data_27WO # _entry.id 27WO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.417 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 27WO pdb_000027wo 10.2210/pdb27wo/pdb WWPDB D_1300075643 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-09-23 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 27WO _pdbx_database_status.recvd_initial_deposition_date 2026-06-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 3 _pdbx_contact_author.email ymkim@konkuk.ac.kr _pdbx_contact_author.name_first YANGMEE _pdbx_contact_author.name_last KIM _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-6438-4718 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lee, W.C.' 1 0000-0002-5500-9518 'Oh, Y.' 2 0009-0009-7774-7560 'Kim, Y.' 3 0000-0001-6438-4718 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of the M11V/C50L double mutant acyl carrier protein from Cutibacterium acnes' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Oh, Y.' 1 0009-0009-7774-7560 primary 'Lee, W.C.' 2 0000-0002-5500-9518 primary 'Kim, Y.' 3 0000-0001-6438-4718 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Acyl carrier protein' 9011.917 1 ? 'M11V, C50L' ? ? 2 non-polymer syn 'ZINC ION' 65.409 9 ? ? ? ? 3 water nat water 18.015 42 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ACP # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MADKDQILADVADIVNDITGVDQSEVTFEKSFVDDLDVDSLSMVEIIYALDEKFGVEIPDEESKNIKIVGDAVNYIIEHQ S ; _entity_poly.pdbx_seq_one_letter_code_can ;MADKDQILADVADIVNDITGVDQSEVTFEKSFVDDLDVDSLSMVEIIYALDEKFGVEIPDEESKNIKIVGDAVNYIIEHQ S ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ASP n 1 4 LYS n 1 5 ASP n 1 6 GLN n 1 7 ILE n 1 8 LEU n 1 9 ALA n 1 10 ASP n 1 11 VAL n 1 12 ALA n 1 13 ASP n 1 14 ILE n 1 15 VAL n 1 16 ASN n 1 17 ASP n 1 18 ILE n 1 19 THR n 1 20 GLY n 1 21 VAL n 1 22 ASP n 1 23 GLN n 1 24 SER n 1 25 GLU n 1 26 VAL n 1 27 THR n 1 28 PHE n 1 29 GLU n 1 30 LYS n 1 31 SER n 1 32 PHE n 1 33 VAL n 1 34 ASP n 1 35 ASP n 1 36 LEU n 1 37 ASP n 1 38 VAL n 1 39 ASP n 1 40 SER n 1 41 LEU n 1 42 SER n 1 43 MET n 1 44 VAL n 1 45 GLU n 1 46 ILE n 1 47 ILE n 1 48 TYR n 1 49 ALA n 1 50 LEU n 1 51 ASP n 1 52 GLU n 1 53 LYS n 1 54 PHE n 1 55 GLY n 1 56 VAL n 1 57 GLU n 1 58 ILE n 1 59 PRO n 1 60 ASP n 1 61 GLU n 1 62 GLU n 1 63 SER n 1 64 LYS n 1 65 ASN n 1 66 ILE n 1 67 LYS n 1 68 ILE n 1 69 VAL n 1 70 GLY n 1 71 ASP n 1 72 ALA n 1 73 VAL n 1 74 ASN n 1 75 TYR n 1 76 ILE n 1 77 ILE n 1 78 GLU n 1 79 HIS n 1 80 GLN n 1 81 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 81 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'acpP, B1B09_02215' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Cutibacterium acnes' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1747 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 MET 43 43 43 MET MET A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 HIS 79 79 79 HIS HIS A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 SER 81 81 81 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 101 1 ZN ZN A . C 2 ZN 1 102 2 ZN ZN A . D 2 ZN 1 103 3 ZN ZN A . E 2 ZN 1 104 4 ZN ZN A . F 2 ZN 1 105 5 ZN ZN A . G 2 ZN 1 106 6 ZN ZN A . H 2 ZN 1 107 7 ZN ZN A . I 2 ZN 1 108 8 ZN ZN A . J 2 ZN 1 109 9 ZN ZN A . K 3 HOH 1 201 15 HOH HOH A . K 3 HOH 2 202 28 HOH HOH A . K 3 HOH 3 203 31 HOH HOH A . K 3 HOH 4 204 41 HOH HOH A . K 3 HOH 5 205 14 HOH HOH A . K 3 HOH 6 206 5 HOH HOH A . K 3 HOH 7 207 30 HOH HOH A . K 3 HOH 8 208 25 HOH HOH A . K 3 HOH 9 209 2 HOH HOH A . K 3 HOH 10 210 17 HOH HOH A . K 3 HOH 11 211 3 HOH HOH A . K 3 HOH 12 212 24 HOH HOH A . K 3 HOH 13 213 40 HOH HOH A . K 3 HOH 14 214 20 HOH HOH A . K 3 HOH 15 215 4 HOH HOH A . K 3 HOH 16 216 42 HOH HOH A . K 3 HOH 17 217 11 HOH HOH A . K 3 HOH 18 218 37 HOH HOH A . K 3 HOH 19 219 9 HOH HOH A . K 3 HOH 20 220 13 HOH HOH A . K 3 HOH 21 221 8 HOH HOH A . K 3 HOH 22 222 12 HOH HOH A . K 3 HOH 23 223 7 HOH HOH A . K 3 HOH 24 224 19 HOH HOH A . K 3 HOH 25 225 29 HOH HOH A . K 3 HOH 26 226 16 HOH HOH A . K 3 HOH 27 227 36 HOH HOH A . K 3 HOH 28 228 10 HOH HOH A . K 3 HOH 29 229 35 HOH HOH A . K 3 HOH 30 230 18 HOH HOH A . K 3 HOH 31 231 21 HOH HOH A . K 3 HOH 32 232 1 HOH HOH A . K 3 HOH 33 233 26 HOH HOH A . K 3 HOH 34 234 38 HOH HOH A . K 3 HOH 35 235 39 HOH HOH A . K 3 HOH 36 236 34 HOH HOH A . K 3 HOH 37 237 22 HOH HOH A . K 3 HOH 38 238 6 HOH HOH A . K 3 HOH 39 239 23 HOH HOH A . K 3 HOH 40 240 27 HOH HOH A . K 3 HOH 41 241 32 HOH HOH A . K 3 HOH 42 242 33 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.19.2_4158: ???)' ? 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? . ? 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 27WO _cell.details ? _cell.formula_units_Z ? _cell.length_a 42.238 _cell.length_a_esd ? _cell.length_b 42.238 _cell.length_b_esd ? _cell.length_c 78.871 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 27WO _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 27WO _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.95 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 36.98 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M zinc acetate, 20% PEG3350' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 290 # _diffrn.ambient_environment ? _diffrn.ambient_temp 273 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER R 4M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2025-09-13 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9793 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 7A (6B, 6C1)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9793 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '7A (6B, 6C1)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 27WO _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.8 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12640 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.91 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.079 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.987 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.063 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 1.80 1.91 ? ? ? ? ? ? 726 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.102 ? ? 1 1 0.986 ? ? ? ? 0.083 ? ? ? ? ? ? ? ? ? 1.91 2.04 ? ? ? ? ? ? 672 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.087 ? ? 2 1 0.985 ? ? ? ? 0.071 ? ? ? ? ? ? ? ? ? 2.04 2.2 ? ? ? ? ? ? 626 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.076 ? ? 3 1 0.99 ? ? ? ? 0.062 ? ? ? ? ? ? ? ? ? 2.20 2.41 ? ? ? ? ? ? 596 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.083 ? ? 4 1 0.986 ? ? ? ? 0.067 ? ? ? ? ? ? ? ? ? 2.41 2.7 ? ? ? ? ? ? 534 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.093 ? ? 5 1 0.979 ? ? ? ? 0.075 ? ? ? ? ? ? ? ? ? 2.70 3.11 ? ? ? ? ? ? 468 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.077 ? ? 6 1 0.989 ? ? ? ? 0.062 ? ? ? ? ? ? ? ? ? 3.11 3.8 ? ? ? ? ? ? 377 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.077 ? ? 7 1 0.972 ? ? ? ? 0.061 ? ? ? ? ? ? ? ? ? 3.80 5.36 ? ? ? ? ? ? 288 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.079 ? ? 8 1 0.984 ? ? ? ? 0.063 ? ? ? ? ? ? ? ? ? 5.36 10 ? ? ? ? ? ? 167 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.063 ? ? 9 1 0.991 ? ? ? ? 0.05 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 27WO _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.80 _refine.ls_d_res_low 37.23 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12640 _refine.ls_number_reflns_R_free 1247 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.89 _refine.ls_percent_reflns_R_free 9.87 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1862 _refine.ls_R_factor_R_free 0.2150 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1831 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.43 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.02 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.20 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 624 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 9 _refine_hist.number_atoms_solvent 42 _refine_hist.number_atoms_total 675 _refine_hist.d_res_high 1.80 _refine_hist.d_res_low 37.23 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 630 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.821 ? 855 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 4.563 ? 82 ? f_dihedral_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.057 ? 103 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 114 ? f_plane_restr ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.80 1.87 . . 137 1269 100.00 . . . . 0.2038 . . . . . . . . . . . . . . . 0.2664 'X-RAY DIFFRACTION' 1.87 1.96 . . 139 1272 100.00 . . . . 0.1816 . . . . . . . . . . . . . . . 0.2366 'X-RAY DIFFRACTION' 1.96 2.06 . . 139 1275 100.00 . . . . 0.1804 . . . . . . . . . . . . . . . 0.2691 'X-RAY DIFFRACTION' 2.06 2.19 . . 140 1265 100.00 . . . . 0.1734 . . . . . . . . . . . . . . . 0.2205 'X-RAY DIFFRACTION' 2.19 2.36 . . 139 1268 100.00 . . . . 0.1657 . . . . . . . . . . . . . . . 0.2654 'X-RAY DIFFRACTION' 2.36 2.60 . . 134 1252 100.00 . . . . 0.1809 . . . . . . . . . . . . . . . 0.2069 'X-RAY DIFFRACTION' 2.60 2.97 . . 140 1272 100.00 . . . . 0.1959 . . . . . . . . . . . . . . . 0.2156 'X-RAY DIFFRACTION' 2.97 3.74 . . 138 1269 100.00 . . . . 0.1845 . . . . . . . . . . . . . . . 0.1855 'X-RAY DIFFRACTION' 3.74 37.23 . . 141 1251 99.00 . . . . 0.1836 . . . . . . . . . . . . . . . 0.1845 # _struct.entry_id 27WO _struct.title 'Crystal structure of the M11V/C50L double mutant acyl carrier protein from Cutibacterium acnes' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 27WO _struct_keywords.text 'acyl carrier protein, cutibacterium acnes, LIPID BINDING PROTEIN' _struct_keywords.pdbx_keywords 'LIPID BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? I N N 2 ? J N N 2 ? K N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A8B2VGS2_CUTAC _struct_ref.pdbx_db_accession A0A8B2VGS2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MADKDQILADMADIVNDITGVDQSEVTFEKSFVDDLDVDSLSMVEIIYACDEKFGVEIPDEESKNIKIVGDAVNYIIEHQ S ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 27WO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 81 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A8B2VGS2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 81 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 81 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 27WO VAL A 11 ? UNP A0A8B2VGS2 MET 11 'engineered mutation' 11 1 1 27WO LEU A 50 ? UNP A0A8B2VGS2 CYS 50 'engineered mutation' 50 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 180 ? 1 MORE -53 ? 1 'SSA (A^2)' 4800 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 3 ? GLY A 20 ? ASP A 3 GLY A 20 1 ? 18 HELX_P HELX_P2 AA2 ASP A 22 ? VAL A 26 ? ASP A 22 VAL A 26 5 ? 5 HELX_P HELX_P3 AA3 ASP A 39 ? GLY A 55 ? ASP A 39 GLY A 55 1 ? 17 HELX_P HELX_P4 AA4 PRO A 59 ? LYS A 64 ? PRO A 59 LYS A 64 1 ? 6 HELX_P HELX_P5 AA5 ILE A 68 ? GLN A 80 ? ILE A 68 GLN A 80 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 5 OD2 ? ? ? 1_555 E ZN . ZN ? ? A ASP 5 A ZN 104 1_555 ? ? ? ? ? ? ? 1.979 ? ? metalc2 metalc ? ? A ASP 10 OD1 ? ? ? 1_555 B ZN . ZN ? ? A ASP 10 A ZN 101 3_454 ? ? ? ? ? ? ? 2.152 ? ? metalc3 metalc ? ? A ASP 10 OD1 ? ? ? 1_555 C ZN . ZN ? ? A ASP 10 A ZN 102 3_454 ? ? ? ? ? ? ? 2.507 ? ? metalc4 metalc ? ? A ASP 10 OD2 ? ? ? 1_555 C ZN . ZN ? ? A ASP 10 A ZN 102 3_454 ? ? ? ? ? ? ? 2.292 ? ? metalc5 metalc ? ? A ASP 13 OD2 ? ? ? 1_555 G ZN . ZN ? ? A ASP 13 A ZN 106 1_555 ? ? ? ? ? ? ? 1.966 ? ? metalc6 metalc ? ? A ASP 17 OD1 ? ? ? 1_555 D ZN . ZN ? ? A ASP 17 A ZN 103 1_555 ? ? ? ? ? ? ? 2.388 ? ? metalc7 metalc ? ? A ASP 17 OD2 ? ? ? 1_555 G ZN . ZN ? ? A ASP 17 A ZN 106 1_555 ? ? ? ? ? ? ? 1.901 ? ? metalc8 metalc ? ? A GLU 25 OE1 ? ? ? 1_555 I ZN . ZN ? ? A GLU 25 A ZN 108 1_555 ? ? ? ? ? ? ? 2.545 ? ? metalc9 metalc ? ? A GLU 29 OE1 ? ? ? 1_555 G ZN . ZN ? ? A GLU 29 A ZN 106 5_444 ? ? ? ? ? ? ? 2.072 ? ? metalc10 metalc ? ? A ASP 34 OD1 ? ? ? 1_555 H ZN . ZN ? ? A ASP 34 A ZN 107 1_555 ? ? ? ? ? ? ? 1.945 ? ? metalc11 metalc ? ? A ASP 34 OD2 ? ? ? 1_555 H ZN . ZN ? ? A ASP 34 A ZN 107 1_555 ? ? ? ? ? ? ? 2.456 ? ? metalc12 metalc ? ? A ASP 34 OD1 ? ? ? 1_555 H ZN . ZN ? ? A ASP 34 A ZN 107 7_555 ? ? ? ? ? ? ? 1.989 ? ? metalc13 metalc ? ? A ASP 34 OD2 ? ? ? 1_555 H ZN . ZN ? ? A ASP 34 A ZN 107 7_555 ? ? ? ? ? ? ? 2.612 ? ? metalc14 metalc ? ? A ASP 39 OD2 ? ? ? 1_555 E ZN . ZN ? ? A ASP 39 A ZN 104 5_454 ? ? ? ? ? ? ? 2.025 ? ? metalc15 metalc ? ? A GLU 52 OE1 ? ? ? 1_555 I ZN . ZN ? ? A GLU 52 A ZN 108 5_454 ? ? ? ? ? ? ? 2.612 ? ? metalc16 metalc ? ? A GLU 52 OE2 ? ? ? 1_555 I ZN . ZN ? ? A GLU 52 A ZN 108 5_454 ? ? ? ? ? ? ? 2.189 ? ? metalc17 metalc ? ? A GLU 57 OE2 ? ? ? 1_555 J ZN . ZN ? ? A GLU 57 A ZN 109 1_555 ? ? ? ? ? ? ? 2.517 ? ? metalc18 metalc ? ? A GLU 62 OE1 ? ? ? 1_555 F ZN . ZN ? ? A GLU 62 A ZN 105 1_555 ? ? ? ? ? ? ? 2.502 ? ? metalc19 metalc ? ? A GLU 62 OE2 ? ? ? 1_555 F ZN . ZN ? ? A GLU 62 A ZN 105 1_555 ? ? ? ? ? ? ? 2.335 ? ? metalc20 metalc ? ? A GLU 78 OE2 ? ? ? 1_555 B ZN . ZN ? ? A GLU 78 A ZN 101 1_555 ? ? ? ? ? ? ? 2.095 ? ? metalc21 metalc ? ? A GLU 78 OE1 ? ? ? 1_555 C ZN . ZN ? ? A GLU 78 A ZN 102 1_555 ? ? ? ? ? ? ? 2.036 ? ? metalc22 metalc ? ? A HIS 79 NE2 ? ? ? 1_555 F ZN . ZN ? ? A HIS 79 A ZN 105 1_555 ? ? ? ? ? ? ? 2.201 ? ? metalc23 metalc ? ? B ZN . ZN ? ? ? 1_555 K HOH . O ? ? A ZN 101 A HOH 214 4_445 ? ? ? ? ? ? ? 2.053 ? ? metalc24 metalc ? ? B ZN . ZN ? ? ? 1_555 K HOH . O ? ? A ZN 101 A HOH 231 1_555 ? ? ? ? ? ? ? 2.311 ? ? metalc25 metalc ? ? B ZN . ZN ? ? ? 1_555 K HOH . O ? ? A ZN 101 A HOH 237 4_445 ? ? ? ? ? ? ? 2.446 ? ? metalc26 metalc ? ? B ZN . ZN ? ? ? 1_555 K HOH . O ? ? A ZN 101 A HOH 239 1_555 ? ? ? ? ? ? ? 2.407 ? ? metalc27 metalc ? ? C ZN . ZN ? ? ? 1_555 K HOH . O ? ? A ZN 102 A HOH 214 4_445 ? ? ? ? ? ? ? 1.966 ? ? metalc28 metalc ? ? E ZN . ZN ? ? ? 1_555 K HOH . O ? ? A ZN 104 A HOH 209 1_555 ? ? ? ? ? ? ? 2.064 ? ? metalc29 metalc ? ? E ZN . ZN ? ? ? 1_555 K HOH . O ? ? A ZN 104 A HOH 211 3_454 ? ? ? ? ? ? ? 2.105 ? ? metalc30 metalc ? ? E ZN . ZN ? ? ? 1_555 K HOH . O ? ? A ZN 104 A HOH 232 5_444 ? ? ? ? ? ? ? 2.268 ? ? metalc31 metalc ? ? F ZN . ZN ? ? ? 1_555 K HOH . O ? ? A ZN 105 A HOH 201 1_555 ? ? ? ? ? ? ? 2.136 ? ? metalc32 metalc ? ? F ZN . ZN ? ? ? 1_555 K HOH . O ? ? A ZN 105 A HOH 226 1_555 ? ? ? ? ? ? ? 2.320 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 5 ? A ASP 5 ? 1_555 ZN ? E ZN . ? A ZN 104 ? 1_555 OD2 ? A ASP 39 ? A ASP 39 ? 1_555 41.7 ? 2 OD2 ? A ASP 5 ? A ASP 5 ? 1_555 ZN ? E ZN . ? A ZN 104 ? 1_555 O ? K HOH . ? A HOH 209 ? 1_555 135.3 ? 3 OD2 ? A ASP 39 ? A ASP 39 ? 1_555 ZN ? E ZN . ? A ZN 104 ? 1_555 O ? K HOH . ? A HOH 209 ? 1_555 97.1 ? 4 OD2 ? A ASP 5 ? A ASP 5 ? 1_555 ZN ? E ZN . ? A ZN 104 ? 1_555 O ? K HOH . ? A HOH 211 ? 3_454 93.5 ? 5 OD2 ? A ASP 39 ? A ASP 39 ? 1_555 ZN ? E ZN . ? A ZN 104 ? 1_555 O ? K HOH . ? A HOH 211 ? 3_454 73.9 ? 6 O ? K HOH . ? A HOH 209 ? 1_555 ZN ? E ZN . ? A ZN 104 ? 1_555 O ? K HOH . ? A HOH 211 ? 3_454 87.4 ? 7 OD2 ? A ASP 5 ? A ASP 5 ? 1_555 ZN ? E ZN . ? A ZN 104 ? 1_555 O ? K HOH . ? A HOH 232 ? 5_444 91.9 ? 8 OD2 ? A ASP 39 ? A ASP 39 ? 1_555 ZN ? E ZN . ? A ZN 104 ? 1_555 O ? K HOH . ? A HOH 232 ? 5_444 109.2 ? 9 O ? K HOH . ? A HOH 209 ? 1_555 ZN ? E ZN . ? A ZN 104 ? 1_555 O ? K HOH . ? A HOH 232 ? 5_444 87.3 ? 10 O ? K HOH . ? A HOH 211 ? 3_454 ZN ? E ZN . ? A ZN 104 ? 1_555 O ? K HOH . ? A HOH 232 ? 5_444 174.2 ? 11 OD1 ? A ASP 10 ? A ASP 10 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 3_454 OE2 ? A GLU 78 ? A GLU 78 ? 1_555 21.8 ? 12 OD1 ? A ASP 10 ? A ASP 10 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 3_454 O ? K HOH . ? A HOH 214 ? 4_445 16.4 ? 13 OE2 ? A GLU 78 ? A GLU 78 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 3_454 O ? K HOH . ? A HOH 214 ? 4_445 8.3 ? 14 OD1 ? A ASP 10 ? A ASP 10 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 3_454 O ? K HOH . ? A HOH 231 ? 1_555 17.2 ? 15 OE2 ? A GLU 78 ? A GLU 78 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 3_454 O ? K HOH . ? A HOH 231 ? 1_555 7.9 ? 16 O ? K HOH . ? A HOH 214 ? 4_445 ZN ? B ZN . ? A ZN 101 ? 3_454 O ? K HOH . ? A HOH 231 ? 1_555 11.0 ? 17 OD1 ? A ASP 10 ? A ASP 10 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 3_454 O ? K HOH . ? A HOH 237 ? 4_445 12.3 ? 18 OE2 ? A GLU 78 ? A GLU 78 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 3_454 O ? K HOH . ? A HOH 237 ? 4_445 9.8 ? 19 O ? K HOH . ? A HOH 214 ? 4_445 ZN ? B ZN . ? A ZN 101 ? 3_454 O ? K HOH . ? A HOH 237 ? 4_445 7.9 ? 20 O ? K HOH . ? A HOH 231 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 3_454 O ? K HOH . ? A HOH 237 ? 4_445 5.7 ? 21 OD1 ? A ASP 10 ? A ASP 10 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 3_454 O ? K HOH . ? A HOH 239 ? 1_555 12.3 ? 22 OE2 ? A GLU 78 ? A GLU 78 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 3_454 O ? K HOH . ? A HOH 239 ? 1_555 9.6 ? 23 O ? K HOH . ? A HOH 214 ? 4_445 ZN ? B ZN . ? A ZN 101 ? 3_454 O ? K HOH . ? A HOH 239 ? 1_555 5.4 ? 24 O ? K HOH . ? A HOH 231 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 3_454 O ? K HOH . ? A HOH 239 ? 1_555 7.8 ? 25 O ? K HOH . ? A HOH 237 ? 4_445 ZN ? B ZN . ? A ZN 101 ? 3_454 O ? K HOH . ? A HOH 239 ? 1_555 2.9 ? 26 OD1 ? A ASP 10 ? A ASP 10 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 3_454 OD2 ? A ASP 10 ? A ASP 10 ? 1_555 54.2 ? 27 OD1 ? A ASP 10 ? A ASP 10 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 3_454 OE1 ? A GLU 78 ? A GLU 78 ? 1_555 82.2 ? 28 OD2 ? A ASP 10 ? A ASP 10 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 3_454 OE1 ? A GLU 78 ? A GLU 78 ? 1_555 32.2 ? 29 OD1 ? A ASP 10 ? A ASP 10 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 3_454 O ? K HOH . ? A HOH 214 ? 4_445 73.8 ? 30 OD2 ? A ASP 10 ? A ASP 10 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 3_454 O ? K HOH . ? A HOH 214 ? 4_445 25.6 ? 31 OE1 ? A GLU 78 ? A GLU 78 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 3_454 O ? K HOH . ? A HOH 214 ? 4_445 8.5 ? 32 OD2 ? A ASP 13 ? A ASP 13 ? 1_555 ZN ? G ZN . ? A ZN 106 ? 1_555 OD2 ? A ASP 17 ? A ASP 17 ? 1_555 114.2 ? 33 OD2 ? A ASP 13 ? A ASP 13 ? 1_555 ZN ? G ZN . ? A ZN 106 ? 1_555 OE1 ? A GLU 29 ? A GLU 29 ? 1_555 30.6 ? 34 OD2 ? A ASP 17 ? A ASP 17 ? 1_555 ZN ? G ZN . ? A ZN 106 ? 1_555 OE1 ? A GLU 29 ? A GLU 29 ? 1_555 84.2 ? 35 OE1 ? A GLU 25 ? A GLU 25 ? 1_555 ZN ? I ZN . ? A ZN 108 ? 1_555 OE1 ? A GLU 52 ? A GLU 52 ? 1_555 19.2 ? 36 OE1 ? A GLU 25 ? A GLU 25 ? 1_555 ZN ? I ZN . ? A ZN 108 ? 1_555 OE2 ? A GLU 52 ? A GLU 52 ? 1_555 22.4 ? 37 OE1 ? A GLU 52 ? A GLU 52 ? 1_555 ZN ? I ZN . ? A ZN 108 ? 1_555 OE2 ? A GLU 52 ? A GLU 52 ? 1_555 3.9 ? 38 OD1 ? A ASP 34 ? A ASP 34 ? 1_555 ZN ? H ZN . ? A ZN 107 ? 1_555 OD2 ? A ASP 34 ? A ASP 34 ? 1_555 58.3 ? 39 OD1 ? A ASP 34 ? A ASP 34 ? 1_555 ZN ? H ZN . ? A ZN 107 ? 1_555 OD1 ? A ASP 34 ? A ASP 34 ? 1_555 0.0 ? 40 OD2 ? A ASP 34 ? A ASP 34 ? 1_555 ZN ? H ZN . ? A ZN 107 ? 1_555 OD1 ? A ASP 34 ? A ASP 34 ? 1_555 58.3 ? 41 OD1 ? A ASP 34 ? A ASP 34 ? 1_555 ZN ? H ZN . ? A ZN 107 ? 1_555 OD2 ? A ASP 34 ? A ASP 34 ? 1_555 58.3 ? 42 OD2 ? A ASP 34 ? A ASP 34 ? 1_555 ZN ? H ZN . ? A ZN 107 ? 1_555 OD2 ? A ASP 34 ? A ASP 34 ? 1_555 0.0 ? 43 OD1 ? A ASP 34 ? A ASP 34 ? 1_555 ZN ? H ZN . ? A ZN 107 ? 1_555 OD2 ? A ASP 34 ? A ASP 34 ? 1_555 58.3 ? 44 OE1 ? A GLU 62 ? A GLU 62 ? 1_555 ZN ? F ZN . ? A ZN 105 ? 1_555 OE2 ? A GLU 62 ? A GLU 62 ? 1_555 53.5 ? 45 OE1 ? A GLU 62 ? A GLU 62 ? 1_555 ZN ? F ZN . ? A ZN 105 ? 1_555 NE2 ? A HIS 79 ? A HIS 79 ? 1_555 106.9 ? 46 OE2 ? A GLU 62 ? A GLU 62 ? 1_555 ZN ? F ZN . ? A ZN 105 ? 1_555 NE2 ? A HIS 79 ? A HIS 79 ? 1_555 98.2 ? 47 OE1 ? A GLU 62 ? A GLU 62 ? 1_555 ZN ? F ZN . ? A ZN 105 ? 1_555 O ? K HOH . ? A HOH 201 ? 1_555 53.0 ? 48 OE2 ? A GLU 62 ? A GLU 62 ? 1_555 ZN ? F ZN . ? A ZN 105 ? 1_555 O ? K HOH . ? A HOH 201 ? 1_555 106.1 ? 49 NE2 ? A HIS 79 ? A HIS 79 ? 1_555 ZN ? F ZN . ? A ZN 105 ? 1_555 O ? K HOH . ? A HOH 201 ? 1_555 95.6 ? 50 OE1 ? A GLU 62 ? A GLU 62 ? 1_555 ZN ? F ZN . ? A ZN 105 ? 1_555 O ? K HOH . ? A HOH 226 ? 1_555 127.3 ? 51 OE2 ? A GLU 62 ? A GLU 62 ? 1_555 ZN ? F ZN . ? A ZN 105 ? 1_555 O ? K HOH . ? A HOH 226 ? 1_555 75.4 ? 52 NE2 ? A HIS 79 ? A HIS 79 ? 1_555 ZN ? F ZN . ? A ZN 105 ? 1_555 O ? K HOH . ? A HOH 226 ? 1_555 90.9 ? 53 O ? K HOH . ? A HOH 201 ? 1_555 ZN ? F ZN . ? A ZN 105 ? 1_555 O ? K HOH . ? A HOH 226 ? 1_555 173.0 ? # _pdbx_entry_details.entry_id 27WO _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification N # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 62 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 201 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.10 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OD2 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ASP _pdbx_validate_symm_contact.auth_seq_id_1 22 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OG _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 SER _pdbx_validate_symm_contact.auth_seq_id_2 24 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 8_554 _pdbx_validate_symm_contact.dist 2.11 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id ZN _pdbx_struct_special_symmetry.auth_seq_id 107 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id H _pdbx_struct_special_symmetry.label_comp_id ZN _pdbx_struct_special_symmetry.label_seq_id . # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id MET _pdbx_unobs_or_zero_occ_residues.auth_seq_id 1 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id MET _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 HIS N N N N 110 HIS CA C N S 111 HIS C C N N 112 HIS O O N N 113 HIS CB C N N 114 HIS CG C Y N 115 HIS ND1 N Y N 116 HIS CD2 C Y N 117 HIS CE1 C Y N 118 HIS NE2 N Y N 119 HIS OXT O N N 120 HIS H H N N 121 HIS H2 H N N 122 HIS HA H N N 123 HIS HB2 H N N 124 HIS HB3 H N N 125 HIS HD1 H N N 126 HIS HD2 H N N 127 HIS HE1 H N N 128 HIS HE2 H N N 129 HIS HXT H N N 130 HOH O O N N 131 HOH H1 H N N 132 HOH H2 H N N 133 ILE N N N N 134 ILE CA C N S 135 ILE C C N N 136 ILE O O N N 137 ILE CB C N S 138 ILE CG1 C N N 139 ILE CG2 C N N 140 ILE CD1 C N N 141 ILE OXT O N N 142 ILE H H N N 143 ILE H2 H N N 144 ILE HA H N N 145 ILE HB H N N 146 ILE HG12 H N N 147 ILE HG13 H N N 148 ILE HG21 H N N 149 ILE HG22 H N N 150 ILE HG23 H N N 151 ILE HD11 H N N 152 ILE HD12 H N N 153 ILE HD13 H N N 154 ILE HXT H N N 155 LEU N N N N 156 LEU CA C N S 157 LEU C C N N 158 LEU O O N N 159 LEU CB C N N 160 LEU CG C N N 161 LEU CD1 C N N 162 LEU CD2 C N N 163 LEU OXT O N N 164 LEU H H N N 165 LEU H2 H N N 166 LEU HA H N N 167 LEU HB2 H N N 168 LEU HB3 H N N 169 LEU HG H N N 170 LEU HD11 H N N 171 LEU HD12 H N N 172 LEU HD13 H N N 173 LEU HD21 H N N 174 LEU HD22 H N N 175 LEU HD23 H N N 176 LEU HXT H N N 177 LYS N N N N 178 LYS CA C N S 179 LYS C C N N 180 LYS O O N N 181 LYS CB C N N 182 LYS CG C N N 183 LYS CD C N N 184 LYS CE C N N 185 LYS NZ N N N 186 LYS OXT O N N 187 LYS H H N N 188 LYS H2 H N N 189 LYS HA H N N 190 LYS HB2 H N N 191 LYS HB3 H N N 192 LYS HG2 H N N 193 LYS HG3 H N N 194 LYS HD2 H N N 195 LYS HD3 H N N 196 LYS HE2 H N N 197 LYS HE3 H N N 198 LYS HZ1 H N N 199 LYS HZ2 H N N 200 LYS HZ3 H N N 201 LYS HXT H N N 202 MET N N N N 203 MET CA C N S 204 MET C C N N 205 MET O O N N 206 MET CB C N N 207 MET CG C N N 208 MET SD S N N 209 MET CE C N N 210 MET OXT O N N 211 MET H H N N 212 MET H2 H N N 213 MET HA H N N 214 MET HB2 H N N 215 MET HB3 H N N 216 MET HG2 H N N 217 MET HG3 H N N 218 MET HE1 H N N 219 MET HE2 H N N 220 MET HE3 H N N 221 MET HXT H N N 222 PHE N N N N 223 PHE CA C N S 224 PHE C C N N 225 PHE O O N N 226 PHE CB C N N 227 PHE CG C Y N 228 PHE CD1 C Y N 229 PHE CD2 C Y N 230 PHE CE1 C Y N 231 PHE CE2 C Y N 232 PHE CZ C Y N 233 PHE OXT O N N 234 PHE H H N N 235 PHE H2 H N N 236 PHE HA H N N 237 PHE HB2 H N N 238 PHE HB3 H N N 239 PHE HD1 H N N 240 PHE HD2 H N N 241 PHE HE1 H N N 242 PHE HE2 H N N 243 PHE HZ H N N 244 PHE HXT H N N 245 PRO N N N N 246 PRO CA C N S 247 PRO C C N N 248 PRO O O N N 249 PRO CB C N N 250 PRO CG C N N 251 PRO CD C N N 252 PRO OXT O N N 253 PRO H H N N 254 PRO HA H N N 255 PRO HB2 H N N 256 PRO HB3 H N N 257 PRO HG2 H N N 258 PRO HG3 H N N 259 PRO HD2 H N N 260 PRO HD3 H N N 261 PRO HXT H N N 262 SER N N N N 263 SER CA C N S 264 SER C C N N 265 SER O O N N 266 SER CB C N N 267 SER OG O N N 268 SER OXT O N N 269 SER H H N N 270 SER H2 H N N 271 SER HA H N N 272 SER HB2 H N N 273 SER HB3 H N N 274 SER HG H N N 275 SER HXT H N N 276 THR N N N N 277 THR CA C N S 278 THR C C N N 279 THR O O N N 280 THR CB C N R 281 THR OG1 O N N 282 THR CG2 C N N 283 THR OXT O N N 284 THR H H N N 285 THR H2 H N N 286 THR HA H N N 287 THR HB H N N 288 THR HG1 H N N 289 THR HG21 H N N 290 THR HG22 H N N 291 THR HG23 H N N 292 THR HXT H N N 293 TYR N N N N 294 TYR CA C N S 295 TYR C C N N 296 TYR O O N N 297 TYR CB C N N 298 TYR CG C Y N 299 TYR CD1 C Y N 300 TYR CD2 C Y N 301 TYR CE1 C Y N 302 TYR CE2 C Y N 303 TYR CZ C Y N 304 TYR OH O N N 305 TYR OXT O N N 306 TYR H H N N 307 TYR H2 H N N 308 TYR HA H N N 309 TYR HB2 H N N 310 TYR HB3 H N N 311 TYR HD1 H N N 312 TYR HD2 H N N 313 TYR HE1 H N N 314 TYR HE2 H N N 315 TYR HH H N N 316 TYR HXT H N N 317 VAL N N N N 318 VAL CA C N S 319 VAL C C N N 320 VAL O O N N 321 VAL CB C N N 322 VAL CG1 C N N 323 VAL CG2 C N N 324 VAL OXT O N N 325 VAL H H N N 326 VAL H2 H N N 327 VAL HA H N N 328 VAL HB H N N 329 VAL HG11 H N N 330 VAL HG12 H N N 331 VAL HG13 H N N 332 VAL HG21 H N N 333 VAL HG22 H N N 334 VAL HG23 H N N 335 VAL HXT H N N 336 ZN ZN ZN N N 337 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLU N CA sing N N 76 GLU N H sing N N 77 GLU N H2 sing N N 78 GLU CA C sing N N 79 GLU CA CB sing N N 80 GLU CA HA sing N N 81 GLU C O doub N N 82 GLU C OXT sing N N 83 GLU CB CG sing N N 84 GLU CB HB2 sing N N 85 GLU CB HB3 sing N N 86 GLU CG CD sing N N 87 GLU CG HG2 sing N N 88 GLU CG HG3 sing N N 89 GLU CD OE1 doub N N 90 GLU CD OE2 sing N N 91 GLU OE2 HE2 sing N N 92 GLU OXT HXT sing N N 93 GLY N CA sing N N 94 GLY N H sing N N 95 GLY N H2 sing N N 96 GLY CA C sing N N 97 GLY CA HA2 sing N N 98 GLY CA HA3 sing N N 99 GLY C O doub N N 100 GLY C OXT sing N N 101 GLY OXT HXT sing N N 102 HIS N CA sing N N 103 HIS N H sing N N 104 HIS N H2 sing N N 105 HIS CA C sing N N 106 HIS CA CB sing N N 107 HIS CA HA sing N N 108 HIS C O doub N N 109 HIS C OXT sing N N 110 HIS CB CG sing N N 111 HIS CB HB2 sing N N 112 HIS CB HB3 sing N N 113 HIS CG ND1 sing Y N 114 HIS CG CD2 doub Y N 115 HIS ND1 CE1 doub Y N 116 HIS ND1 HD1 sing N N 117 HIS CD2 NE2 sing Y N 118 HIS CD2 HD2 sing N N 119 HIS CE1 NE2 sing Y N 120 HIS CE1 HE1 sing N N 121 HIS NE2 HE2 sing N N 122 HIS OXT HXT sing N N 123 HOH O H1 sing N N 124 HOH O H2 sing N N 125 ILE N CA sing N N 126 ILE N H sing N N 127 ILE N H2 sing N N 128 ILE CA C sing N N 129 ILE CA CB sing N N 130 ILE CA HA sing N N 131 ILE C O doub N N 132 ILE C OXT sing N N 133 ILE CB CG1 sing N N 134 ILE CB CG2 sing N N 135 ILE CB HB sing N N 136 ILE CG1 CD1 sing N N 137 ILE CG1 HG12 sing N N 138 ILE CG1 HG13 sing N N 139 ILE CG2 HG21 sing N N 140 ILE CG2 HG22 sing N N 141 ILE CG2 HG23 sing N N 142 ILE CD1 HD11 sing N N 143 ILE CD1 HD12 sing N N 144 ILE CD1 HD13 sing N N 145 ILE OXT HXT sing N N 146 LEU N CA sing N N 147 LEU N H sing N N 148 LEU N H2 sing N N 149 LEU CA C sing N N 150 LEU CA CB sing N N 151 LEU CA HA sing N N 152 LEU C O doub N N 153 LEU C OXT sing N N 154 LEU CB CG sing N N 155 LEU CB HB2 sing N N 156 LEU CB HB3 sing N N 157 LEU CG CD1 sing N N 158 LEU CG CD2 sing N N 159 LEU CG HG sing N N 160 LEU CD1 HD11 sing N N 161 LEU CD1 HD12 sing N N 162 LEU CD1 HD13 sing N N 163 LEU CD2 HD21 sing N N 164 LEU CD2 HD22 sing N N 165 LEU CD2 HD23 sing N N 166 LEU OXT HXT sing N N 167 LYS N CA sing N N 168 LYS N H sing N N 169 LYS N H2 sing N N 170 LYS CA C sing N N 171 LYS CA CB sing N N 172 LYS CA HA sing N N 173 LYS C O doub N N 174 LYS C OXT sing N N 175 LYS CB CG sing N N 176 LYS CB HB2 sing N N 177 LYS CB HB3 sing N N 178 LYS CG CD sing N N 179 LYS CG HG2 sing N N 180 LYS CG HG3 sing N N 181 LYS CD CE sing N N 182 LYS CD HD2 sing N N 183 LYS CD HD3 sing N N 184 LYS CE NZ sing N N 185 LYS CE HE2 sing N N 186 LYS CE HE3 sing N N 187 LYS NZ HZ1 sing N N 188 LYS NZ HZ2 sing N N 189 LYS NZ HZ3 sing N N 190 LYS OXT HXT sing N N 191 MET N CA sing N N 192 MET N H sing N N 193 MET N H2 sing N N 194 MET CA C sing N N 195 MET CA CB sing N N 196 MET CA HA sing N N 197 MET C O doub N N 198 MET C OXT sing N N 199 MET CB CG sing N N 200 MET CB HB2 sing N N 201 MET CB HB3 sing N N 202 MET CG SD sing N N 203 MET CG HG2 sing N N 204 MET CG HG3 sing N N 205 MET SD CE sing N N 206 MET CE HE1 sing N N 207 MET CE HE2 sing N N 208 MET CE HE3 sing N N 209 MET OXT HXT sing N N 210 PHE N CA sing N N 211 PHE N H sing N N 212 PHE N H2 sing N N 213 PHE CA C sing N N 214 PHE CA CB sing N N 215 PHE CA HA sing N N 216 PHE C O doub N N 217 PHE C OXT sing N N 218 PHE CB CG sing N N 219 PHE CB HB2 sing N N 220 PHE CB HB3 sing N N 221 PHE CG CD1 doub Y N 222 PHE CG CD2 sing Y N 223 PHE CD1 CE1 sing Y N 224 PHE CD1 HD1 sing N N 225 PHE CD2 CE2 doub Y N 226 PHE CD2 HD2 sing N N 227 PHE CE1 CZ doub Y N 228 PHE CE1 HE1 sing N N 229 PHE CE2 CZ sing Y N 230 PHE CE2 HE2 sing N N 231 PHE CZ HZ sing N N 232 PHE OXT HXT sing N N 233 PRO N CA sing N N 234 PRO N CD sing N N 235 PRO N H sing N N 236 PRO CA C sing N N 237 PRO CA CB sing N N 238 PRO CA HA sing N N 239 PRO C O doub N N 240 PRO C OXT sing N N 241 PRO CB CG sing N N 242 PRO CB HB2 sing N N 243 PRO CB HB3 sing N N 244 PRO CG CD sing N N 245 PRO CG HG2 sing N N 246 PRO CG HG3 sing N N 247 PRO CD HD2 sing N N 248 PRO CD HD3 sing N N 249 PRO OXT HXT sing N N 250 SER N CA sing N N 251 SER N H sing N N 252 SER N H2 sing N N 253 SER CA C sing N N 254 SER CA CB sing N N 255 SER CA HA sing N N 256 SER C O doub N N 257 SER C OXT sing N N 258 SER CB OG sing N N 259 SER CB HB2 sing N N 260 SER CB HB3 sing N N 261 SER OG HG sing N N 262 SER OXT HXT sing N N 263 THR N CA sing N N 264 THR N H sing N N 265 THR N H2 sing N N 266 THR CA C sing N N 267 THR CA CB sing N N 268 THR CA HA sing N N 269 THR C O doub N N 270 THR C OXT sing N N 271 THR CB OG1 sing N N 272 THR CB CG2 sing N N 273 THR CB HB sing N N 274 THR OG1 HG1 sing N N 275 THR CG2 HG21 sing N N 276 THR CG2 HG22 sing N N 277 THR CG2 HG23 sing N N 278 THR OXT HXT sing N N 279 TYR N CA sing N N 280 TYR N H sing N N 281 TYR N H2 sing N N 282 TYR CA C sing N N 283 TYR CA CB sing N N 284 TYR CA HA sing N N 285 TYR C O doub N N 286 TYR C OXT sing N N 287 TYR CB CG sing N N 288 TYR CB HB2 sing N N 289 TYR CB HB3 sing N N 290 TYR CG CD1 doub Y N 291 TYR CG CD2 sing Y N 292 TYR CD1 CE1 sing Y N 293 TYR CD1 HD1 sing N N 294 TYR CD2 CE2 doub Y N 295 TYR CD2 HD2 sing N N 296 TYR CE1 CZ doub Y N 297 TYR CE1 HE1 sing N N 298 TYR CE2 CZ sing Y N 299 TYR CE2 HE2 sing N N 300 TYR CZ OH sing N N 301 TYR OH HH sing N N 302 TYR OXT HXT sing N N 303 VAL N CA sing N N 304 VAL N H sing N N 305 VAL N H2 sing N N 306 VAL CA C sing N N 307 VAL CA CB sing N N 308 VAL CA HA sing N N 309 VAL C O doub N N 310 VAL C OXT sing N N 311 VAL CB CG1 sing N N 312 VAL CB CG2 sing N N 313 VAL CB HB sing N N 314 VAL CG1 HG11 sing N N 315 VAL CG1 HG12 sing N N 316 VAL CG1 HG13 sing N N 317 VAL CG2 HG21 sing N N 318 VAL CG2 HG22 sing N N 319 VAL CG2 HG23 sing N N 320 VAL OXT HXT sing N N 321 # _pdbx_audit_support.funding_organization 'Ministry of Science, ICT and Future Planning (MSIP)' _pdbx_audit_support.country 'Korea, Republic Of' _pdbx_audit_support.grant_number RS-2026-25474289 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 8YG0 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 27WO _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.023675 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023675 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012679 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S ZN # loop_ #