.2828 'X-RAY DIFFRACTION' 1.82 1.86 . . 145 2779 99.76 . . . . 0.2290 . . . . . . . . . . . . . . . 0.2716 'X-RAY DIFFRACTION' 1.86 1.90 . . 121 2798 99.76 . . . . 0.2111 . . . . . . . . . . . . . . . 0.2549 'X-RAY DIFFRACTION' 1.90 1.94 . . 146 2745 99.59 . . . . 0.2055 . . . . . . . . . . . . . . . 0.2675 'X-RAY DIFFRACTION' 1.94 1.99 . . 150 2769 99.69 . . . . 0.2118 . . . . . . . . . . . . . . . 0.2306 'X-RAY DIFFRACTION' 1.99 2.04 . . 152 2745 99.52 . . . . 0.2062 . . . . . . . . . . . . . . . 0.2312 'X-RAY DIFFRACTION' 2.04 2.10 . . 166 2741 99.69 . . . . 0.2034 . . . . . . . . . . . . . . . 0.2455 'X-RAY DIFFRACTION' 2.10 2.17 . . 158 2769 99.59 . . . . 0.1928 . . . . . . . . . . . . . . . 0.2617 'X-RAY DIFFRACTION' 2.17 2.25 . . 129 2748 99.69 . . . . 0.2045 . . . . . . . . . . . . . . . 0.1959 'X-RAY DIFFRACTION' 2.25 2.34 . . 131 2800 99.66 . . . . 0.2049 . . . . . . . . . . . . . . . 0.2265 'X-RAY DIFFRACTION' 2.34 2.45 . . 137 2781 99.86 . . . . 0.2114 . . . . . . . . . . . . . . . 0.2622 'X-RAY DIFFRACTION' 2.45 2.57 . . 115 2801 99.59 . . . . 0.2045 . . . . . . . . . . . . . . . 0.2558 'X-RAY DIFFRACTION' 2.57 2.74 . . 142 2754 99.79 . . . . 0.2054 . . . . . . . . . . . . . . . 0.2232 'X-RAY DIFFRACTION' 2.74 2.95 . . 140 2772 99.59 . . . . 0.2091 . . . . . . . . . . . . . . . 0.1829 'X-RAY DIFFRACTION' 2.95 3.24 . . 156 2742 99.45 . . . . 0.1987 . . . . . . . . . . . . . . . 0.2291 'X-RAY DIFFRACTION' 3.24 3.71 . . 147 2764 99.76 . . . . 0.1707 . . . . . . . . . . . . . . . 0.2065 'X-RAY DIFFRACTION' 3.71 4.67 . . 138 2786 99.86 . . . . 0.1593 . . . . . . . . . . . . . . . 0.1603 'X-RAY DIFFRACTION' 4.67 34.63 . . 142 2780 99.93 . . . . 0.1847 . . . . . . . . . . . . . . . 0.1493 # _struct.entry_id 24KU _struct.title 'Crystal structure of the Aeropyrum pernix PCNA1 monomer' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 24KU _struct_keywords.text 'Sliding clamp, PCNA, Aeropyrum pernix, DNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A401HB34_AERPX _struct_ref.pdbx_db_accession A0A401HB34 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSSEATLDSEFTDYKAMFRYEAKVFKELVDSVSKILDEGLFIITGEGLRLRGMDPARVALVDIEIPSSSFFDFYIAGDVE RVELGVNMETLKGVVARAKKGDQLEVRVREDKVLFIVESVVLRRYLLPNLEVIVDVPEDISLEFDATATVIADVVKKTLR DVELVGDIVEFDAGEDYLSIRSVGPERRRVETRLTRESPALIDLEVKEPATSRYDVGYLKRMLGVAKIAESIELSFSTDK PLKMVFKSPDGSRVTYLLAPSTG ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 24KU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 263 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A401HB34 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 263 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 263 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 24KU _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 75 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code A0A401HB34 _struct_ref_seq_dif.db_mon_id ILE _struct_ref_seq_dif.pdbx_seq_db_seq_num 75 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 75 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 22 ? LYS A 34 ? ALA A 22 LYS A 34 1 ? 13 HELX_P HELX_P2 AA2 SER A 68 ? PHE A 70 ? SER A 68 PHE A 70 5 ? 3 HELX_P HELX_P3 AA3 MET A 88 ? VAL A 95 ? MET A 88 VAL A 95 1 ? 8 HELX_P HELX_P4 AA4 ALA A 152 ? LEU A 164 ? ALA A 152 LEU A 164 1 ? 13 HELX_P HELX_P5 AA5 VAL A 216 ? LEU A 223 ? VAL A 216 LEU A 223 1 ? 8 HELX_P HELX_P6 AA6 GLY A 224 ? ALA A 229 ? GLY A 224 ALA A 229 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ARG _struct_mon_prot_cis.label_seq_id 187 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ARG _struct_mon_prot_cis.auth_seq_id 187 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 ARG _struct_mon_prot_cis.pdbx_label_seq_id_2 188 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 ARG _struct_mon_prot_cis.pdbx_auth_seq_id_2 188 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -7.30 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 9 ? AA3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel AA2 7 8 ? anti-parallel AA2 8 9 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASP A 72 ? MET A 75 ? ASP A 72 MET A 75 AA1 2 ALA A 16 ? GLU A 21 ? ALA A 16 GLU A 21 AA1 3 GLN A 103 ? VAL A 108 ? GLN A 103 VAL A 108 AA1 4 LYS A 112 ? GLU A 118 ? LYS A 112 GLU A 118 AA1 5 LEU A 122 ? PRO A 128 ? LEU A 122 PRO A 128 AA2 1 ARG A 81 ? ASN A 87 ? ARG A 81 ASN A 87 AA2 2 GLU A 38 ? THR A 44 ? GLU A 38 THR A 44 AA2 3 GLY A 47 ? MET A 53 ? GLY A 47 MET A 53 AA2 4 ALA A 59 ? PRO A 66 ? ALA A 59 PRO A 66 AA2 5 ARG A 253 ? LEU A 258 ? ARG A 253 LEU A 258 AA2 6 LEU A 242 ? LYS A 247 ? LEU A 242 LYS A 247 AA2 7 SER A 231 ? PHE A 236 ? SER A 231 PHE A 236 AA2 8 ALA A 146 ? ILE A 151 ? ALA A 146 ILE A 151 AA2 9 LEU A 201 ? VAL A 206 ? LEU A 201 VAL A 206 AA3 1 GLU A 191 ? THR A 195 ? GLU A 191 THR A 195 AA3 2 TYR A 177 ? SER A 182 ? TYR A 177 SER A 182 AA3 3 ILE A 168 ? ALA A 173 ? ILE A 168 ALA A 173 AA3 4 ALA A 210 ? ASP A 215 ? ALA A 210 ASP A 215 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O TYR A 74 ? O TYR A 74 N MET A 17 ? N MET A 17 AA1 2 3 N TYR A 20 ? N TYR A 20 O LEU A 104 ? O LEU A 104 AA1 3 4 N GLN A 103 ? N GLN A 103 O GLU A 118 ? O GLU A 118 AA1 4 5 N VAL A 117 ? N VAL A 117 O ARG A 123 ? O ARG A 123 AA2 1 2 O VAL A 82 ? O VAL A 82 N ILE A 43 ? N ILE A 43 AA2 2 3 N ILE A 42 ? N ILE A 42 O ARG A 49 ? O ARG A 49 AA2 3 4 N LEU A 48 ? N LEU A 48 O ILE A 65 ? O ILE A 65 AA2 4 5 N ASP A 62 ? N ASP A 62 O THR A 255 ? O THR A 255 AA2 5 6 O VAL A 254 ? O VAL A 254 N PHE A 246 ? N PHE A 246 AA2 6 7 O LYS A 243 ? O LYS A 243 N SER A 235 ? N SER A 235 AA2 7 8 O LEU A 234 ? O LEU A 234 N ALA A 148 ? N ALA A 148 AA2 8 9 N THR A 147 ? N THR A 147 O GLU A 205 ? O GLU A 205 AA3 1 2 O LEU A 194 ? O LEU A 194 N LEU A 178 ? N LEU A 178 AA3 2 3 O SER A 179 ? O SER A 179 N ASP A 172 ? N ASP A 172 AA3 3 4 N ALA A 173 ? N ALA A 173 O ALA A 210 ? O ALA A 210 # _pdbx_entry_details.entry_id 24KU _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 119 ? ? -122.36 -141.02 2 1 VAL A 183 ? ? -129.23 -168.92 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x+1/2,z+3/4 3 y+1/2,-x+1/2,z+1/4 4 x+1/2,-y+1/2,-z+1/4 5 -x+1/2,y+1/2,-z+3/4 6 -x,-y,z+1/2 7 y,x,-z 8 -y,-x,-z+1/2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A SER 9 ? A SER 9 5 1 Y 1 A GLU 10 ? A GLU 10 6 1 Y 1 A PHE 11 ? A PHE 11 7 1 Y 1 A THR 12 ? A THR 12 8 1 Y 1 A ASP 13 ? A ASP 13 9 1 Y 1 A GLY 263 ? A GLY 263 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HOH O O N N 123 HOH H1 H N N 124 HOH H2 H N N 125 ILE N N N N 126 ILE CA C N S 127 ILE C C N N 128 ILE O O N N 129 ILE CB C N S 130 ILE CG1 C N N 131 ILE CG2 C N N 132 ILE CD1 C N N 133 ILE OXT O N N 134 ILE H H N N 135 ILE H2 H N N 136 ILE HA H N N 137 ILE HB H N N 138 ILE HG12 H N N 139 ILE HG13 H N N 140 ILE HG21 H N N 141 ILE HG22 H N N 142 ILE HG23 H N N 143 ILE HD11 H N N 144 ILE HD12 H N N 145 ILE HD13 H N N 146 ILE HXT H N N 147 LEU N N N N 148 LEU CA C N S 149 LEU C C N N 150 LEU O O N N 151 LEU CB C N N 152 LEU CG C N N 153 LEU CD1 C N N 154 LEU CD2 C N N 155 LEU OXT O N N 156 LEU H H N N 157 LEU H2 H N N 158 LEU HA H N N 159 LEU HB2 H N N 160 LEU HB3 H N N 161 LEU HG H N N 162 LEU HD11 H N N 163 LEU HD12 H N N 164 LEU HD13 H N N 165 LEU HD21 H N N 166 LEU HD22 H N N 167 LEU HD23 H N N 168 LEU HXT H N N 169 LYS N N N N 170 LYS CA C N S 171 LYS C C N N 172 LYS O O N N 173 LYS CB C N N 174 LYS CG C N N 175 LYS CD C N N 176 LYS CE C N N 177 LYS NZ N N N 178 LYS OXT O N N 179 LYS H H N N 180 LYS H2 H N N 181 LYS HA H N N 182 LYS HB2 H N N 183 LYS HB3 H N N 184 LYS HG2 H N N 185 LYS HG3 H N N 186 LYS HD2 H N N 187 LYS HD3 H N N 188 LYS HE2 H N N 189 LYS HE3 H N N 190 LYS HZ1 H N N 191 LYS HZ2 H N N 192 LYS HZ3 H N N 193 LYS HXT H N N 194 MET N N N N 195 MET CA C N S 196 MET C C N N 197 MET O O N N 198 MET CB C N N 199 MET CG C N N 200 MET SD S N N 201 MET CE C N N 202 MET OXT O N N 203 MET H H N N 204 MET H2 H N N 205 MET HA H N N 206 MET HB2 H N N 207 MET HB3 H N N 208 MET HG2 H N N 209 MET HG3 H N N 210 MET HE1 H N N 211 MET HE2 H N N 212 MET HE3 H N N 213 MET HXT H N N 214 PHE N N N N 215 PHE CA C N S 216 PHE C C N N 217 PHE O O N N 218 PHE CB C N N 219 PHE CG C Y N 220 PHE CD1 C Y N 221 PHE CD2 C Y N 222 PHE CE1 C Y N 223 PHE CE2 C Y N 224 PHE CZ C Y N 225 PHE OXT O N N 226 PHE H H N N 227 PHE H2 H N N 228 PHE HA H N N 229 PHE HB2 H N N 230 PHE HB3 H N N 231 PHE HD1 H N N 232 PHE HD2 H N N 233 PHE HE1 H N N 234 PHE HE2 H N N 235 PHE HZ H N N 236 PHE HXT H N N 237 PRO N N N N 238 PRO CA C N S 239 PRO C C N N 240 PRO O O N N 241 PRO CB C N N 242 PRO CG C N N 243 PRO CD C N N 244 PRO OXT O N N 245 PRO H H N N 246 PRO HA H N N 247 PRO HB2 H N N 248 PRO HB3 H N N 249 PRO HG2 H N N 250 PRO HG3 H N N 251 PRO HD2 H N N 252 PRO HD3 H N N 253 PRO HXT H N N 254 SER N N N N 255 SER CA C N S 256 SER C C N N 257 SER O O N N 258 SER CB C N N 259 SER OG O N N 260 SER OXT O N N 261 SER H H N N 262 SER H2 H N N 263 SER HA H N N 264 SER HB2 H N N 265 SER HB3 H N N 266 SER HG H N N 267 SER HXT H N N 268 THR N N N N 269 THR CA C N S 270 THR C C N N 271 THR O O N N 272 THR CB C N R 273 THR OG1 O N N 274 THR CG2 C N N 275 THR OXT O N N 276 THR H H N N 277 THR H2 H N N 278 THR HA H N N 279 THR HB H N N 280 THR HG1 H N N 281 THR HG21 H N N 282 THR HG22 H N N 283 THR HG23 H N N 284 THR HXT H N N 285 TYR N N N N 286 TYR CA C N S 287 TYR C C N N 288 TYR O O N N 289 TYR CB C N N 290 TYR CG C Y N 291 TYR CD1 C Y N 292 TYR CD2 C Y N 293 TYR CE1 C Y N 294 TYR CE2 C Y N 295 TYR CZ C Y N 296 TYR OH O N N 297 TYR OXT O N N 298 TYR H H N N 299 TYR H2 H N N 300 TYR HA H N N 301 TYR HB2 H N N 302 TYR HB3 H N N 303 TYR HD1 H N N 304 TYR HD2 H N N 305 TYR HE1 H N N 306 TYR HE2 H N N 307 TYR HH H N N 308 TYR HXT H N N 309 VAL N N N N 310 VAL CA C N S 311 VAL C C N N 312 VAL O O N N 313 VAL CB C N N 314 VAL CG1 C N N 315 VAL CG2 C N N 316 VAL OXT O N N 317 VAL H H N N 318 VAL H2 H N N 319 VAL HA H N N 320 VAL HB H N N 321 VAL HG11 H N N 322 VAL HG12 H N N 323 VAL HG13 H N N 324 VAL HG21 H N N 325 VAL HG22 H N N 326 VAL HG23 H N N 327 VAL HXT H N N 328 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HOH O H1 sing N N 116 HOH O H2 sing N N 117 ILE N CA sing N N 118 ILE N H sing N N 119 ILE N H2 sing N N 120 ILE CA C sing N N 121 ILE CA CB sing N N 122 ILE CA HA sing N N 123 ILE C O doub N N 124 ILE C OXT sing N N 125 ILE CB CG1 sing N N 126 ILE CB CG2 sing N N 127 ILE CB HB sing N N 128 ILE CG1 CD1 sing N N 129 ILE CG1 HG12 sing N N 130 ILE CG1 HG13 sing N N 131 ILE CG2 HG21 sing N N 132 ILE CG2 HG22 sing N N 133 ILE CG2 HG23 sing N N 134 ILE CD1 HD11 sing N N 135 ILE CD1 HD12 sing N N 136 ILE CD1 HD13 sing N N 137 ILE OXT HXT sing N N 138 LEU N CA sing N N 139 LEU N H sing N N 140 LEU N H2 sing N N 141 LEU CA C sing N N 142 LEU CA CB sing N N 143 LEU CA HA sing N N 144 LEU C O doub N N 145 LEU C OXT sing N N 146 LEU CB CG sing N N 147 LEU CB HB2 sing N N 148 LEU CB HB3 sing N N 149 LEU CG CD1 sing N N 150 LEU CG CD2 sing N N 151 LEU CG HG sing N N 152 LEU CD1 HD11 sing N N 153 LEU CD1 HD12 sing N N 154 LEU CD1 HD13 sing N N 155 LEU CD2 HD21 sing N N 156 LEU CD2 HD22 sing N N 157 LEU CD2 HD23 sing N N 158 LEU OXT HXT sing N N 159 LYS N CA sing N N 160 LYS N H sing N N 161 LYS N H2 sing N N 162 LYS CA C sing N N 163 LYS CA CB sing N N 164 LYS CA HA sing N N 165 LYS C O doub N N 166 LYS C OXT sing N N 167 LYS CB CG sing N N 168 LYS CB HB2 sing N N 169 LYS CB HB3 sing N N 170 LYS CG CD sing N N 171 LYS CG HG2 sing N N 172 LYS CG HG3 sing N N 173 LYS CD CE sing N N 174 LYS CD HD2 sing N N 175 LYS CD HD3 sing N N 176 LYS CE NZ sing N N 177 LYS CE HE2 sing N N 178 LYS CE HE3 sing N N 179 LYS NZ HZ1 sing N N 180 LYS NZ HZ2 sing N N 181 LYS NZ HZ3 sing N N 182 LYS OXT HXT sing N N 183 MET N CA sing N N 184 MET N H sing N N 185 MET N H2 sing N N 186 MET CA C sing N N 187 MET CA CB sing N N 188 MET CA HA sing N N 189 MET C O doub N N 190 MET C OXT sing N N 191 MET CB CG sing N N 192 MET CB HB2 sing N N 193 MET CB HB3 sing N N 194 MET CG SD sing N N 195 MET CG HG2 sing N N 196 MET CG HG3 sing N N 197 MET SD CE sing N N 198 MET CE HE1 sing N N 199 MET CE HE2 sing N N 200 MET CE HE3 sing N N 201 MET OXT HXT sing N N 202 PHE N CA sing N N 203 PHE N H sing N N 204 PHE N H2 sing N N 205 PHE CA C sing N N 206 PHE CA CB sing N N 207 PHE CA HA sing N N 208 PHE C O doub N N 209 PHE C OXT sing N N 210 PHE CB CG sing N N 211 PHE CB HB2 sing N N 212 PHE CB HB3 sing N N 213 PHE CG CD1 doub Y N 214 PHE CG CD2 sing Y N 215 PHE CD1 CE1 sing Y N 216 PHE CD1 HD1 sing N N 217 PHE CD2 CE2 doub Y N 218 PHE CD2 HD2 sing N N 219 PHE CE1 CZ doub Y N 220 PHE CE1 HE1 sing N N 221 PHE CE2 CZ sing Y N 222 PHE CE2 HE2 sing N N 223 PHE CZ HZ sing N N 224 PHE OXT HXT sing N N 225 PRO N CA sing N N 226 PRO N CD sing N N 227 PRO N H sing N N 228 PRO CA C sing N N 229 PRO CA CB sing N N 230 PRO CA HA sing N N 231 PRO C O doub N N 232 PRO C OXT sing N N 233 PRO CB CG sing N N 234 PRO CB HB2 sing N N 235 PRO CB HB3 sing N N 236 PRO CG CD sing N N 237 PRO CG HG2 sing N N 238 PRO CG HG3 sing N N 239 PRO CD HD2 sing N N 240 PRO CD HD3 sing N N 241 PRO OXT HXT sing N N 242 SER N CA sing N N 243 SER N H sing N N 244 SER N H2 sing N N 245 SER CA C sing N N 246 SER CA CB sing N N 247 SER CA HA sing N N 248 SER C O doub N N 249 SER C OXT sing N N 250 SER CB OG sing N N 251 SER CB HB2 sing N N 252 SER CB HB3 sing N N 253 SER OG HG sing N N 254 SER OXT HXT sing N N 255 THR N CA sing N N 256 THR N H sing N N 257 THR N H2 sing N N 258 THR CA C sing N N 259 THR CA CB sing N N 260 THR CA HA sing N N 261 THR C O doub N N 262 THR C OXT sing N N 263 THR CB OG1 sing N N 264 THR CB CG2 sing N N 265 THR CB HB sing N N 266 THR OG1 HG1 sing N N 267 THR CG2 HG21 sing N N 268 THR CG2 HG22 sing N N 269 THR CG2 HG23 sing N N 270 THR OXT HXT sing N N 271 TYR N CA sing N N 272 TYR N H sing N N 273 TYR N H2 sing N N 274 TYR CA C sing N N 275 TYR CA CB sing N N 276 TYR CA HA sing N N 277 TYR C O doub N N 278 TYR C OXT sing N N 279 TYR CB CG sing N N 280 TYR CB HB2 sing N N 281 TYR CB HB3 sing N N 282 TYR CG CD1 doub Y N 283 TYR CG CD2 sing Y N 284 TYR CD1 CE1 sing Y N 285 TYR CD1 HD1 sing N N 286 TYR CD2 CE2 doub Y N 287 TYR CD2 HD2 sing N N 288 TYR CE1 CZ doub Y N 289 TYR CE1 HE1 sing N N 290 TYR CE2 CZ sing Y N 291 TYR CE2 HE2 sing N N 292 TYR CZ OH sing N N 293 TYR OH HH sing N N 294 TYR OXT HXT sing N N 295 VAL N CA sing N N 296 VAL N H sing N N 297 VAL N H2 sing N N 298 VAL CA C sing N N 299 VAL CA CB sing N N 300 VAL CA HA sing N N 301 VAL C O doub N N 302 VAL C OXT sing N N 303 VAL CB CG1 sing N N 304 VAL CB CG2 sing N N 305 VAL CB HB sing N N 306 VAL CG1 HG11 sing N N 307 VAL CG1 HG12 sing N N 308 VAL CG1 HG13 sing N N 309 VAL CG2 HG21 sing N N 310 VAL CG2 HG22 sing N N 311 VAL CG2 HG23 sing N N 312 VAL OXT HXT sing N N 313 # _pdbx_audit_support.funding_organization 'Japan Science and Technology' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number 07050930 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1GE8 _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 43 21 2' _space_group.name_Hall 'P 4nw 2abw' _space_group.IT_number 96 _space_group.crystal_system tetragonal _space_group.id 1 # _atom_sites.entry_id 24KU _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.014508 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014508 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008322 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #