data_24BL # _entry.id 24BL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.413 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 24BL pdb_000024bl 10.2210/pdb24bl/pdb WWPDB D_1300070835 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-04-22 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 24BL _pdbx_database_status.recvd_initial_deposition_date 2026-02-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBC _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email lanchao2022@sibcb.ac.cn _pdbx_contact_author.name_first Chao _pdbx_contact_author.name_last Lan _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0009-0004-9933-7750 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ding, J.' 1 0000-0001-7029-7346 'Lan, C.' 2 0009-0004-9933-7750 'Chen, Z.' 3 0000-0002-5889-3628 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CN _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Biochim.Biophys.Sin.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1745-7270 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Biochemical and structural studies reveal the substrate specificity and catalytic mechanism of MYG1 as a two-metal ion-dependent 3'→5' exonuclease. ; _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3724/abbs.2026058 _citation.pdbx_database_id_PubMed 41964352 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lan, C.' 1 ? primary 'Chen, Z.' 2 ? primary 'Wang, G.' 3 ? primary 'Ding, J.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'MYG1 exonuclease' 36873.492 1 3.1.-.- E58A ? ? 2 non-polymer syn 'ADENOSINE MONOPHOSPHATE' 347.221 2 ? ? ? ? 3 non-polymer syn 'MANGANESE (II) ION' 54.938 2 ? ? ? ? 4 water nat water 18.015 431 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;APPRIGTHNGTFHCDAALACALLRLLPEYRDAEIVRTRDPEKLASCDIVVDVGGEYDPRRHRYDHHQRSFTETMSSLSPG KPWQTKLSSAGLIYLHFGHKLLAQLLGTSEEDSMVGTLYDKMYENFVEEVDAVDNGISQWAEGEPRYALTTTLSARVARL NPTWNHPDQDTEAGFKRAMDLVQEEFLQRLDFYQHSWLPARALVEEALAQRFQVDPSGEIVELAKGACPWKEHLYHLESG LSPPIAIFFVIYTDQAGQWRIQCVPKEPHSFQSRLPLPEPWRGLRDEALDQVSGIPGCIFVHASGFIGGHHTREGALSMA RATLAQR ; _entity_poly.pdbx_seq_one_letter_code_can ;APPRIGTHNGTFHCDAALACALLRLLPEYRDAEIVRTRDPEKLASCDIVVDVGGEYDPRRHRYDHHQRSFTETMSSLSPG KPWQTKLSSAGLIYLHFGHKLLAQLLGTSEEDSMVGTLYDKMYENFVEEVDAVDNGISQWAEGEPRYALTTTLSARVARL NPTWNHPDQDTEAGFKRAMDLVQEEFLQRLDFYQHSWLPARALVEEALAQRFQVDPSGEIVELAKGACPWKEHLYHLESG LSPPIAIFFVIYTDQAGQWRIQCVPKEPHSFQSRLPLPEPWRGLRDEALDQVSGIPGCIFVHASGFIGGHHTREGALSMA RATLAQR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ADENOSINE MONOPHOSPHATE' AMP 3 'MANGANESE (II) ION' MN 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 PRO n 1 3 PRO n 1 4 ARG n 1 5 ILE n 1 6 GLY n 1 7 THR n 1 8 HIS n 1 9 ASN n 1 10 GLY n 1 11 THR n 1 12 PHE n 1 13 HIS n 1 14 CYS n 1 15 ASP n 1 16 ALA n 1 17 ALA n 1 18 LEU n 1 19 ALA n 1 20 CYS n 1 21 ALA n 1 22 LEU n 1 23 LEU n 1 24 ARG n 1 25 LEU n 1 26 LEU n 1 27 PRO n 1 28 GLU n 1 29 TYR n 1 30 ARG n 1 31 ASP n 1 32 ALA n 1 33 GLU n 1 34 ILE n 1 35 VAL n 1 36 ARG n 1 37 THR n 1 38 ARG n 1 39 ASP n 1 40 PRO n 1 41 GLU n 1 42 LYS n 1 43 LEU n 1 44 ALA n 1 45 SER n 1 46 CYS n 1 47 ASP n 1 48 ILE n 1 49 VAL n 1 50 VAL n 1 51 ASP n 1 52 VAL n 1 53 GLY n 1 54 GLY n 1 55 GLU n 1 56 TYR n 1 57 ASP n 1 58 PRO n 1 59 ARG n 1 60 ARG n 1 61 HIS n 1 62 ARG n 1 63 TYR n 1 64 ASP n 1 65 HIS n 1 66 HIS n 1 67 GLN n 1 68 ARG n 1 69 SER n 1 70 PHE n 1 71 THR n 1 72 GLU n 1 73 THR n 1 74 MET n 1 75 SER n 1 76 SER n 1 77 LEU n 1 78 SER n 1 79 PRO n 1 80 GLY n 1 81 LYS n 1 82 PRO n 1 83 TRP n 1 84 GLN n 1 85 THR n 1 86 LYS n 1 87 LEU n 1 88 SER n 1 89 SER n 1 90 ALA n 1 91 GLY n 1 92 LEU n 1 93 ILE n 1 94 TYR n 1 95 LEU n 1 96 HIS n 1 97 PHE n 1 98 GLY n 1 99 HIS n 1 100 LYS n 1 101 LEU n 1 102 LEU n 1 103 ALA n 1 104 GLN n 1 105 LEU n 1 106 LEU n 1 107 GLY n 1 108 THR n 1 109 SER n 1 110 GLU n 1 111 GLU n 1 112 ASP n 1 113 SER n 1 114 MET n 1 115 VAL n 1 116 GLY n 1 117 THR n 1 118 LEU n 1 119 TYR n 1 120 ASP n 1 121 LYS n 1 122 MET n 1 123 TYR n 1 124 GLU n 1 125 ASN n 1 126 PHE n 1 127 VAL n 1 128 GLU n 1 129 GLU n 1 130 VAL n 1 131 ASP n 1 132 ALA n 1 133 VAL n 1 134 ASP n 1 135 ASN n 1 136 GLY n 1 137 ILE n 1 138 SER n 1 139 GLN n 1 140 TRP n 1 141 ALA n 1 142 GLU n 1 143 GLY n 1 144 GLU n 1 145 PRO n 1 146 ARG n 1 147 TYR n 1 148 ALA n 1 149 LEU n 1 150 THR n 1 151 THR n 1 152 THR n 1 153 LEU n 1 154 SER n 1 155 ALA n 1 156 ARG n 1 157 VAL n 1 158 ALA n 1 159 ARG n 1 160 LEU n 1 161 ASN n 1 162 PRO n 1 163 THR n 1 164 TRP n 1 165 ASN n 1 166 HIS n 1 167 PRO n 1 168 ASP n 1 169 GLN n 1 170 ASP n 1 171 THR n 1 172 GLU n 1 173 ALA n 1 174 GLY n 1 175 PHE n 1 176 LYS n 1 177 ARG n 1 178 ALA n 1 179 MET n 1 180 ASP n 1 181 LEU n 1 182 VAL n 1 183 GLN n 1 184 GLU n 1 185 GLU n 1 186 PHE n 1 187 LEU n 1 188 GLN n 1 189 ARG n 1 190 LEU n 1 191 ASP n 1 192 PHE n 1 193 TYR n 1 194 GLN n 1 195 HIS n 1 196 SER n 1 197 TRP n 1 198 LEU n 1 199 PRO n 1 200 ALA n 1 201 ARG n 1 202 ALA n 1 203 LEU n 1 204 VAL n 1 205 GLU n 1 206 GLU n 1 207 ALA n 1 208 LEU n 1 209 ALA n 1 210 GLN n 1 211 ARG n 1 212 PHE n 1 213 GLN n 1 214 VAL n 1 215 ASP n 1 216 PRO n 1 217 SER n 1 218 GLY n 1 219 GLU n 1 220 ILE n 1 221 VAL n 1 222 GLU n 1 223 LEU n 1 224 ALA n 1 225 LYS n 1 226 GLY n 1 227 ALA n 1 228 CYS n 1 229 PRO n 1 230 TRP n 1 231 LYS n 1 232 GLU n 1 233 HIS n 1 234 LEU n 1 235 TYR n 1 236 HIS n 1 237 LEU n 1 238 GLU n 1 239 SER n 1 240 GLY n 1 241 LEU n 1 242 SER n 1 243 PRO n 1 244 PRO n 1 245 ILE n 1 246 ALA n 1 247 ILE n 1 248 PHE n 1 249 PHE n 1 250 VAL n 1 251 ILE n 1 252 TYR n 1 253 THR n 1 254 ASP n 1 255 GLN n 1 256 ALA n 1 257 GLY n 1 258 GLN n 1 259 TRP n 1 260 ARG n 1 261 ILE n 1 262 GLN n 1 263 CYS n 1 264 VAL n 1 265 PRO n 1 266 LYS n 1 267 GLU n 1 268 PRO n 1 269 HIS n 1 270 SER n 1 271 PHE n 1 272 GLN n 1 273 SER n 1 274 ARG n 1 275 LEU n 1 276 PRO n 1 277 LEU n 1 278 PRO n 1 279 GLU n 1 280 PRO n 1 281 TRP n 1 282 ARG n 1 283 GLY n 1 284 LEU n 1 285 ARG n 1 286 ASP n 1 287 GLU n 1 288 ALA n 1 289 LEU n 1 290 ASP n 1 291 GLN n 1 292 VAL n 1 293 SER n 1 294 GLY n 1 295 ILE n 1 296 PRO n 1 297 GLY n 1 298 CYS n 1 299 ILE n 1 300 PHE n 1 301 VAL n 1 302 HIS n 1 303 ALA n 1 304 SER n 1 305 GLY n 1 306 PHE n 1 307 ILE n 1 308 GLY n 1 309 GLY n 1 310 HIS n 1 311 HIS n 1 312 THR n 1 313 ARG n 1 314 GLU n 1 315 GLY n 1 316 ALA n 1 317 LEU n 1 318 SER n 1 319 MET n 1 320 ALA n 1 321 ARG n 1 322 ALA n 1 323 THR n 1 324 LEU n 1 325 ALA n 1 326 GLN n 1 327 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 327 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MYG1, C12orf10' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 AMP non-polymer . 'ADENOSINE MONOPHOSPHATE' ? 'C10 H14 N5 O7 P' 347.221 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 43 43 ALA ALA A . n A 1 2 PRO 2 44 44 PRO PRO A . n A 1 3 PRO 3 45 45 PRO PRO A . n A 1 4 ARG 4 46 46 ARG ARG A . n A 1 5 ILE 5 47 47 ILE ILE A . n A 1 6 GLY 6 48 48 GLY GLY A . n A 1 7 THR 7 49 49 THR THR A . n A 1 8 HIS 8 50 50 HIS HIS A . n A 1 9 ASN 9 51 51 ASN ASN A . n A 1 10 GLY 10 52 52 GLY GLY A . n A 1 11 THR 11 53 53 THR THR A . n A 1 12 PHE 12 54 54 PHE PHE A . n A 1 13 HIS 13 55 55 HIS HIS A . n A 1 14 CYS 14 56 56 CYS CYS A . n A 1 15 ASP 15 57 57 ASP ASP A . n A 1 16 ALA 16 58 58 ALA ALA A . n A 1 17 ALA 17 59 59 ALA ALA A . n A 1 18 LEU 18 60 60 LEU LEU A . n A 1 19 ALA 19 61 61 ALA ALA A . n A 1 20 CYS 20 62 62 CYS CYS A . n A 1 21 ALA 21 63 63 ALA ALA A . n A 1 22 LEU 22 64 64 LEU LEU A . n A 1 23 LEU 23 65 65 LEU LEU A . n A 1 24 ARG 24 66 66 ARG ARG A . n A 1 25 LEU 25 67 67 LEU LEU A . n A 1 26 LEU 26 68 68 LEU LEU A . n A 1 27 PRO 27 69 69 PRO PRO A . n A 1 28 GLU 28 70 70 GLU GLU A . n A 1 29 TYR 29 71 71 TYR TYR A . n A 1 30 ARG 30 72 72 ARG ARG A . n A 1 31 ASP 31 73 73 ASP ASP A . n A 1 32 ALA 32 74 74 ALA ALA A . n A 1 33 GLU 33 75 75 GLU GLU A . n A 1 34 ILE 34 76 76 ILE ILE A . n A 1 35 VAL 35 77 77 VAL VAL A . n A 1 36 ARG 36 78 78 ARG ARG A . n A 1 37 THR 37 79 79 THR THR A . n A 1 38 ARG 38 80 80 ARG ARG A . n A 1 39 ASP 39 81 81 ASP ASP A . n A 1 40 PRO 40 82 82 PRO PRO A . n A 1 41 GLU 41 83 83 GLU GLU A . n A 1 42 LYS 42 84 84 LYS LYS A . n A 1 43 LEU 43 85 85 LEU LEU A . n A 1 44 ALA 44 86 86 ALA ALA A . n A 1 45 SER 45 87 87 SER SER A . n A 1 46 CYS 46 88 88 CYS CYS A . n A 1 47 ASP 47 89 89 ASP ASP A . n A 1 48 ILE 48 90 90 ILE ILE A . n A 1 49 VAL 49 91 91 VAL VAL A . n A 1 50 VAL 50 92 92 VAL VAL A . n A 1 51 ASP 51 93 93 ASP ASP A . n A 1 52 VAL 52 94 94 VAL VAL A . n A 1 53 GLY 53 95 95 GLY GLY A . n A 1 54 GLY 54 96 96 GLY GLY A . n A 1 55 GLU 55 97 97 GLU GLU A . n A 1 56 TYR 56 98 98 TYR TYR A . n A 1 57 ASP 57 99 99 ASP ASP A . n A 1 58 PRO 58 100 100 PRO PRO A . n A 1 59 ARG 59 101 101 ARG ARG A . n A 1 60 ARG 60 102 102 ARG ARG A . n A 1 61 HIS 61 103 103 HIS HIS A . n A 1 62 ARG 62 104 104 ARG ARG A . n A 1 63 TYR 63 105 105 TYR TYR A . n A 1 64 ASP 64 106 106 ASP ASP A . n A 1 65 HIS 65 107 107 HIS HIS A . n A 1 66 HIS 66 108 108 HIS HIS A . n A 1 67 GLN 67 109 109 GLN GLN A . n A 1 68 ARG 68 110 110 ARG ARG A . n A 1 69 SER 69 111 111 SER SER A . n A 1 70 PHE 70 112 112 PHE PHE A . n A 1 71 THR 71 113 113 THR THR A . n A 1 72 GLU 72 114 114 GLU GLU A . n A 1 73 THR 73 115 115 THR THR A . n A 1 74 MET 74 116 116 MET MET A . n A 1 75 SER 75 117 117 SER SER A . n A 1 76 SER 76 118 118 SER SER A . n A 1 77 LEU 77 119 119 LEU LEU A . n A 1 78 SER 78 120 120 SER SER A . n A 1 79 PRO 79 121 121 PRO PRO A . n A 1 80 GLY 80 122 122 GLY GLY A . n A 1 81 LYS 81 123 123 LYS LYS A . n A 1 82 PRO 82 124 124 PRO PRO A . n A 1 83 TRP 83 125 125 TRP TRP A . n A 1 84 GLN 84 126 126 GLN GLN A . n A 1 85 THR 85 127 127 THR THR A . n A 1 86 LYS 86 128 128 LYS LYS A . n A 1 87 LEU 87 129 129 LEU LEU A . n A 1 88 SER 88 130 130 SER SER A . n A 1 89 SER 89 131 131 SER SER A . n A 1 90 ALA 90 132 132 ALA ALA A . n A 1 91 GLY 91 133 133 GLY GLY A . n A 1 92 LEU 92 134 134 LEU LEU A . n A 1 93 ILE 93 135 135 ILE ILE A . n A 1 94 TYR 94 136 136 TYR TYR A . n A 1 95 LEU 95 137 137 LEU LEU A . n A 1 96 HIS 96 138 138 HIS HIS A . n A 1 97 PHE 97 139 139 PHE PHE A . n A 1 98 GLY 98 140 140 GLY GLY A . n A 1 99 HIS 99 141 141 HIS HIS A . n A 1 100 LYS 100 142 142 LYS LYS A . n A 1 101 LEU 101 143 143 LEU LEU A . n A 1 102 LEU 102 144 144 LEU LEU A . n A 1 103 ALA 103 145 145 ALA ALA A . n A 1 104 GLN 104 146 146 GLN GLN A . n A 1 105 LEU 105 147 147 LEU LEU A . n A 1 106 LEU 106 148 148 LEU LEU A . n A 1 107 GLY 107 149 149 GLY GLY A . n A 1 108 THR 108 150 150 THR THR A . n A 1 109 SER 109 151 151 SER SER A . n A 1 110 GLU 110 152 152 GLU GLU A . n A 1 111 GLU 111 153 153 GLU GLU A . n A 1 112 ASP 112 154 154 ASP ASP A . n A 1 113 SER 113 155 155 SER SER A . n A 1 114 MET 114 156 156 MET MET A . n A 1 115 VAL 115 157 157 VAL VAL A . n A 1 116 GLY 116 158 158 GLY GLY A . n A 1 117 THR 117 159 159 THR THR A . n A 1 118 LEU 118 160 160 LEU LEU A . n A 1 119 TYR 119 161 161 TYR TYR A . n A 1 120 ASP 120 162 162 ASP ASP A . n A 1 121 LYS 121 163 163 LYS LYS A . n A 1 122 MET 122 164 164 MET MET A . n A 1 123 TYR 123 165 165 TYR TYR A . n A 1 124 GLU 124 166 166 GLU GLU A . n A 1 125 ASN 125 167 167 ASN ASN A . n A 1 126 PHE 126 168 168 PHE PHE A . n A 1 127 VAL 127 169 169 VAL VAL A . n A 1 128 GLU 128 170 170 GLU GLU A . n A 1 129 GLU 129 171 171 GLU GLU A . n A 1 130 VAL 130 172 172 VAL VAL A . n A 1 131 ASP 131 173 173 ASP ASP A . n A 1 132 ALA 132 174 174 ALA ALA A . n A 1 133 VAL 133 175 175 VAL VAL A . n A 1 134 ASP 134 176 176 ASP ASP A . n A 1 135 ASN 135 177 177 ASN ASN A . n A 1 136 GLY 136 178 178 GLY GLY A . n A 1 137 ILE 137 179 179 ILE ILE A . n A 1 138 SER 138 180 180 SER SER A . n A 1 139 GLN 139 181 181 GLN GLN A . n A 1 140 TRP 140 182 182 TRP TRP A . n A 1 141 ALA 141 183 183 ALA ALA A . n A 1 142 GLU 142 184 184 GLU GLU A . n A 1 143 GLY 143 185 185 GLY GLY A . n A 1 144 GLU 144 186 186 GLU GLU A . n A 1 145 PRO 145 187 187 PRO PRO A . n A 1 146 ARG 146 188 188 ARG ARG A . n A 1 147 TYR 147 189 189 TYR TYR A . n A 1 148 ALA 148 190 190 ALA ALA A . n A 1 149 LEU 149 191 191 LEU LEU A . n A 1 150 THR 150 192 192 THR THR A . n A 1 151 THR 151 193 193 THR THR A . n A 1 152 THR 152 194 194 THR THR A . n A 1 153 LEU 153 195 195 LEU LEU A . n A 1 154 SER 154 196 196 SER SER A . n A 1 155 ALA 155 197 197 ALA ALA A . n A 1 156 ARG 156 198 198 ARG ARG A . n A 1 157 VAL 157 199 199 VAL VAL A . n A 1 158 ALA 158 200 200 ALA ALA A . n A 1 159 ARG 159 201 201 ARG ARG A . n A 1 160 LEU 160 202 202 LEU LEU A . n A 1 161 ASN 161 203 203 ASN ASN A . n A 1 162 PRO 162 204 204 PRO PRO A . n A 1 163 THR 163 205 205 THR THR A . n A 1 164 TRP 164 206 206 TRP TRP A . n A 1 165 ASN 165 207 207 ASN ASN A . n A 1 166 HIS 166 208 208 HIS HIS A . n A 1 167 PRO 167 209 209 PRO PRO A . n A 1 168 ASP 168 210 210 ASP ASP A . n A 1 169 GLN 169 211 211 GLN GLN A . n A 1 170 ASP 170 212 212 ASP ASP A . n A 1 171 THR 171 213 213 THR THR A . n A 1 172 GLU 172 214 214 GLU GLU A . n A 1 173 ALA 173 215 215 ALA ALA A . n A 1 174 GLY 174 216 216 GLY GLY A . n A 1 175 PHE 175 217 217 PHE PHE A . n A 1 176 LYS 176 218 218 LYS LYS A . n A 1 177 ARG 177 219 219 ARG ARG A . n A 1 178 ALA 178 220 220 ALA ALA A . n A 1 179 MET 179 221 221 MET MET A . n A 1 180 ASP 180 222 222 ASP ASP A . n A 1 181 LEU 181 223 223 LEU LEU A . n A 1 182 VAL 182 224 224 VAL VAL A . n A 1 183 GLN 183 225 225 GLN GLN A . n A 1 184 GLU 184 226 226 GLU GLU A . n A 1 185 GLU 185 227 227 GLU GLU A . n A 1 186 PHE 186 228 228 PHE PHE A . n A 1 187 LEU 187 229 229 LEU LEU A . n A 1 188 GLN 188 230 230 GLN GLN A . n A 1 189 ARG 189 231 231 ARG ARG A . n A 1 190 LEU 190 232 232 LEU LEU A . n A 1 191 ASP 191 233 233 ASP ASP A . n A 1 192 PHE 192 234 234 PHE PHE A . n A 1 193 TYR 193 235 235 TYR TYR A . n A 1 194 GLN 194 236 236 GLN GLN A . n A 1 195 HIS 195 237 237 HIS HIS A . n A 1 196 SER 196 238 238 SER SER A . n A 1 197 TRP 197 239 239 TRP TRP A . n A 1 198 LEU 198 240 240 LEU LEU A . n A 1 199 PRO 199 241 241 PRO PRO A . n A 1 200 ALA 200 242 242 ALA ALA A . n A 1 201 ARG 201 243 243 ARG ARG A . n A 1 202 ALA 202 244 244 ALA ALA A . n A 1 203 LEU 203 245 245 LEU LEU A . n A 1 204 VAL 204 246 246 VAL VAL A . n A 1 205 GLU 205 247 247 GLU GLU A . n A 1 206 GLU 206 248 248 GLU GLU A . n A 1 207 ALA 207 249 249 ALA ALA A . n A 1 208 LEU 208 250 250 LEU LEU A . n A 1 209 ALA 209 251 251 ALA ALA A . n A 1 210 GLN 210 252 252 GLN GLN A . n A 1 211 ARG 211 253 253 ARG ARG A . n A 1 212 PHE 212 254 254 PHE PHE A . n A 1 213 GLN 213 255 255 GLN GLN A . n A 1 214 VAL 214 256 256 VAL VAL A . n A 1 215 ASP 215 257 257 ASP ASP A . n A 1 216 PRO 216 258 258 PRO PRO A . n A 1 217 SER 217 259 259 SER SER A . n A 1 218 GLY 218 260 260 GLY GLY A . n A 1 219 GLU 219 261 261 GLU GLU A . n A 1 220 ILE 220 262 262 ILE ILE A . n A 1 221 VAL 221 263 263 VAL VAL A . n A 1 222 GLU 222 264 264 GLU GLU A . n A 1 223 LEU 223 265 265 LEU LEU A . n A 1 224 ALA 224 266 266 ALA ALA A . n A 1 225 LYS 225 267 267 LYS LYS A . n A 1 226 GLY 226 268 268 GLY GLY A . n A 1 227 ALA 227 269 269 ALA ALA A . n A 1 228 CYS 228 270 270 CYS CYS A . n A 1 229 PRO 229 271 271 PRO PRO A . n A 1 230 TRP 230 272 272 TRP TRP A . n A 1 231 LYS 231 273 273 LYS LYS A . n A 1 232 GLU 232 274 274 GLU GLU A . n A 1 233 HIS 233 275 275 HIS HIS A . n A 1 234 LEU 234 276 276 LEU LEU A . n A 1 235 TYR 235 277 277 TYR TYR A . n A 1 236 HIS 236 278 278 HIS HIS A . n A 1 237 LEU 237 279 279 LEU LEU A . n A 1 238 GLU 238 280 280 GLU GLU A . n A 1 239 SER 239 281 281 SER SER A . n A 1 240 GLY 240 282 282 GLY GLY A . n A 1 241 LEU 241 283 ? ? ? A . n A 1 242 SER 242 284 ? ? ? A . n A 1 243 PRO 243 285 ? ? ? A . n A 1 244 PRO 244 286 ? ? ? A . n A 1 245 ILE 245 287 287 ILE ILE A . n A 1 246 ALA 246 288 288 ALA ALA A . n A 1 247 ILE 247 289 289 ILE ILE A . n A 1 248 PHE 248 290 290 PHE PHE A . n A 1 249 PHE 249 291 291 PHE PHE A . n A 1 250 VAL 250 292 292 VAL VAL A . n A 1 251 ILE 251 293 293 ILE ILE A . n A 1 252 TYR 252 294 294 TYR TYR A . n A 1 253 THR 253 295 295 THR THR A . n A 1 254 ASP 254 296 296 ASP ASP A . n A 1 255 GLN 255 297 297 GLN GLN A . n A 1 256 ALA 256 298 298 ALA ALA A . n A 1 257 GLY 257 299 299 GLY GLY A . n A 1 258 GLN 258 300 300 GLN GLN A . n A 1 259 TRP 259 301 301 TRP TRP A . n A 1 260 ARG 260 302 302 ARG ARG A . n A 1 261 ILE 261 303 303 ILE ILE A . n A 1 262 GLN 262 304 304 GLN GLN A . n A 1 263 CYS 263 305 305 CYS CYS A . n A 1 264 VAL 264 306 306 VAL VAL A . n A 1 265 PRO 265 307 307 PRO PRO A . n A 1 266 LYS 266 308 308 LYS LYS A . n A 1 267 GLU 267 309 309 GLU GLU A . n A 1 268 PRO 268 310 310 PRO PRO A . n A 1 269 HIS 269 311 311 HIS HIS A . n A 1 270 SER 270 312 312 SER SER A . n A 1 271 PHE 271 313 313 PHE PHE A . n A 1 272 GLN 272 314 314 GLN GLN A . n A 1 273 SER 273 315 315 SER SER A . n A 1 274 ARG 274 316 316 ARG ARG A . n A 1 275 LEU 275 317 317 LEU LEU A . n A 1 276 PRO 276 318 318 PRO PRO A . n A 1 277 LEU 277 319 319 LEU LEU A . n A 1 278 PRO 278 320 320 PRO PRO A . n A 1 279 GLU 279 321 321 GLU GLU A . n A 1 280 PRO 280 322 322 PRO PRO A . n A 1 281 TRP 281 323 323 TRP TRP A . n A 1 282 ARG 282 324 324 ARG ARG A . n A 1 283 GLY 283 325 325 GLY GLY A . n A 1 284 LEU 284 326 326 LEU LEU A . n A 1 285 ARG 285 327 327 ARG ARG A . n A 1 286 ASP 286 328 328 ASP ASP A . n A 1 287 GLU 287 329 329 GLU GLU A . n A 1 288 ALA 288 330 330 ALA ALA A . n A 1 289 LEU 289 331 331 LEU LEU A . n A 1 290 ASP 290 332 332 ASP ASP A . n A 1 291 GLN 291 333 333 GLN GLN A . n A 1 292 VAL 292 334 334 VAL VAL A . n A 1 293 SER 293 335 335 SER SER A . n A 1 294 GLY 294 336 336 GLY GLY A . n A 1 295 ILE 295 337 337 ILE ILE A . n A 1 296 PRO 296 338 338 PRO PRO A . n A 1 297 GLY 297 339 339 GLY GLY A . n A 1 298 CYS 298 340 340 CYS CYS A . n A 1 299 ILE 299 341 341 ILE ILE A . n A 1 300 PHE 300 342 342 PHE PHE A . n A 1 301 VAL 301 343 343 VAL VAL A . n A 1 302 HIS 302 344 344 HIS HIS A . n A 1 303 ALA 303 345 345 ALA ALA A . n A 1 304 SER 304 346 346 SER SER A . n A 1 305 GLY 305 347 347 GLY GLY A . n A 1 306 PHE 306 348 348 PHE PHE A . n A 1 307 ILE 307 349 349 ILE ILE A . n A 1 308 GLY 308 350 350 GLY GLY A . n A 1 309 GLY 309 351 351 GLY GLY A . n A 1 310 HIS 310 352 352 HIS HIS A . n A 1 311 HIS 311 353 353 HIS HIS A . n A 1 312 THR 312 354 354 THR THR A . n A 1 313 ARG 313 355 355 ARG ARG A . n A 1 314 GLU 314 356 356 GLU GLU A . n A 1 315 GLY 315 357 357 GLY GLY A . n A 1 316 ALA 316 358 358 ALA ALA A . n A 1 317 LEU 317 359 359 LEU LEU A . n A 1 318 SER 318 360 360 SER SER A . n A 1 319 MET 319 361 361 MET MET A . n A 1 320 ALA 320 362 362 ALA ALA A . n A 1 321 ARG 321 363 363 ARG ARG A . n A 1 322 ALA 322 364 364 ALA ALA A . n A 1 323 THR 323 365 365 THR THR A . n A 1 324 LEU 324 366 366 LEU LEU A . n A 1 325 ALA 325 367 367 ALA ALA A . n A 1 326 GLN 326 368 368 GLN GLN A . n A 1 327 ARG 327 369 369 ARG ARG A . n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 AMP ? ? AMP ? ? 'SUBJECT OF INVESTIGATION' ? 2 MN ? ? MN ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 AMP 1 401 401 AMP A A . C 2 AMP 1 402 501 AMP A A . D 3 MN 1 403 1 MN MN A . E 3 MN 1 404 2 MN MN A . F 4 HOH 1 501 217 HOH HOH A . F 4 HOH 2 502 159 HOH HOH A . F 4 HOH 3 503 222 HOH HOH A . F 4 HOH 4 504 423 HOH HOH A . F 4 HOH 5 505 160 HOH HOH A . F 4 HOH 6 506 331 HOH HOH A . F 4 HOH 7 507 152 HOH HOH A . F 4 HOH 8 508 197 HOH HOH A . F 4 HOH 9 509 26 HOH HOH A . F 4 HOH 10 510 239 HOH HOH A . F 4 HOH 11 511 256 HOH HOH A . F 4 HOH 12 512 114 HOH HOH A . F 4 HOH 13 513 167 HOH HOH A . F 4 HOH 14 514 332 HOH HOH A . F 4 HOH 15 515 1 HOH HOH A . F 4 HOH 16 516 228 HOH HOH A . F 4 HOH 17 517 215 HOH HOH A . F 4 HOH 18 518 190 HOH HOH A . F 4 HOH 19 519 362 HOH HOH A . F 4 HOH 20 520 260 HOH HOH A . F 4 HOH 21 521 310 HOH HOH A . F 4 HOH 22 522 86 HOH HOH A . F 4 HOH 23 523 178 HOH HOH A . F 4 HOH 24 524 408 HOH HOH A . F 4 HOH 25 525 214 HOH HOH A . F 4 HOH 26 526 245 HOH HOH A . F 4 HOH 27 527 164 HOH HOH A . F 4 HOH 28 528 33 HOH HOH A . F 4 HOH 29 529 203 HOH HOH A . F 4 HOH 30 530 84 HOH HOH A . F 4 HOH 31 531 58 HOH HOH A . F 4 HOH 32 532 6 HOH HOH A . F 4 HOH 33 533 187 HOH HOH A . F 4 HOH 34 534 318 HOH HOH A . F 4 HOH 35 535 128 HOH HOH A . F 4 HOH 36 536 77 HOH HOH A . F 4 HOH 37 537 324 HOH HOH A . F 4 HOH 38 538 55 HOH HOH A . F 4 HOH 39 539 348 HOH HOH A . F 4 HOH 40 540 22 HOH HOH A . F 4 HOH 41 541 96 HOH HOH A . F 4 HOH 42 542 3 HOH HOH A . F 4 HOH 43 543 83 HOH HOH A . F 4 HOH 44 544 384 HOH HOH A . F 4 HOH 45 545 181 HOH HOH A . F 4 HOH 46 546 32 HOH HOH A . F 4 HOH 47 547 172 HOH HOH A . F 4 HOH 48 548 85 HOH HOH A . F 4 HOH 49 549 283 HOH HOH A . F 4 HOH 50 550 49 HOH HOH A . F 4 HOH 51 551 242 HOH HOH A . F 4 HOH 52 552 9 HOH HOH A . F 4 HOH 53 553 233 HOH HOH A . F 4 HOH 54 554 315 HOH HOH A . F 4 HOH 55 555 377 HOH HOH A . F 4 HOH 56 556 154 HOH HOH A . F 4 HOH 57 557 391 HOH HOH A . F 4 HOH 58 558 45 HOH HOH A . F 4 HOH 59 559 405 HOH HOH A . F 4 HOH 60 560 104 HOH HOH A . F 4 HOH 61 561 225 HOH HOH A . F 4 HOH 62 562 316 HOH HOH A . F 4 HOH 63 563 330 HOH HOH A . F 4 HOH 64 564 79 HOH HOH A . F 4 HOH 65 565 143 HOH HOH A . F 4 HOH 66 566 365 HOH HOH A . F 4 HOH 67 567 40 HOH HOH A . F 4 HOH 68 568 336 HOH HOH A . F 4 HOH 69 569 202 HOH HOH A . F 4 HOH 70 570 129 HOH HOH A . F 4 HOH 71 571 207 HOH HOH A . F 4 HOH 72 572 349 HOH HOH A . F 4 HOH 73 573 141 HOH HOH A . F 4 HOH 74 574 8 HOH HOH A . F 4 HOH 75 575 212 HOH HOH A . F 4 HOH 76 576 24 HOH HOH A . F 4 HOH 77 577 142 HOH HOH A . F 4 HOH 78 578 82 HOH HOH A . F 4 HOH 79 579 62 HOH HOH A . F 4 HOH 80 580 7 HOH HOH A . F 4 HOH 81 581 76 HOH HOH A . F 4 HOH 82 582 151 HOH HOH A . F 4 HOH 83 583 70 HOH HOH A . F 4 HOH 84 584 109 HOH HOH A . F 4 HOH 85 585 176 HOH HOH A . F 4 HOH 86 586 11 HOH HOH A . F 4 HOH 87 587 5 HOH HOH A . F 4 HOH 88 588 271 HOH HOH A . F 4 HOH 89 589 429 HOH HOH A . F 4 HOH 90 590 2 HOH HOH A . F 4 HOH 91 591 44 HOH HOH A . F 4 HOH 92 592 264 HOH HOH A . F 4 HOH 93 593 183 HOH HOH A . F 4 HOH 94 594 13 HOH HOH A . F 4 HOH 95 595 367 HOH HOH A . F 4 HOH 96 596 237 HOH HOH A . F 4 HOH 97 597 66 HOH HOH A . F 4 HOH 98 598 29 HOH HOH A . F 4 HOH 99 599 4 HOH HOH A . F 4 HOH 100 600 259 HOH HOH A . F 4 HOH 101 601 304 HOH HOH A . F 4 HOH 102 602 88 HOH HOH A . F 4 HOH 103 603 206 HOH HOH A . F 4 HOH 104 604 378 HOH HOH A . F 4 HOH 105 605 424 HOH HOH A . F 4 HOH 106 606 263 HOH HOH A . F 4 HOH 107 607 155 HOH HOH A . F 4 HOH 108 608 52 HOH HOH A . F 4 HOH 109 609 95 HOH HOH A . F 4 HOH 110 610 42 HOH HOH A . F 4 HOH 111 611 12 HOH HOH A . F 4 HOH 112 612 25 HOH HOH A . F 4 HOH 113 613 185 HOH HOH A . F 4 HOH 114 614 38 HOH HOH A . F 4 HOH 115 615 15 HOH HOH A . F 4 HOH 116 616 10 HOH HOH A . F 4 HOH 117 617 166 HOH HOH A . F 4 HOH 118 618 292 HOH HOH A . F 4 HOH 119 619 291 HOH HOH A . F 4 HOH 120 620 41 HOH HOH A . F 4 HOH 121 621 27 HOH HOH A . F 4 HOH 122 622 105 HOH HOH A . F 4 HOH 123 623 426 HOH HOH A . F 4 HOH 124 624 175 HOH HOH A . F 4 HOH 125 625 75 HOH HOH A . F 4 HOH 126 626 57 HOH HOH A . F 4 HOH 127 627 157 HOH HOH A . F 4 HOH 128 628 131 HOH HOH A . F 4 HOH 129 629 69 HOH HOH A . F 4 HOH 130 630 37 HOH HOH A . F 4 HOH 131 631 16 HOH HOH A . F 4 HOH 132 632 102 HOH HOH A . F 4 HOH 133 633 97 HOH HOH A . F 4 HOH 134 634 306 HOH HOH A . F 4 HOH 135 635 272 HOH HOH A . F 4 HOH 136 636 230 HOH HOH A . F 4 HOH 137 637 179 HOH HOH A . F 4 HOH 138 638 153 HOH HOH A . F 4 HOH 139 639 50 HOH HOH A . F 4 HOH 140 640 339 HOH HOH A . F 4 HOH 141 641 53 HOH HOH A . F 4 HOH 142 642 63 HOH HOH A . F 4 HOH 143 643 189 HOH HOH A . F 4 HOH 144 644 93 HOH HOH A . F 4 HOH 145 645 389 HOH HOH A . F 4 HOH 146 646 48 HOH HOH A . F 4 HOH 147 647 99 HOH HOH A . F 4 HOH 148 648 73 HOH HOH A . F 4 HOH 149 649 224 HOH HOH A . F 4 HOH 150 650 81 HOH HOH A . F 4 HOH 151 651 59 HOH HOH A . F 4 HOH 152 652 71 HOH HOH A . F 4 HOH 153 653 139 HOH HOH A . F 4 HOH 154 654 409 HOH HOH A . F 4 HOH 155 655 72 HOH HOH A . F 4 HOH 156 656 302 HOH HOH A . F 4 HOH 157 657 101 HOH HOH A . F 4 HOH 158 658 174 HOH HOH A . F 4 HOH 159 659 117 HOH HOH A . F 4 HOH 160 660 199 HOH HOH A . F 4 HOH 161 661 138 HOH HOH A . F 4 HOH 162 662 156 HOH HOH A . F 4 HOH 163 663 91 HOH HOH A . F 4 HOH 164 664 111 HOH HOH A . F 4 HOH 165 665 107 HOH HOH A . F 4 HOH 166 666 80 HOH HOH A . F 4 HOH 167 667 253 HOH HOH A . F 4 HOH 168 668 158 HOH HOH A . F 4 HOH 169 669 28 HOH HOH A . F 4 HOH 170 670 287 HOH HOH A . F 4 HOH 171 671 122 HOH HOH A . F 4 HOH 172 672 431 HOH HOH A . F 4 HOH 173 673 196 HOH HOH A . F 4 HOH 174 674 329 HOH HOH A . F 4 HOH 175 675 65 HOH HOH A . F 4 HOH 176 676 275 HOH HOH A . F 4 HOH 177 677 270 HOH HOH A . F 4 HOH 178 678 344 HOH HOH A . F 4 HOH 179 679 36 HOH HOH A . F 4 HOH 180 680 257 HOH HOH A . F 4 HOH 181 681 163 HOH HOH A . F 4 HOH 182 682 34 HOH HOH A . F 4 HOH 183 683 188 HOH HOH A . F 4 HOH 184 684 261 HOH HOH A . F 4 HOH 185 685 39 HOH HOH A . F 4 HOH 186 686 398 HOH HOH A . F 4 HOH 187 687 279 HOH HOH A . F 4 HOH 188 688 216 HOH HOH A . F 4 HOH 189 689 78 HOH HOH A . F 4 HOH 190 690 98 HOH HOH A . F 4 HOH 191 691 31 HOH HOH A . F 4 HOH 192 692 17 HOH HOH A . F 4 HOH 193 693 268 HOH HOH A . F 4 HOH 194 694 106 HOH HOH A . F 4 HOH 195 695 320 HOH HOH A . F 4 HOH 196 696 198 HOH HOH A . F 4 HOH 197 697 113 HOH HOH A . F 4 HOH 198 698 51 HOH HOH A . F 4 HOH 199 699 118 HOH HOH A . F 4 HOH 200 700 112 HOH HOH A . F 4 HOH 201 701 209 HOH HOH A . F 4 HOH 202 702 30 HOH HOH A . F 4 HOH 203 703 299 HOH HOH A . F 4 HOH 204 704 119 HOH HOH A . F 4 HOH 205 705 103 HOH HOH A . F 4 HOH 206 706 56 HOH HOH A . F 4 HOH 207 707 319 HOH HOH A . F 4 HOH 208 708 67 HOH HOH A . F 4 HOH 209 709 46 HOH HOH A . F 4 HOH 210 710 89 HOH HOH A . F 4 HOH 211 711 137 HOH HOH A . F 4 HOH 212 712 68 HOH HOH A . F 4 HOH 213 713 278 HOH HOH A . F 4 HOH 214 714 420 HOH HOH A . F 4 HOH 215 715 150 HOH HOH A . F 4 HOH 216 716 380 HOH HOH A . F 4 HOH 217 717 282 HOH HOH A . F 4 HOH 218 718 87 HOH HOH A . F 4 HOH 219 719 229 HOH HOH A . F 4 HOH 220 720 74 HOH HOH A . F 4 HOH 221 721 21 HOH HOH A . F 4 HOH 222 722 364 HOH HOH A . F 4 HOH 223 723 35 HOH HOH A . F 4 HOH 224 724 19 HOH HOH A . F 4 HOH 225 725 173 HOH HOH A . F 4 HOH 226 726 356 HOH HOH A . F 4 HOH 227 727 120 HOH HOH A . F 4 HOH 228 728 145 HOH HOH A . F 4 HOH 229 729 311 HOH HOH A . F 4 HOH 230 730 144 HOH HOH A . F 4 HOH 231 731 90 HOH HOH A . F 4 HOH 232 732 395 HOH HOH A . F 4 HOH 233 733 92 HOH HOH A . F 4 HOH 234 734 294 HOH HOH A . F 4 HOH 235 735 240 HOH HOH A . F 4 HOH 236 736 416 HOH HOH A . F 4 HOH 237 737 201 HOH HOH A . F 4 HOH 238 738 295 HOH HOH A . F 4 HOH 239 739 410 HOH HOH A . F 4 HOH 240 740 226 HOH HOH A . F 4 HOH 241 741 250 HOH HOH A . F 4 HOH 242 742 213 HOH HOH A . F 4 HOH 243 743 60 HOH HOH A . F 4 HOH 244 744 248 HOH HOH A . F 4 HOH 245 745 219 HOH HOH A . F 4 HOH 246 746 171 HOH HOH A . F 4 HOH 247 747 399 HOH HOH A . F 4 HOH 248 748 205 HOH HOH A . F 4 HOH 249 749 352 HOH HOH A . F 4 HOH 250 750 218 HOH HOH A . F 4 HOH 251 751 223 HOH HOH A . F 4 HOH 252 752 170 HOH HOH A . F 4 HOH 253 753 124 HOH HOH A . F 4 HOH 254 754 61 HOH HOH A . F 4 HOH 255 755 284 HOH HOH A . F 4 HOH 256 756 343 HOH HOH A . F 4 HOH 257 757 289 HOH HOH A . F 4 HOH 258 758 314 HOH HOH A . F 4 HOH 259 759 116 HOH HOH A . F 4 HOH 260 760 227 HOH HOH A . F 4 HOH 261 761 288 HOH HOH A . F 4 HOH 262 762 392 HOH HOH A . F 4 HOH 263 763 346 HOH HOH A . F 4 HOH 264 764 23 HOH HOH A . F 4 HOH 265 765 146 HOH HOH A . F 4 HOH 266 766 18 HOH HOH A . F 4 HOH 267 767 413 HOH HOH A . F 4 HOH 268 768 412 HOH HOH A . F 4 HOH 269 769 406 HOH HOH A . F 4 HOH 270 770 244 HOH HOH A . F 4 HOH 271 771 47 HOH HOH A . F 4 HOH 272 772 194 HOH HOH A . F 4 HOH 273 773 232 HOH HOH A . F 4 HOH 274 774 195 HOH HOH A . F 4 HOH 275 775 220 HOH HOH A . F 4 HOH 276 776 337 HOH HOH A . F 4 HOH 277 777 130 HOH HOH A . F 4 HOH 278 778 140 HOH HOH A . F 4 HOH 279 779 307 HOH HOH A . F 4 HOH 280 780 20 HOH HOH A . F 4 HOH 281 781 296 HOH HOH A . F 4 HOH 282 782 313 HOH HOH A . F 4 HOH 283 783 123 HOH HOH A . F 4 HOH 284 784 345 HOH HOH A . F 4 HOH 285 785 148 HOH HOH A . F 4 HOH 286 786 110 HOH HOH A . F 4 HOH 287 787 108 HOH HOH A . F 4 HOH 288 788 165 HOH HOH A . F 4 HOH 289 789 14 HOH HOH A . F 4 HOH 290 790 369 HOH HOH A . F 4 HOH 291 791 94 HOH HOH A . F 4 HOH 292 792 134 HOH HOH A . F 4 HOH 293 793 340 HOH HOH A . F 4 HOH 294 794 325 HOH HOH A . F 4 HOH 295 795 407 HOH HOH A . F 4 HOH 296 796 126 HOH HOH A . F 4 HOH 297 797 286 HOH HOH A . F 4 HOH 298 798 326 HOH HOH A . F 4 HOH 299 799 361 HOH HOH A . F 4 HOH 300 800 210 HOH HOH A . F 4 HOH 301 801 388 HOH HOH A . F 4 HOH 302 802 368 HOH HOH A . F 4 HOH 303 803 404 HOH HOH A . F 4 HOH 304 804 363 HOH HOH A . F 4 HOH 305 805 293 HOH HOH A . F 4 HOH 306 806 385 HOH HOH A . F 4 HOH 307 807 372 HOH HOH A . F 4 HOH 308 808 366 HOH HOH A . F 4 HOH 309 809 290 HOH HOH A . F 4 HOH 310 810 208 HOH HOH A . F 4 HOH 311 811 393 HOH HOH A . F 4 HOH 312 812 191 HOH HOH A . F 4 HOH 313 813 387 HOH HOH A . F 4 HOH 314 814 136 HOH HOH A . F 4 HOH 315 815 347 HOH HOH A . F 4 HOH 316 816 360 HOH HOH A . F 4 HOH 317 817 309 HOH HOH A . F 4 HOH 318 818 376 HOH HOH A . F 4 HOH 319 819 354 HOH HOH A . F 4 HOH 320 820 127 HOH HOH A . F 4 HOH 321 821 328 HOH HOH A . F 4 HOH 322 822 335 HOH HOH A . F 4 HOH 323 823 381 HOH HOH A . F 4 HOH 324 824 266 HOH HOH A . F 4 HOH 325 825 238 HOH HOH A . F 4 HOH 326 826 394 HOH HOH A . F 4 HOH 327 827 341 HOH HOH A . F 4 HOH 328 828 397 HOH HOH A . F 4 HOH 329 829 274 HOH HOH A . F 4 HOH 330 830 317 HOH HOH A . F 4 HOH 331 831 135 HOH HOH A . F 4 HOH 332 832 262 HOH HOH A . F 4 HOH 333 833 342 HOH HOH A . F 4 HOH 334 834 415 HOH HOH A . F 4 HOH 335 835 427 HOH HOH A . F 4 HOH 336 836 351 HOH HOH A . F 4 HOH 337 837 221 HOH HOH A . F 4 HOH 338 838 200 HOH HOH A . F 4 HOH 339 839 350 HOH HOH A . F 4 HOH 340 840 249 HOH HOH A . F 4 HOH 341 841 422 HOH HOH A . F 4 HOH 342 842 182 HOH HOH A . F 4 HOH 343 843 333 HOH HOH A . F 4 HOH 344 844 281 HOH HOH A . F 4 HOH 345 845 54 HOH HOH A . F 4 HOH 346 846 418 HOH HOH A . F 4 HOH 347 847 241 HOH HOH A . F 4 HOH 348 848 276 HOH HOH A . F 4 HOH 349 849 180 HOH HOH A . F 4 HOH 350 850 374 HOH HOH A . F 4 HOH 351 851 285 HOH HOH A . F 4 HOH 352 852 297 HOH HOH A . F 4 HOH 353 853 236 HOH HOH A . F 4 HOH 354 854 192 HOH HOH A . F 4 HOH 355 855 321 HOH HOH A . F 4 HOH 356 856 133 HOH HOH A . F 4 HOH 357 857 358 HOH HOH A . F 4 HOH 358 858 204 HOH HOH A . F 4 HOH 359 859 371 HOH HOH A . F 4 HOH 360 860 269 HOH HOH A . F 4 HOH 361 861 375 HOH HOH A . F 4 HOH 362 862 338 HOH HOH A . F 4 HOH 363 863 255 HOH HOH A . F 4 HOH 364 864 100 HOH HOH A . F 4 HOH 365 865 273 HOH HOH A . F 4 HOH 366 866 265 HOH HOH A . F 4 HOH 367 867 417 HOH HOH A . F 4 HOH 368 868 251 HOH HOH A . F 4 HOH 369 869 301 HOH HOH A . F 4 HOH 370 870 383 HOH HOH A . F 4 HOH 371 871 186 HOH HOH A . F 4 HOH 372 872 390 HOH HOH A . F 4 HOH 373 873 243 HOH HOH A . F 4 HOH 374 874 115 HOH HOH A . F 4 HOH 375 875 411 HOH HOH A . F 4 HOH 376 876 277 HOH HOH A . F 4 HOH 377 877 235 HOH HOH A . F 4 HOH 378 878 334 HOH HOH A . F 4 HOH 379 879 300 HOH HOH A . F 4 HOH 380 880 149 HOH HOH A . F 4 HOH 381 881 168 HOH HOH A . F 4 HOH 382 882 234 HOH HOH A . F 4 HOH 383 883 322 HOH HOH A . F 4 HOH 384 884 303 HOH HOH A . F 4 HOH 385 885 308 HOH HOH A . F 4 HOH 386 886 258 HOH HOH A . F 4 HOH 387 887 357 HOH HOH A . F 4 HOH 388 888 125 HOH HOH A . F 4 HOH 389 889 211 HOH HOH A . F 4 HOH 390 890 370 HOH HOH A . F 4 HOH 391 891 247 HOH HOH A . F 4 HOH 392 892 161 HOH HOH A . F 4 HOH 393 893 184 HOH HOH A . F 4 HOH 394 894 43 HOH HOH A . F 4 HOH 395 895 353 HOH HOH A . F 4 HOH 396 896 355 HOH HOH A . F 4 HOH 397 897 327 HOH HOH A . F 4 HOH 398 898 382 HOH HOH A . F 4 HOH 399 899 421 HOH HOH A . F 4 HOH 400 900 359 HOH HOH A . F 4 HOH 401 901 305 HOH HOH A . F 4 HOH 402 902 231 HOH HOH A . F 4 HOH 403 903 193 HOH HOH A . F 4 HOH 404 904 132 HOH HOH A . F 4 HOH 405 905 147 HOH HOH A . F 4 HOH 406 906 121 HOH HOH A . F 4 HOH 407 907 396 HOH HOH A . F 4 HOH 408 908 414 HOH HOH A . F 4 HOH 409 909 403 HOH HOH A . F 4 HOH 410 910 246 HOH HOH A . F 4 HOH 411 911 280 HOH HOH A . F 4 HOH 412 912 402 HOH HOH A . F 4 HOH 413 913 267 HOH HOH A . F 4 HOH 414 914 298 HOH HOH A . F 4 HOH 415 915 169 HOH HOH A . F 4 HOH 416 916 177 HOH HOH A . F 4 HOH 417 917 254 HOH HOH A . F 4 HOH 418 918 323 HOH HOH A . F 4 HOH 419 919 162 HOH HOH A . F 4 HOH 420 920 252 HOH HOH A . F 4 HOH 421 921 64 HOH HOH A . F 4 HOH 422 922 373 HOH HOH A . F 4 HOH 423 923 312 HOH HOH A . F 4 HOH 424 924 379 HOH HOH A . F 4 HOH 425 925 428 HOH HOH A . F 4 HOH 426 926 419 HOH HOH A . F 4 HOH 427 927 401 HOH HOH A . F 4 HOH 428 928 400 HOH HOH A . F 4 HOH 429 929 386 HOH HOH A . F 4 HOH 430 930 430 HOH HOH A . F 4 HOH 431 931 425 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 84 ? CG ? A LYS 42 CG 2 1 Y 1 A LYS 84 ? CD ? A LYS 42 CD 3 1 Y 1 A LYS 84 ? CE ? A LYS 42 CE 4 1 Y 1 A LYS 84 ? NZ ? A LYS 42 NZ 5 1 Y 1 A ARG 101 ? CG ? A ARG 59 CG 6 1 Y 1 A ARG 101 ? CD ? A ARG 59 CD 7 1 Y 1 A ARG 101 ? NE ? A ARG 59 NE 8 1 Y 1 A ARG 101 ? CZ ? A ARG 59 CZ 9 1 Y 1 A ARG 101 ? NH1 ? A ARG 59 NH1 10 1 Y 1 A ARG 101 ? NH2 ? A ARG 59 NH2 11 1 Y 1 A GLU 184 ? CG ? A GLU 142 CG 12 1 Y 1 A GLU 184 ? CD ? A GLU 142 CD 13 1 Y 1 A GLU 184 ? OE1 ? A GLU 142 OE1 14 1 Y 1 A GLU 184 ? OE2 ? A GLU 142 OE2 15 1 Y 1 A GLU 186 ? CG ? A GLU 144 CG 16 1 Y 1 A GLU 186 ? CD ? A GLU 144 CD 17 1 Y 1 A GLU 186 ? OE1 ? A GLU 144 OE1 18 1 Y 1 A GLU 186 ? OE2 ? A GLU 144 OE2 19 1 Y 1 A GLN 255 ? CG ? A GLN 213 CG 20 1 Y 1 A GLN 255 ? CD ? A GLN 213 CD 21 1 Y 1 A GLN 255 ? OE1 ? A GLN 213 OE1 22 1 Y 1 A GLN 255 ? NE2 ? A GLN 213 NE2 23 1 Y 1 A TYR 277 ? CG ? A TYR 235 CG 24 1 Y 1 A TYR 277 ? CD1 ? A TYR 235 CD1 25 1 Y 1 A TYR 277 ? CD2 ? A TYR 235 CD2 26 1 Y 1 A TYR 277 ? CE1 ? A TYR 235 CE1 27 1 Y 1 A TYR 277 ? CE2 ? A TYR 235 CE2 28 1 Y 1 A TYR 277 ? CZ ? A TYR 235 CZ 29 1 Y 1 A TYR 277 ? OH ? A TYR 235 OH 30 1 Y 1 A GLN 297 ? CG ? A GLN 255 CG 31 1 Y 1 A GLN 297 ? CD ? A GLN 255 CD 32 1 Y 1 A GLN 297 ? OE1 ? A GLN 255 OE1 33 1 Y 1 A GLN 297 ? NE2 ? A GLN 255 NE2 34 1 Y 1 A GLU 309 ? CG ? A GLU 267 CG 35 1 Y 1 A GLU 309 ? CD ? A GLU 267 CD 36 1 Y 1 A GLU 309 ? OE1 ? A GLU 267 OE1 37 1 Y 1 A GLU 309 ? OE2 ? A GLU 267 OE2 38 1 Y 1 A GLU 329 ? CG ? A GLU 287 CG 39 1 Y 1 A GLU 329 ? CD ? A GLU 287 CD 40 1 Y 1 A GLU 329 ? OE1 ? A GLU 287 OE1 41 1 Y 1 A GLU 329 ? OE2 ? A GLU 287 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? 1.20.1_4487 ? 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 3 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 24BL _cell.details ? _cell.formula_units_Z ? _cell.length_a 70.094 _cell.length_a_esd ? _cell.length_b 97.887 _cell.length_b_esd ? _cell.length_c 116.976 _cell.length_c_esd ? _cell.volume 802606.420 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 24BL _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall 'C 2c 2' _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 24BL _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.72 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.79 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M potassium chloride, 0.1 M Hepes, pH 7.0, 15% w/v PEG 5000 MME' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 289 # _diffrn.ambient_environment ? _diffrn.ambient_temp 193 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 X 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2025-11-29 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9786 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NFPSS BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9786 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site NFPSS # _reflns.B_iso_Wilson_estimate 22.18 _reflns.entry_id 24BL _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.81 _reflns.d_resolution_low 51.23 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 37178 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.0 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.99 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.81 _reflns_shell.d_res_low 1.87 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 5353 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.91 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 25.87 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 24BL _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.81 _refine.ls_d_res_low 51.23 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 37122 _refine.ls_number_reflns_R_free 1998 _refine.ls_number_reflns_R_work 35124 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.88 _refine.ls_percent_reflns_R_free 5.38 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1789 _refine.ls_R_factor_R_free 0.2199 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1766 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.6050 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1715 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.81 _refine_hist.d_res_low 51.23 _refine_hist.number_atoms_solvent 431 _refine_hist.number_atoms_total 3008 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2529 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 48 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0061 ? 2647 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.7844 ? 3608 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0498 ? 389 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0081 ? 467 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 13.9883 ? 953 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.81 1.85 . . 140 2462 99.31 . . . . 0.2381 . . . . . . . . . . . . . . . 0.2867 'X-RAY DIFFRACTION' 1.85 1.90 . . 141 2473 99.73 . . . . 0.2095 . . . . . . . . . . . . . . . 0.2480 'X-RAY DIFFRACTION' 1.90 1.96 . . 141 2492 99.81 . . . . 0.1998 . . . . . . . . . . . . . . . 0.2450 'X-RAY DIFFRACTION' 1.96 2.02 . . 140 2459 99.92 . . . . 0.2041 . . . . . . . . . . . . . . . 0.2424 'X-RAY DIFFRACTION' 2.02 2.09 . . 141 2488 99.96 . . . . 0.1891 . . . . . . . . . . . . . . . 0.2460 'X-RAY DIFFRACTION' 2.09 2.18 . . 142 2476 99.92 . . . . 0.1766 . . . . . . . . . . . . . . . 0.2446 'X-RAY DIFFRACTION' 2.18 2.28 . . 142 2504 99.96 . . . . 0.1771 . . . . . . . . . . . . . . . 0.2154 'X-RAY DIFFRACTION' 2.28 2.40 . . 142 2497 100.00 . . . . 0.1833 . . . . . . . . . . . . . . . 0.2596 'X-RAY DIFFRACTION' 2.40 2.55 . . 141 2492 100.00 . . . . 0.1853 . . . . . . . . . . . . . . . 0.2350 'X-RAY DIFFRACTION' 2.55 2.74 . . 144 2523 100.00 . . . . 0.1848 . . . . . . . . . . . . . . . 0.2525 'X-RAY DIFFRACTION' 2.74 3.02 . . 143 2509 100.00 . . . . 0.1802 . . . . . . . . . . . . . . . 0.2252 'X-RAY DIFFRACTION' 3.02 3.46 . . 143 2528 99.96 . . . . 0.1715 . . . . . . . . . . . . . . . 0.1921 'X-RAY DIFFRACTION' 3.46 4.35 . . 147 2563 100.00 . . . . 0.1502 . . . . . . . . . . . . . . . 0.1855 'X-RAY DIFFRACTION' 4.36 51.23 . . 151 2658 99.82 . . . . 0.1708 . . . . . . . . . . . . . . . 0.2081 # _struct.entry_id 24BL _struct.title 'Crystal structure of nuclease MYG1(E58A) bound to Mn2+ and AMP' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 24BL _struct_keywords.text 'MYG1, nuclease, Mn2+, DHH family, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MYG1_HUMAN _struct_ref.pdbx_db_accession Q9HB07 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;APPRIGTHNGTFHCDEALACALLRLLPEYRDAEIVRTRDPEKLASCDIVVDVGGEYDPRRHRYDHHQRSFTETMSSLSPG KPWQTKLSSAGLIYLHFGHKLLAQLLGTSEEDSMVGTLYDKMYENFVEEVDAVDNGISQWAEGEPRYALTTTLSARVARL NPTWNHPDQDTEAGFKRAMDLVQEEFLQRLDFYQHSWLPARALVEEALAQRFQVDPSGEIVELAKGACPWKEHLYHLESG LSPPVAIFFVIYTDQAGQWRIQCVPKEPHSFQSRLPLPEPWRGLRDEALDQVSGIPGCIFVHASGFIGGHRTREGALSMA RATLAQR ; _struct_ref.pdbx_align_begin 43 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 24BL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 327 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9HB07 _struct_ref_seq.db_align_beg 43 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 369 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 43 _struct_ref_seq.pdbx_auth_seq_align_end 369 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 24BL ALA A 16 ? UNP Q9HB07 GLU 58 'engineered mutation' 58 1 1 24BL ILE A 245 ? UNP Q9HB07 VAL 287 conflict 287 2 1 24BL HIS A 311 ? UNP Q9HB07 ARG 353 conflict 353 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1200 ? 1 MORE -25 ? 1 'SSA (A^2)' 16560 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 13 ? LEU A 26 ? HIS A 55 LEU A 68 1 ? 14 HELX_P HELX_P2 AA2 PRO A 27 ? ARG A 30 ? PRO A 69 ARG A 72 5 ? 4 HELX_P HELX_P3 AA3 ASP A 39 ? SER A 45 ? ASP A 81 SER A 87 1 ? 7 HELX_P HELX_P4 AA4 PRO A 58 ? ARG A 60 ? PRO A 100 ARG A 102 5 ? 3 HELX_P HELX_P5 AA5 THR A 73 ? SER A 78 ? THR A 115 SER A 120 1 ? 6 HELX_P HELX_P6 AA6 SER A 88 ? GLY A 107 ? SER A 130 GLY A 149 1 ? 20 HELX_P HELX_P7 AA7 ASP A 112 ? ASN A 125 ? ASP A 154 ASN A 167 1 ? 14 HELX_P HELX_P8 AA8 PHE A 126 ? ASN A 135 ? PHE A 168 ASN A 177 1 ? 10 HELX_P HELX_P9 AA9 THR A 152 ? ARG A 159 ? THR A 194 ARG A 201 1 ? 8 HELX_P HELX_P10 AB1 ASP A 170 ? SER A 196 ? ASP A 212 SER A 238 1 ? 27 HELX_P HELX_P11 AB2 SER A 196 ? GLN A 210 ? SER A 238 GLN A 252 1 ? 15 HELX_P HELX_P12 AB3 GLN A 210 ? ASP A 215 ? GLN A 252 ASP A 257 1 ? 6 HELX_P HELX_P13 AB4 TRP A 230 ? GLU A 238 ? TRP A 272 GLU A 280 1 ? 9 HELX_P HELX_P14 AB5 PRO A 278 ? ARG A 282 ? PRO A 320 ARG A 324 5 ? 5 HELX_P HELX_P15 AB6 ARG A 285 ? GLY A 294 ? ARG A 327 GLY A 336 1 ? 10 HELX_P HELX_P16 AB7 THR A 312 ? GLN A 326 ? THR A 354 GLN A 368 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 8 NE2 ? ? ? 1_555 E MN . MN ? ? A HIS 50 A MN 404 1_555 ? ? ? ? ? ? ? 2.366 ? ? metalc2 metalc ? ? A HIS 13 ND1 ? ? ? 1_555 E MN . MN ? ? A HIS 55 A MN 404 1_555 ? ? ? ? ? ? ? 2.286 ? ? metalc3 metalc ? ? A ASP 15 OD2 ? ? ? 1_555 D MN . MN ? ? A ASP 57 A MN 403 1_555 ? ? ? ? ? ? ? 2.075 ? ? metalc4 metalc ? ? A ASP 51 OD1 ? ? ? 1_555 D MN . MN ? ? A ASP 93 A MN 403 1_555 ? ? ? ? ? ? ? 2.205 ? ? metalc5 metalc ? ? A ASP 51 OD2 ? ? ? 1_555 E MN . MN ? ? A ASP 93 A MN 404 1_555 ? ? ? ? ? ? ? 2.187 ? ? metalc6 metalc ? ? A HIS 65 NE2 ? ? ? 1_555 D MN . MN ? ? A HIS 107 A MN 403 1_555 ? ? ? ? ? ? ? 2.307 ? ? metalc7 metalc ? ? A ASP 134 OD2 ? ? ? 1_555 D MN . MN ? ? A ASP 176 A MN 403 1_555 ? ? ? ? ? ? ? 2.172 ? ? metalc8 metalc ? ? B AMP . O3P ? ? ? 1_555 D MN . MN ? ? A AMP 401 A MN 403 1_555 ? ? ? ? ? ? ? 1.796 ? ? metalc9 metalc ? ? B AMP . O2P ? ? ? 1_555 E MN . MN ? ? A AMP 401 A MN 404 1_555 ? ? ? ? ? ? ? 2.287 ? ? metalc10 metalc ? ? D MN . MN ? ? ? 1_555 F HOH . O ? ? A MN 403 A HOH 501 1_555 ? ? ? ? ? ? ? 2.314 ? ? metalc11 metalc ? ? E MN . MN ? ? ? 1_555 F HOH . O ? ? A MN 404 A HOH 501 1_555 ? ? ? ? ? ? ? 2.199 ? ? metalc12 metalc ? ? E MN . MN ? ? ? 1_555 F HOH . O ? ? A MN 404 A HOH 656 1_555 ? ? ? ? ? ? ? 2.454 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 8 ? A HIS 50 ? 1_555 MN ? E MN . ? A MN 404 ? 1_555 ND1 ? A HIS 13 ? A HIS 55 ? 1_555 98.4 ? 2 NE2 ? A HIS 8 ? A HIS 50 ? 1_555 MN ? E MN . ? A MN 404 ? 1_555 OD2 ? A ASP 51 ? A ASP 93 ? 1_555 81.7 ? 3 ND1 ? A HIS 13 ? A HIS 55 ? 1_555 MN ? E MN . ? A MN 404 ? 1_555 OD2 ? A ASP 51 ? A ASP 93 ? 1_555 165.4 ? 4 NE2 ? A HIS 8 ? A HIS 50 ? 1_555 MN ? E MN . ? A MN 404 ? 1_555 O2P ? B AMP . ? A AMP 401 ? 1_555 99.2 ? 5 ND1 ? A HIS 13 ? A HIS 55 ? 1_555 MN ? E MN . ? A MN 404 ? 1_555 O2P ? B AMP . ? A AMP 401 ? 1_555 92.4 ? 6 OD2 ? A ASP 51 ? A ASP 93 ? 1_555 MN ? E MN . ? A MN 404 ? 1_555 O2P ? B AMP . ? A AMP 401 ? 1_555 102.0 ? 7 NE2 ? A HIS 8 ? A HIS 50 ? 1_555 MN ? E MN . ? A MN 404 ? 1_555 O ? F HOH . ? A HOH 501 ? 1_555 156.9 ? 8 ND1 ? A HIS 13 ? A HIS 55 ? 1_555 MN ? E MN . ? A MN 404 ? 1_555 O ? F HOH . ? A HOH 501 ? 1_555 101.9 ? 9 OD2 ? A ASP 51 ? A ASP 93 ? 1_555 MN ? E MN . ? A MN 404 ? 1_555 O ? F HOH . ? A HOH 501 ? 1_555 75.9 ? 10 O2P ? B AMP . ? A AMP 401 ? 1_555 MN ? E MN . ? A MN 404 ? 1_555 O ? F HOH . ? A HOH 501 ? 1_555 90.9 ? 11 NE2 ? A HIS 8 ? A HIS 50 ? 1_555 MN ? E MN . ? A MN 404 ? 1_555 O ? F HOH . ? A HOH 656 ? 1_555 71.4 ? 12 ND1 ? A HIS 13 ? A HIS 55 ? 1_555 MN ? E MN . ? A MN 404 ? 1_555 O ? F HOH . ? A HOH 656 ? 1_555 78.2 ? 13 OD2 ? A ASP 51 ? A ASP 93 ? 1_555 MN ? E MN . ? A MN 404 ? 1_555 O ? F HOH . ? A HOH 656 ? 1_555 88.1 ? 14 O2P ? B AMP . ? A AMP 401 ? 1_555 MN ? E MN . ? A MN 404 ? 1_555 O ? F HOH . ? A HOH 656 ? 1_555 165.2 ? 15 O ? F HOH . ? A HOH 501 ? 1_555 MN ? E MN . ? A MN 404 ? 1_555 O ? F HOH . ? A HOH 656 ? 1_555 102.1 ? 16 OD2 ? A ASP 15 ? A ASP 57 ? 1_555 MN ? D MN . ? A MN 403 ? 1_555 OD1 ? A ASP 51 ? A ASP 93 ? 1_555 86.0 ? 17 OD2 ? A ASP 15 ? A ASP 57 ? 1_555 MN ? D MN . ? A MN 403 ? 1_555 NE2 ? A HIS 65 ? A HIS 107 ? 1_555 93.1 ? 18 OD1 ? A ASP 51 ? A ASP 93 ? 1_555 MN ? D MN . ? A MN 403 ? 1_555 NE2 ? A HIS 65 ? A HIS 107 ? 1_555 92.5 ? 19 OD2 ? A ASP 15 ? A ASP 57 ? 1_555 MN ? D MN . ? A MN 403 ? 1_555 OD2 ? A ASP 134 ? A ASP 176 ? 1_555 89.0 ? 20 OD1 ? A ASP 51 ? A ASP 93 ? 1_555 MN ? D MN . ? A MN 403 ? 1_555 OD2 ? A ASP 134 ? A ASP 176 ? 1_555 174.1 ? 21 NE2 ? A HIS 65 ? A HIS 107 ? 1_555 MN ? D MN . ? A MN 403 ? 1_555 OD2 ? A ASP 134 ? A ASP 176 ? 1_555 84.5 ? 22 OD2 ? A ASP 15 ? A ASP 57 ? 1_555 MN ? D MN . ? A MN 403 ? 1_555 O3P ? B AMP . ? A AMP 401 ? 1_555 147.3 ? 23 OD1 ? A ASP 51 ? A ASP 93 ? 1_555 MN ? D MN . ? A MN 403 ? 1_555 O3P ? B AMP . ? A AMP 401 ? 1_555 98.4 ? 24 NE2 ? A HIS 65 ? A HIS 107 ? 1_555 MN ? D MN . ? A MN 403 ? 1_555 O3P ? B AMP . ? A AMP 401 ? 1_555 118.8 ? 25 OD2 ? A ASP 134 ? A ASP 176 ? 1_555 MN ? D MN . ? A MN 403 ? 1_555 O3P ? B AMP . ? A AMP 401 ? 1_555 87.5 ? 26 OD2 ? A ASP 15 ? A ASP 57 ? 1_555 MN ? D MN . ? A MN 403 ? 1_555 O ? F HOH . ? A HOH 501 ? 1_555 92.0 ? 27 OD1 ? A ASP 51 ? A ASP 93 ? 1_555 MN ? D MN . ? A MN 403 ? 1_555 O ? F HOH . ? A HOH 501 ? 1_555 93.6 ? 28 NE2 ? A HIS 65 ? A HIS 107 ? 1_555 MN ? D MN . ? A MN 403 ? 1_555 O ? F HOH . ? A HOH 501 ? 1_555 172.3 ? 29 OD2 ? A ASP 134 ? A ASP 176 ? 1_555 MN ? D MN . ? A MN 403 ? 1_555 O ? F HOH . ? A HOH 501 ? 1_555 89.8 ? 30 O3P ? B AMP . ? A AMP 401 ? 1_555 MN ? D MN . ? A MN 403 ? 1_555 O ? F HOH . ? A HOH 501 ? 1_555 55.5 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 33 ? ARG A 36 ? GLU A 75 ARG A 78 AA1 2 ARG A 4 ? THR A 7 ? ARG A 46 THR A 49 AA1 3 ILE A 48 ? VAL A 50 ? ILE A 90 VAL A 92 AA1 4 ARG A 62 ? TYR A 63 ? ARG A 104 TYR A 105 AA1 5 TYR A 56 ? ASP A 57 ? TYR A 98 ASP A 99 AA2 1 ILE A 220 ? GLU A 222 ? ILE A 262 GLU A 264 AA2 2 PHE A 249 ? THR A 253 ? PHE A 291 THR A 295 AA2 3 TRP A 259 ? CYS A 263 ? TRP A 301 CYS A 305 AA2 4 ILE A 307 ? HIS A 310 ? ILE A 349 HIS A 352 AA2 5 CYS A 298 ? VAL A 301 ? CYS A 340 VAL A 343 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O VAL A 35 ? O VAL A 77 N ILE A 5 ? N ILE A 47 AA1 2 3 N GLY A 6 ? N GLY A 48 O ILE A 48 ? O ILE A 90 AA1 3 4 N VAL A 49 ? N VAL A 91 O TYR A 63 ? O TYR A 105 AA1 4 5 O ARG A 62 ? O ARG A 104 N ASP A 57 ? N ASP A 99 AA2 1 2 N VAL A 221 ? N VAL A 263 O ILE A 251 ? O ILE A 293 AA2 2 3 N TYR A 252 ? N TYR A 294 O ARG A 260 ? O ARG A 302 AA2 3 4 N TRP A 259 ? N TRP A 301 O HIS A 310 ? O HIS A 352 AA2 4 5 O GLY A 309 ? O GLY A 351 N ILE A 299 ? N ILE A 341 # _pdbx_entry_details.entry_id 24BL _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O3P A AMP 401 ? ? O A HOH 501 ? ? 1.97 2 1 O A HOH 508 ? ? O A HOH 515 ? ? 2.04 3 1 O A HOH 772 ? ? O A HOH 856 ? ? 2.11 4 1 O A HOH 869 ? ? O A HOH 894 ? ? 2.15 5 1 O A HOH 774 ? ? O A HOH 888 ? ? 2.15 6 1 O A HOH 701 ? ? O A HOH 882 ? ? 2.16 7 1 OE1 A GLN 225 ? ? O A HOH 502 ? ? 2.17 8 1 OE1 A GLN 368 ? ? O A HOH 503 ? ? 2.17 9 1 O A HOH 771 ? ? O A HOH 859 ? ? 2.17 10 1 O A HOH 760 ? ? O A HOH 856 ? ? 2.18 11 1 OE1 A GLU 226 ? ? O A HOH 504 ? ? 2.19 12 1 OD1 A ASP 73 ? ? O A HOH 505 ? ? 2.19 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 601 ? ? 1_555 O A HOH 775 ? ? 3_555 2.19 2 1 O A HOH 707 ? ? 1_555 O A HOH 763 ? ? 6_444 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 168 ? ? -160.04 -56.90 2 1 ASP A 210 ? ? -63.24 96.99 3 1 ASP A 328 ? ? 52.13 -134.26 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 526 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z 3 -x,y,-z+1/2 4 -x,-y,z+1/2 5 x+1/2,y+1/2,z 6 x+1/2,-y+1/2,-z 7 -x+1/2,y+1/2,-z+1/2 8 -x+1/2,-y+1/2,z+1/2 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 930 ? 6.31 . 2 1 O ? A HOH 931 ? 6.71 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 283 ? A LEU 241 2 1 Y 1 A SER 284 ? A SER 242 3 1 Y 1 A PRO 285 ? A PRO 243 4 1 Y 1 A PRO 286 ? A PRO 244 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 AMP P P N N 14 AMP O1P O N N 15 AMP O2P O N N 16 AMP O3P O N N 17 AMP "O5'" O N N 18 AMP "C5'" C N N 19 AMP "C4'" C N R 20 AMP "O4'" O N N 21 AMP "C3'" C N S 22 AMP "O3'" O N N 23 AMP "C2'" C N R 24 AMP "O2'" O N N 25 AMP "C1'" C N R 26 AMP N9 N Y N 27 AMP C8 C Y N 28 AMP N7 N Y N 29 AMP C5 C Y N 30 AMP C6 C Y N 31 AMP N6 N N N 32 AMP N1 N Y N 33 AMP C2 C Y N 34 AMP N3 N Y N 35 AMP C4 C Y N 36 AMP HOP2 H N N 37 AMP HOP3 H N N 38 AMP "H5'1" H N N 39 AMP "H5'2" H N N 40 AMP "H4'" H N N 41 AMP "H3'" H N N 42 AMP "HO3'" H N N 43 AMP "H2'" H N N 44 AMP "HO2'" H N N 45 AMP "H1'" H N N 46 AMP H8 H N N 47 AMP HN61 H N N 48 AMP HN62 H N N 49 AMP H2 H N N 50 ARG N N N N 51 ARG CA C N S 52 ARG C C N N 53 ARG O O N N 54 ARG CB C N N 55 ARG CG C N N 56 ARG CD C N N 57 ARG NE N N N 58 ARG CZ C N N 59 ARG NH1 N N N 60 ARG NH2 N N N 61 ARG OXT O N N 62 ARG H H N N 63 ARG H2 H N N 64 ARG HA H N N 65 ARG HB2 H N N 66 ARG HB3 H N N 67 ARG HG2 H N N 68 ARG HG3 H N N 69 ARG HD2 H N N 70 ARG HD3 H N N 71 ARG HE H N N 72 ARG HH11 H N N 73 ARG HH12 H N N 74 ARG HH21 H N N 75 ARG HH22 H N N 76 ARG HXT H N N 77 ASN N N N N 78 ASN CA C N S 79 ASN C C N N 80 ASN O O N N 81 ASN CB C N N 82 ASN CG C N N 83 ASN OD1 O N N 84 ASN ND2 N N N 85 ASN OXT O N N 86 ASN H H N N 87 ASN H2 H N N 88 ASN HA H N N 89 ASN HB2 H N N 90 ASN HB3 H N N 91 ASN HD21 H N N 92 ASN HD22 H N N 93 ASN HXT H N N 94 ASP N N N N 95 ASP CA C N S 96 ASP C C N N 97 ASP O O N N 98 ASP CB C N N 99 ASP CG C N N 100 ASP OD1 O N N 101 ASP OD2 O N N 102 ASP OXT O N N 103 ASP H H N N 104 ASP H2 H N N 105 ASP HA H N N 106 ASP HB2 H N N 107 ASP HB3 H N N 108 ASP HD2 H N N 109 ASP HXT H N N 110 CYS N N N N 111 CYS CA C N R 112 CYS C C N N 113 CYS O O N N 114 CYS CB C N N 115 CYS SG S N N 116 CYS OXT O N N 117 CYS H H N N 118 CYS H2 H N N 119 CYS HA H N N 120 CYS HB2 H N N 121 CYS HB3 H N N 122 CYS HG H N N 123 CYS HXT H N N 124 GLN N N N N 125 GLN CA C N S 126 GLN C C N N 127 GLN O O N N 128 GLN CB C N N 129 GLN CG C N N 130 GLN CD C N N 131 GLN OE1 O N N 132 GLN NE2 N N N 133 GLN OXT O N N 134 GLN H H N N 135 GLN H2 H N N 136 GLN HA H N N 137 GLN HB2 H N N 138 GLN HB3 H N N 139 GLN HG2 H N N 140 GLN HG3 H N N 141 GLN HE21 H N N 142 GLN HE22 H N N 143 GLN HXT H N N 144 GLU N N N N 145 GLU CA C N S 146 GLU C C N N 147 GLU O O N N 148 GLU CB C N N 149 GLU CG C N N 150 GLU CD C N N 151 GLU OE1 O N N 152 GLU OE2 O N N 153 GLU OXT O N N 154 GLU H H N N 155 GLU H2 H N N 156 GLU HA H N N 157 GLU HB2 H N N 158 GLU HB3 H N N 159 GLU HG2 H N N 160 GLU HG3 H N N 161 GLU HE2 H N N 162 GLU HXT H N N 163 GLY N N N N 164 GLY CA C N N 165 GLY C C N N 166 GLY O O N N 167 GLY OXT O N N 168 GLY H H N N 169 GLY H2 H N N 170 GLY HA2 H N N 171 GLY HA3 H N N 172 GLY HXT H N N 173 HIS N N N N 174 HIS CA C N S 175 HIS C C N N 176 HIS O O N N 177 HIS CB C N N 178 HIS CG C Y N 179 HIS ND1 N Y N 180 HIS CD2 C Y N 181 HIS CE1 C Y N 182 HIS NE2 N Y N 183 HIS OXT O N N 184 HIS H H N N 185 HIS H2 H N N 186 HIS HA H N N 187 HIS HB2 H N N 188 HIS HB3 H N N 189 HIS HD1 H N N 190 HIS HD2 H N N 191 HIS HE1 H N N 192 HIS HE2 H N N 193 HIS HXT H N N 194 HOH O O N N 195 HOH H1 H N N 196 HOH H2 H N N 197 ILE N N N N 198 ILE CA C N S 199 ILE C C N N 200 ILE O O N N 201 ILE CB C N S 202 ILE CG1 C N N 203 ILE CG2 C N N 204 ILE CD1 C N N 205 ILE OXT O N N 206 ILE H H N N 207 ILE H2 H N N 208 ILE HA H N N 209 ILE HB H N N 210 ILE HG12 H N N 211 ILE HG13 H N N 212 ILE HG21 H N N 213 ILE HG22 H N N 214 ILE HG23 H N N 215 ILE HD11 H N N 216 ILE HD12 H N N 217 ILE HD13 H N N 218 ILE HXT H N N 219 LEU N N N N 220 LEU CA C N S 221 LEU C C N N 222 LEU O O N N 223 LEU CB C N N 224 LEU CG C N N 225 LEU CD1 C N N 226 LEU CD2 C N N 227 LEU OXT O N N 228 LEU H H N N 229 LEU H2 H N N 230 LEU HA H N N 231 LEU HB2 H N N 232 LEU HB3 H N N 233 LEU HG H N N 234 LEU HD11 H N N 235 LEU HD12 H N N 236 LEU HD13 H N N 237 LEU HD21 H N N 238 LEU HD22 H N N 239 LEU HD23 H N N 240 LEU HXT H N N 241 LYS N N N N 242 LYS CA C N S 243 LYS C C N N 244 LYS O O N N 245 LYS CB C N N 246 LYS CG C N N 247 LYS CD C N N 248 LYS CE C N N 249 LYS NZ N N N 250 LYS OXT O N N 251 LYS H H N N 252 LYS H2 H N N 253 LYS HA H N N 254 LYS HB2 H N N 255 LYS HB3 H N N 256 LYS HG2 H N N 257 LYS HG3 H N N 258 LYS HD2 H N N 259 LYS HD3 H N N 260 LYS HE2 H N N 261 LYS HE3 H N N 262 LYS HZ1 H N N 263 LYS HZ2 H N N 264 LYS HZ3 H N N 265 LYS HXT H N N 266 MET N N N N 267 MET CA C N S 268 MET C C N N 269 MET O O N N 270 MET CB C N N 271 MET CG C N N 272 MET SD S N N 273 MET CE C N N 274 MET OXT O N N 275 MET H H N N 276 MET H2 H N N 277 MET HA H N N 278 MET HB2 H N N 279 MET HB3 H N N 280 MET HG2 H N N 281 MET HG3 H N N 282 MET HE1 H N N 283 MET HE2 H N N 284 MET HE3 H N N 285 MET HXT H N N 286 MN MN MN N N 287 PHE N N N N 288 PHE CA C N S 289 PHE C C N N 290 PHE O O N N 291 PHE CB C N N 292 PHE CG C Y N 293 PHE CD1 C Y N 294 PHE CD2 C Y N 295 PHE CE1 C Y N 296 PHE CE2 C Y N 297 PHE CZ C Y N 298 PHE OXT O N N 299 PHE H H N N 300 PHE H2 H N N 301 PHE HA H N N 302 PHE HB2 H N N 303 PHE HB3 H N N 304 PHE HD1 H N N 305 PHE HD2 H N N 306 PHE HE1 H N N 307 PHE HE2 H N N 308 PHE HZ H N N 309 PHE HXT H N N 310 PRO N N N N 311 PRO CA C N S 312 PRO C C N N 313 PRO O O N N 314 PRO CB C N N 315 PRO CG C N N 316 PRO CD C N N 317 PRO OXT O N N 318 PRO H H N N 319 PRO HA H N N 320 PRO HB2 H N N 321 PRO HB3 H N N 322 PRO HG2 H N N 323 PRO HG3 H N N 324 PRO HD2 H N N 325 PRO HD3 H N N 326 PRO HXT H N N 327 SER N N N N 328 SER CA C N S 329 SER C C N N 330 SER O O N N 331 SER CB C N N 332 SER OG O N N 333 SER OXT O N N 334 SER H H N N 335 SER H2 H N N 336 SER HA H N N 337 SER HB2 H N N 338 SER HB3 H N N 339 SER HG H N N 340 SER HXT H N N 341 THR N N N N 342 THR CA C N S 343 THR C C N N 344 THR O O N N 345 THR CB C N R 346 THR OG1 O N N 347 THR CG2 C N N 348 THR OXT O N N 349 THR H H N N 350 THR H2 H N N 351 THR HA H N N 352 THR HB H N N 353 THR HG1 H N N 354 THR HG21 H N N 355 THR HG22 H N N 356 THR HG23 H N N 357 THR HXT H N N 358 TRP N N N N 359 TRP CA C N S 360 TRP C C N N 361 TRP O O N N 362 TRP CB C N N 363 TRP CG C Y N 364 TRP CD1 C Y N 365 TRP CD2 C Y N 366 TRP NE1 N Y N 367 TRP CE2 C Y N 368 TRP CE3 C Y N 369 TRP CZ2 C Y N 370 TRP CZ3 C Y N 371 TRP CH2 C Y N 372 TRP OXT O N N 373 TRP H H N N 374 TRP H2 H N N 375 TRP HA H N N 376 TRP HB2 H N N 377 TRP HB3 H N N 378 TRP HD1 H N N 379 TRP HE1 H N N 380 TRP HE3 H N N 381 TRP HZ2 H N N 382 TRP HZ3 H N N 383 TRP HH2 H N N 384 TRP HXT H N N 385 TYR N N N N 386 TYR CA C N S 387 TYR C C N N 388 TYR O O N N 389 TYR CB C N N 390 TYR CG C Y N 391 TYR CD1 C Y N 392 TYR CD2 C Y N 393 TYR CE1 C Y N 394 TYR CE2 C Y N 395 TYR CZ C Y N 396 TYR OH O N N 397 TYR OXT O N N 398 TYR H H N N 399 TYR H2 H N N 400 TYR HA H N N 401 TYR HB2 H N N 402 TYR HB3 H N N 403 TYR HD1 H N N 404 TYR HD2 H N N 405 TYR HE1 H N N 406 TYR HE2 H N N 407 TYR HH H N N 408 TYR HXT H N N 409 VAL N N N N 410 VAL CA C N S 411 VAL C C N N 412 VAL O O N N 413 VAL CB C N N 414 VAL CG1 C N N 415 VAL CG2 C N N 416 VAL OXT O N N 417 VAL H H N N 418 VAL H2 H N N 419 VAL HA H N N 420 VAL HB H N N 421 VAL HG11 H N N 422 VAL HG12 H N N 423 VAL HG13 H N N 424 VAL HG21 H N N 425 VAL HG22 H N N 426 VAL HG23 H N N 427 VAL HXT H N N 428 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 AMP P O1P doub N N 13 AMP P O2P sing N N 14 AMP P O3P sing N N 15 AMP P "O5'" sing N N 16 AMP O2P HOP2 sing N N 17 AMP O3P HOP3 sing N N 18 AMP "O5'" "C5'" sing N N 19 AMP "C5'" "C4'" sing N N 20 AMP "C5'" "H5'1" sing N N 21 AMP "C5'" "H5'2" sing N N 22 AMP "C4'" "O4'" sing N N 23 AMP "C4'" "C3'" sing N N 24 AMP "C4'" "H4'" sing N N 25 AMP "O4'" "C1'" sing N N 26 AMP "C3'" "O3'" sing N N 27 AMP "C3'" "C2'" sing N N 28 AMP "C3'" "H3'" sing N N 29 AMP "O3'" "HO3'" sing N N 30 AMP "C2'" "O2'" sing N N 31 AMP "C2'" "C1'" sing N N 32 AMP "C2'" "H2'" sing N N 33 AMP "O2'" "HO2'" sing N N 34 AMP "C1'" N9 sing N N 35 AMP "C1'" "H1'" sing N N 36 AMP N9 C8 sing Y N 37 AMP N9 C4 sing Y N 38 AMP C8 N7 doub Y N 39 AMP C8 H8 sing N N 40 AMP N7 C5 sing Y N 41 AMP C5 C6 sing Y N 42 AMP C5 C4 doub Y N 43 AMP C6 N6 sing N N 44 AMP C6 N1 doub Y N 45 AMP N6 HN61 sing N N 46 AMP N6 HN62 sing N N 47 AMP N1 C2 sing Y N 48 AMP C2 N3 doub Y N 49 AMP C2 H2 sing N N 50 AMP N3 C4 sing Y N 51 ARG N CA sing N N 52 ARG N H sing N N 53 ARG N H2 sing N N 54 ARG CA C sing N N 55 ARG CA CB sing N N 56 ARG CA HA sing N N 57 ARG C O doub N N 58 ARG C OXT sing N N 59 ARG CB CG sing N N 60 ARG CB HB2 sing N N 61 ARG CB HB3 sing N N 62 ARG CG CD sing N N 63 ARG CG HG2 sing N N 64 ARG CG HG3 sing N N 65 ARG CD NE sing N N 66 ARG CD HD2 sing N N 67 ARG CD HD3 sing N N 68 ARG NE CZ sing N N 69 ARG NE HE sing N N 70 ARG CZ NH1 sing N N 71 ARG CZ NH2 doub N N 72 ARG NH1 HH11 sing N N 73 ARG NH1 HH12 sing N N 74 ARG NH2 HH21 sing N N 75 ARG NH2 HH22 sing N N 76 ARG OXT HXT sing N N 77 ASN N CA sing N N 78 ASN N H sing N N 79 ASN N H2 sing N N 80 ASN CA C sing N N 81 ASN CA CB sing N N 82 ASN CA HA sing N N 83 ASN C O doub N N 84 ASN C OXT sing N N 85 ASN CB CG sing N N 86 ASN CB HB2 sing N N 87 ASN CB HB3 sing N N 88 ASN CG OD1 doub N N 89 ASN CG ND2 sing N N 90 ASN ND2 HD21 sing N N 91 ASN ND2 HD22 sing N N 92 ASN OXT HXT sing N N 93 ASP N CA sing N N 94 ASP N H sing N N 95 ASP N H2 sing N N 96 ASP CA C sing N N 97 ASP CA CB sing N N 98 ASP CA HA sing N N 99 ASP C O doub N N 100 ASP C OXT sing N N 101 ASP CB CG sing N N 102 ASP CB HB2 sing N N 103 ASP CB HB3 sing N N 104 ASP CG OD1 doub N N 105 ASP CG OD2 sing N N 106 ASP OD2 HD2 sing N N 107 ASP OXT HXT sing N N 108 CYS N CA sing N N 109 CYS N H sing N N 110 CYS N H2 sing N N 111 CYS CA C sing N N 112 CYS CA CB sing N N 113 CYS CA HA sing N N 114 CYS C O doub N N 115 CYS C OXT sing N N 116 CYS CB SG sing N N 117 CYS CB HB2 sing N N 118 CYS CB HB3 sing N N 119 CYS SG HG sing N N 120 CYS OXT HXT sing N N 121 GLN N CA sing N N 122 GLN N H sing N N 123 GLN N H2 sing N N 124 GLN CA C sing N N 125 GLN CA CB sing N N 126 GLN CA HA sing N N 127 GLN C O doub N N 128 GLN C OXT sing N N 129 GLN CB CG sing N N 130 GLN CB HB2 sing N N 131 GLN CB HB3 sing N N 132 GLN CG CD sing N N 133 GLN CG HG2 sing N N 134 GLN CG HG3 sing N N 135 GLN CD OE1 doub N N 136 GLN CD NE2 sing N N 137 GLN NE2 HE21 sing N N 138 GLN NE2 HE22 sing N N 139 GLN OXT HXT sing N N 140 GLU N CA sing N N 141 GLU N H sing N N 142 GLU N H2 sing N N 143 GLU CA C sing N N 144 GLU CA CB sing N N 145 GLU CA HA sing N N 146 GLU C O doub N N 147 GLU C OXT sing N N 148 GLU CB CG sing N N 149 GLU CB HB2 sing N N 150 GLU CB HB3 sing N N 151 GLU CG CD sing N N 152 GLU CG HG2 sing N N 153 GLU CG HG3 sing N N 154 GLU CD OE1 doub N N 155 GLU CD OE2 sing N N 156 GLU OE2 HE2 sing N N 157 GLU OXT HXT sing N N 158 GLY N CA sing N N 159 GLY N H sing N N 160 GLY N H2 sing N N 161 GLY CA C sing N N 162 GLY CA HA2 sing N N 163 GLY CA HA3 sing N N 164 GLY C O doub N N 165 GLY C OXT sing N N 166 GLY OXT HXT sing N N 167 HIS N CA sing N N 168 HIS N H sing N N 169 HIS N H2 sing N N 170 HIS CA C sing N N 171 HIS CA CB sing N N 172 HIS CA HA sing N N 173 HIS C O doub N N 174 HIS C OXT sing N N 175 HIS CB CG sing N N 176 HIS CB HB2 sing N N 177 HIS CB HB3 sing N N 178 HIS CG ND1 sing Y N 179 HIS CG CD2 doub Y N 180 HIS ND1 CE1 doub Y N 181 HIS ND1 HD1 sing N N 182 HIS CD2 NE2 sing Y N 183 HIS CD2 HD2 sing N N 184 HIS CE1 NE2 sing Y N 185 HIS CE1 HE1 sing N N 186 HIS NE2 HE2 sing N N 187 HIS OXT HXT sing N N 188 HOH O H1 sing N N 189 HOH O H2 sing N N 190 ILE N CA sing N N 191 ILE N H sing N N 192 ILE N H2 sing N N 193 ILE CA C sing N N 194 ILE CA CB sing N N 195 ILE CA HA sing N N 196 ILE C O doub N N 197 ILE C OXT sing N N 198 ILE CB CG1 sing N N 199 ILE CB CG2 sing N N 200 ILE CB HB sing N N 201 ILE CG1 CD1 sing N N 202 ILE CG1 HG12 sing N N 203 ILE CG1 HG13 sing N N 204 ILE CG2 HG21 sing N N 205 ILE CG2 HG22 sing N N 206 ILE CG2 HG23 sing N N 207 ILE CD1 HD11 sing N N 208 ILE CD1 HD12 sing N N 209 ILE CD1 HD13 sing N N 210 ILE OXT HXT sing N N 211 LEU N CA sing N N 212 LEU N H sing N N 213 LEU N H2 sing N N 214 LEU CA C sing N N 215 LEU CA CB sing N N 216 LEU CA HA sing N N 217 LEU C O doub N N 218 LEU C OXT sing N N 219 LEU CB CG sing N N 220 LEU CB HB2 sing N N 221 LEU CB HB3 sing N N 222 LEU CG CD1 sing N N 223 LEU CG CD2 sing N N 224 LEU CG HG sing N N 225 LEU CD1 HD11 sing N N 226 LEU CD1 HD12 sing N N 227 LEU CD1 HD13 sing N N 228 LEU CD2 HD21 sing N N 229 LEU CD2 HD22 sing N N 230 LEU CD2 HD23 sing N N 231 LEU OXT HXT sing N N 232 LYS N CA sing N N 233 LYS N H sing N N 234 LYS N H2 sing N N 235 LYS CA C sing N N 236 LYS CA CB sing N N 237 LYS CA HA sing N N 238 LYS C O doub N N 239 LYS C OXT sing N N 240 LYS CB CG sing N N 241 LYS CB HB2 sing N N 242 LYS CB HB3 sing N N 243 LYS CG CD sing N N 244 LYS CG HG2 sing N N 245 LYS CG HG3 sing N N 246 LYS CD CE sing N N 247 LYS CD HD2 sing N N 248 LYS CD HD3 sing N N 249 LYS CE NZ sing N N 250 LYS CE HE2 sing N N 251 LYS CE HE3 sing N N 252 LYS NZ HZ1 sing N N 253 LYS NZ HZ2 sing N N 254 LYS NZ HZ3 sing N N 255 LYS OXT HXT sing N N 256 MET N CA sing N N 257 MET N H sing N N 258 MET N H2 sing N N 259 MET CA C sing N N 260 MET CA CB sing N N 261 MET CA HA sing N N 262 MET C O doub N N 263 MET C OXT sing N N 264 MET CB CG sing N N 265 MET CB HB2 sing N N 266 MET CB HB3 sing N N 267 MET CG SD sing N N 268 MET CG HG2 sing N N 269 MET CG HG3 sing N N 270 MET SD CE sing N N 271 MET CE HE1 sing N N 272 MET CE HE2 sing N N 273 MET CE HE3 sing N N 274 MET OXT HXT sing N N 275 PHE N CA sing N N 276 PHE N H sing N N 277 PHE N H2 sing N N 278 PHE CA C sing N N 279 PHE CA CB sing N N 280 PHE CA HA sing N N 281 PHE C O doub N N 282 PHE C OXT sing N N 283 PHE CB CG sing N N 284 PHE CB HB2 sing N N 285 PHE CB HB3 sing N N 286 PHE CG CD1 doub Y N 287 PHE CG CD2 sing Y N 288 PHE CD1 CE1 sing Y N 289 PHE CD1 HD1 sing N N 290 PHE CD2 CE2 doub Y N 291 PHE CD2 HD2 sing N N 292 PHE CE1 CZ doub Y N 293 PHE CE1 HE1 sing N N 294 PHE CE2 CZ sing Y N 295 PHE CE2 HE2 sing N N 296 PHE CZ HZ sing N N 297 PHE OXT HXT sing N N 298 PRO N CA sing N N 299 PRO N CD sing N N 300 PRO N H sing N N 301 PRO CA C sing N N 302 PRO CA CB sing N N 303 PRO CA HA sing N N 304 PRO C O doub N N 305 PRO C OXT sing N N 306 PRO CB CG sing N N 307 PRO CB HB2 sing N N 308 PRO CB HB3 sing N N 309 PRO CG CD sing N N 310 PRO CG HG2 sing N N 311 PRO CG HG3 sing N N 312 PRO CD HD2 sing N N 313 PRO CD HD3 sing N N 314 PRO OXT HXT sing N N 315 SER N CA sing N N 316 SER N H sing N N 317 SER N H2 sing N N 318 SER CA C sing N N 319 SER CA CB sing N N 320 SER CA HA sing N N 321 SER C O doub N N 322 SER C OXT sing N N 323 SER CB OG sing N N 324 SER CB HB2 sing N N 325 SER CB HB3 sing N N 326 SER OG HG sing N N 327 SER OXT HXT sing N N 328 THR N CA sing N N 329 THR N H sing N N 330 THR N H2 sing N N 331 THR CA C sing N N 332 THR CA CB sing N N 333 THR CA HA sing N N 334 THR C O doub N N 335 THR C OXT sing N N 336 THR CB OG1 sing N N 337 THR CB CG2 sing N N 338 THR CB HB sing N N 339 THR OG1 HG1 sing N N 340 THR CG2 HG21 sing N N 341 THR CG2 HG22 sing N N 342 THR CG2 HG23 sing N N 343 THR OXT HXT sing N N 344 TRP N CA sing N N 345 TRP N H sing N N 346 TRP N H2 sing N N 347 TRP CA C sing N N 348 TRP CA CB sing N N 349 TRP CA HA sing N N 350 TRP C O doub N N 351 TRP C OXT sing N N 352 TRP CB CG sing N N 353 TRP CB HB2 sing N N 354 TRP CB HB3 sing N N 355 TRP CG CD1 doub Y N 356 TRP CG CD2 sing Y N 357 TRP CD1 NE1 sing Y N 358 TRP CD1 HD1 sing N N 359 TRP CD2 CE2 doub Y N 360 TRP CD2 CE3 sing Y N 361 TRP NE1 CE2 sing Y N 362 TRP NE1 HE1 sing N N 363 TRP CE2 CZ2 sing Y N 364 TRP CE3 CZ3 doub Y N 365 TRP CE3 HE3 sing N N 366 TRP CZ2 CH2 doub Y N 367 TRP CZ2 HZ2 sing N N 368 TRP CZ3 CH2 sing Y N 369 TRP CZ3 HZ3 sing N N 370 TRP CH2 HH2 sing N N 371 TRP OXT HXT sing N N 372 TYR N CA sing N N 373 TYR N H sing N N 374 TYR N H2 sing N N 375 TYR CA C sing N N 376 TYR CA CB sing N N 377 TYR CA HA sing N N 378 TYR C O doub N N 379 TYR C OXT sing N N 380 TYR CB CG sing N N 381 TYR CB HB2 sing N N 382 TYR CB HB3 sing N N 383 TYR CG CD1 doub Y N 384 TYR CG CD2 sing Y N 385 TYR CD1 CE1 sing Y N 386 TYR CD1 HD1 sing N N 387 TYR CD2 CE2 doub Y N 388 TYR CD2 HD2 sing N N 389 TYR CE1 CZ doub Y N 390 TYR CE1 HE1 sing N N 391 TYR CE2 CZ sing Y N 392 TYR CE2 HE2 sing N N 393 TYR CZ OH sing N N 394 TYR OH HH sing N N 395 TYR OXT HXT sing N N 396 VAL N CA sing N N 397 VAL N H sing N N 398 VAL N H2 sing N N 399 VAL CA C sing N N 400 VAL CA CB sing N N 401 VAL CA HA sing N N 402 VAL C O doub N N 403 VAL C OXT sing N N 404 VAL CB CG1 sing N N 405 VAL CB CG2 sing N N 406 VAL CB HB sing N N 407 VAL CG1 HG11 sing N N 408 VAL CG1 HG12 sing N N 409 VAL CG1 HG13 sing N N 410 VAL CG2 HG21 sing N N 411 VAL CG2 HG22 sing N N 412 VAL CG2 HG23 sing N N 413 VAL OXT HXT sing N N 414 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'C 2 2 21' _space_group.name_Hall 'C 2c 2' _space_group.IT_number 20 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 24BL _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.014267 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010216 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008549 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MN ? ? 20.23591 4.67902 ? ? 2.76514 44.01191 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 ? ? 1.42069 35.72801 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #