data_28UC # _entry.id 28UC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.417 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 28UC pdb_000028uc 10.2210/pdb28uc/pdb WWPDB D_1292154120 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-10-07 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 28UC _pdbx_database_status.recvd_initial_deposition_date 2026-02-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email alke.meents@desy.de _pdbx_contact_author.name_first Alke _pdbx_contact_author.name_last Meents _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-6078-4095 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Falke, S.' 1 0000-0003-3409-1791 'Reinke, P.Y.A.' 2 0000-0002-7354-0839 'Senst, J.M.' 3 0000-0002-0912-0514 'Lewe, P.' 4 ? 'Witt, S.' 5 ? 'Meents, A.' 6 0000-0001-6078-4095 'Guenther, S.' 7 0000-0002-7329-6653 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr D Struct Biol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2059-7983 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Perspectives for pharmaceutical screening at XFEL sources using the example of Lassa virus endonuclease.' _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2059798326009435 _citation.pdbx_database_id_PubMed 42789322 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Falke, S.' 1 0000-0003-3409-1791 primary 'Reinke, P.Y.A.' 2 ? primary 'Rosenberg, D.' 3 ? primary 'Fischer, P.' 4 ? primary 'Meyer, J.' 5 0000-0002-6498-9976 primary 'Galchenkova, M.' 6 ? primary 'Tolstikova, A.' 7 ? primary 'Mariani, V.' 8 ? primary 'Senst, J.M.' 9 ? primary 'Lewe, P.' 10 ? primary 'Witt, S.' 11 ? primary 'Wagner, A.' 12 0000-0001-8995-7324 primary 'Chapman, H.N.' 13 0000-0002-4655-1743 primary 'Hunter, M.' 14 ? primary 'Gunther, S.' 15 ? primary 'Meents, A.' 16 0000-0001-6078-4095 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'RNA-directed RNA polymerase L' 22906.141 1 2.7.7.48,3.1.-.- ? ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 2 ? ? ? ? 3 non-polymer syn 'Baloxavir acid' 483.487 1 ? ? ? ? 4 non-polymer syn 2,3-DIHYDROXY-1,4-DITHIOBUTANE 154.251 1 ? ? ? ? 5 water nat water 18.015 70 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Protein L,Large structural protein,Replicase,Transcriptase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MEEDIA(CSO)VKDLVSKYLVDNERLSRQKLAFLVQTEPRMLLMEGLKLLSLCIEVDSCNANGCEHNSEDKSVERILHDH GILTPSLCFVVPDGYKLTGNVLILLECFVRSSPANFEQKYIEDFKKLEQLKEDLKSVDINLIPLIDGRTSFYNEQIPDWV NDKLRDTLFSLLKYAQESNSLFEESEYSRLCESLSMTSGRLSGV ; _entity_poly.pdbx_seq_one_letter_code_can ;MEEDIACVKDLVSKYLVDNERLSRQKLAFLVQTEPRMLLMEGLKLLSLCIEVDSCNANGCEHNSEDKSVERILHDHGILT PSLCFVVPDGYKLTGNVLILLECFVRSSPANFEQKYIEDFKKLEQLKEDLKSVDINLIPLIDGRTSFYNEQIPDWVNDKL RDTLFSLLKYAQESNSLFEESEYSRLCESLSMTSGRLSGV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 'Baloxavir acid' E4Z 4 2,3-DIHYDROXY-1,4-DITHIOBUTANE DTT 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 GLU n 1 4 ASP n 1 5 ILE n 1 6 ALA n 1 7 CSO n 1 8 VAL n 1 9 LYS n 1 10 ASP n 1 11 LEU n 1 12 VAL n 1 13 SER n 1 14 LYS n 1 15 TYR n 1 16 LEU n 1 17 VAL n 1 18 ASP n 1 19 ASN n 1 20 GLU n 1 21 ARG n 1 22 LEU n 1 23 SER n 1 24 ARG n 1 25 GLN n 1 26 LYS n 1 27 LEU n 1 28 ALA n 1 29 PHE n 1 30 LEU n 1 31 VAL n 1 32 GLN n 1 33 THR n 1 34 GLU n 1 35 PRO n 1 36 ARG n 1 37 MET n 1 38 LEU n 1 39 LEU n 1 40 MET n 1 41 GLU n 1 42 GLY n 1 43 LEU n 1 44 LYS n 1 45 LEU n 1 46 LEU n 1 47 SER n 1 48 LEU n 1 49 CYS n 1 50 ILE n 1 51 GLU n 1 52 VAL n 1 53 ASP n 1 54 SER n 1 55 CYS n 1 56 ASN n 1 57 ALA n 1 58 ASN n 1 59 GLY n 1 60 CYS n 1 61 GLU n 1 62 HIS n 1 63 ASN n 1 64 SER n 1 65 GLU n 1 66 ASP n 1 67 LYS n 1 68 SER n 1 69 VAL n 1 70 GLU n 1 71 ARG n 1 72 ILE n 1 73 LEU n 1 74 HIS n 1 75 ASP n 1 76 HIS n 1 77 GLY n 1 78 ILE n 1 79 LEU n 1 80 THR n 1 81 PRO n 1 82 SER n 1 83 LEU n 1 84 CYS n 1 85 PHE n 1 86 VAL n 1 87 VAL n 1 88 PRO n 1 89 ASP n 1 90 GLY n 1 91 TYR n 1 92 LYS n 1 93 LEU n 1 94 THR n 1 95 GLY n 1 96 ASN n 1 97 VAL n 1 98 LEU n 1 99 ILE n 1 100 LEU n 1 101 LEU n 1 102 GLU n 1 103 CYS n 1 104 PHE n 1 105 VAL n 1 106 ARG n 1 107 SER n 1 108 SER n 1 109 PRO n 1 110 ALA n 1 111 ASN n 1 112 PHE n 1 113 GLU n 1 114 GLN n 1 115 LYS n 1 116 TYR n 1 117 ILE n 1 118 GLU n 1 119 ASP n 1 120 PHE n 1 121 LYS n 1 122 LYS n 1 123 LEU n 1 124 GLU n 1 125 GLN n 1 126 LEU n 1 127 LYS n 1 128 GLU n 1 129 ASP n 1 130 LEU n 1 131 LYS n 1 132 SER n 1 133 VAL n 1 134 ASP n 1 135 ILE n 1 136 ASN n 1 137 LEU n 1 138 ILE n 1 139 PRO n 1 140 LEU n 1 141 ILE n 1 142 ASP n 1 143 GLY n 1 144 ARG n 1 145 THR n 1 146 SER n 1 147 PHE n 1 148 TYR n 1 149 ASN n 1 150 GLU n 1 151 GLN n 1 152 ILE n 1 153 PRO n 1 154 ASP n 1 155 TRP n 1 156 VAL n 1 157 ASN n 1 158 ASP n 1 159 LYS n 1 160 LEU n 1 161 ARG n 1 162 ASP n 1 163 THR n 1 164 LEU n 1 165 PHE n 1 166 SER n 1 167 LEU n 1 168 LEU n 1 169 LYS n 1 170 TYR n 1 171 ALA n 1 172 GLN n 1 173 GLU n 1 174 SER n 1 175 ASN n 1 176 SER n 1 177 LEU n 1 178 PHE n 1 179 GLU n 1 180 GLU n 1 181 SER n 1 182 GLU n 1 183 TYR n 1 184 SER n 1 185 ARG n 1 186 LEU n 1 187 CYS n 1 188 GLU n 1 189 SER n 1 190 LEU n 1 191 SER n 1 192 MET n 1 193 THR n 1 194 SER n 1 195 GLY n 1 196 ARG n 1 197 LEU n 1 198 SER n 1 199 GLY n 1 200 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 200 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mammarenavirus lassaense' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3052310 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CSO 'L-peptide linking' n S-HYDROXYCYSTEINE ? 'C3 H7 N O3 S' 137.158 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DTT non-polymer . 2,3-DIHYDROXY-1,4-DITHIOBUTANE 1,4-DITHIOTHREITOL 'C4 H10 O2 S2' 154.251 E4Z non-polymer . 'Baloxavir acid' ? 'C24 H19 F2 N3 O4 S' 483.487 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 CSO 7 7 7 CSO CSO A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 MET 37 37 37 MET MET A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 MET 40 40 40 MET MET A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 CYS 55 55 55 CYS CYS A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 HIS 62 62 62 HIS HIS A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 HIS 74 74 74 HIS HIS A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 HIS 76 76 76 HIS HIS A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 CYS 84 84 84 CYS CYS A . n A 1 85 PHE 85 85 85 PHE PHE A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 CYS 103 103 103 CYS CYS A . n A 1 104 PHE 104 104 104 PHE PHE A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 PRO 109 109 109 PRO PRO A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 GLN 114 114 114 GLN GLN A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 TYR 116 116 116 TYR TYR A . n A 1 117 ILE 117 117 117 ILE ILE A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 ASP 119 119 119 ASP ASP A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 GLN 125 125 125 GLN GLN A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 LYS 131 131 131 LYS LYS A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 ASN 136 136 136 ASN ASN A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 ILE 138 138 138 ILE ILE A . n A 1 139 PRO 139 139 139 PRO PRO A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 ILE 141 141 141 ILE ILE A . n A 1 142 ASP 142 142 142 ASP ASP A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 ARG 144 144 144 ARG ARG A . n A 1 145 THR 145 145 145 THR THR A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 PHE 147 147 147 PHE PHE A . n A 1 148 TYR 148 148 148 TYR TYR A . n A 1 149 ASN 149 149 149 ASN ASN A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 GLN 151 151 151 GLN GLN A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 PRO 153 153 153 PRO PRO A . n A 1 154 ASP 154 154 154 ASP ASP A . n A 1 155 TRP 155 155 155 TRP TRP A . n A 1 156 VAL 156 156 156 VAL VAL A . n A 1 157 ASN 157 157 157 ASN ASN A . n A 1 158 ASP 158 158 158 ASP ASP A . n A 1 159 LYS 159 159 159 LYS LYS A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 ARG 161 161 161 ARG ARG A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 THR 163 163 163 THR THR A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 PHE 165 165 165 PHE PHE A . n A 1 166 SER 166 166 166 SER SER A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 LYS 169 169 169 LYS LYS A . n A 1 170 TYR 170 170 170 TYR TYR A . n A 1 171 ALA 171 171 ? ? ? A . n A 1 172 GLN 172 172 ? ? ? A . n A 1 173 GLU 173 173 ? ? ? A . n A 1 174 SER 174 174 ? ? ? A . n A 1 175 ASN 175 175 ? ? ? A . n A 1 176 SER 176 176 ? ? ? A . n A 1 177 LEU 177 177 ? ? ? A . n A 1 178 PHE 178 178 ? ? ? A . n A 1 179 GLU 179 179 ? ? ? A . n A 1 180 GLU 180 180 ? ? ? A . n A 1 181 SER 181 181 ? ? ? A . n A 1 182 GLU 182 182 ? ? ? A . n A 1 183 TYR 183 183 ? ? ? A . n A 1 184 SER 184 184 ? ? ? A . n A 1 185 ARG 185 185 ? ? ? A . n A 1 186 LEU 186 186 ? ? ? A . n A 1 187 CYS 187 187 ? ? ? A . n A 1 188 GLU 188 188 ? ? ? A . n A 1 189 SER 189 189 ? ? ? A . n A 1 190 LEU 190 190 ? ? ? A . n A 1 191 SER 191 191 ? ? ? A . n A 1 192 MET 192 192 ? ? ? A . n A 1 193 THR 193 193 ? ? ? A . n A 1 194 SER 194 194 ? ? ? A . n A 1 195 GLY 195 195 ? ? ? A . n A 1 196 ARG 196 196 ? ? ? A . n A 1 197 LEU 197 197 ? ? ? A . n A 1 198 SER 198 198 ? ? ? A . n A 1 199 GLY 199 199 ? ? ? A . n A 1 200 VAL 200 200 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id E4Z _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id E4Z _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 301 201 MG MG A . C 2 MG 1 302 202 MG MG A . D 3 E4Z 1 303 203 E4Z E4Z A . E 4 DTT 1 304 301 DTT DTT A . F 5 HOH 1 401 307 HOH HOH A . F 5 HOH 2 402 132 HOH HOH A . F 5 HOH 3 403 21 HOH HOH A . F 5 HOH 4 404 78 HOH HOH A . F 5 HOH 5 405 7 HOH HOH A . F 5 HOH 6 406 61 HOH HOH A . F 5 HOH 7 407 69 HOH HOH A . F 5 HOH 8 408 33 HOH HOH A . F 5 HOH 9 409 289 HOH HOH A . F 5 HOH 10 410 24 HOH HOH A . F 5 HOH 11 411 16 HOH HOH A . F 5 HOH 12 412 22 HOH HOH A . F 5 HOH 13 413 38 HOH HOH A . F 5 HOH 14 414 77 HOH HOH A . F 5 HOH 15 415 27 HOH HOH A . F 5 HOH 16 416 19 HOH HOH A . F 5 HOH 17 417 14 HOH HOH A . F 5 HOH 18 418 73 HOH HOH A . F 5 HOH 19 419 26 HOH HOH A . F 5 HOH 20 420 17 HOH HOH A . F 5 HOH 21 421 30 HOH HOH A . F 5 HOH 22 422 49 HOH HOH A . F 5 HOH 23 423 58 HOH HOH A . F 5 HOH 24 424 34 HOH HOH A . F 5 HOH 25 425 9 HOH HOH A . F 5 HOH 26 426 122 HOH HOH A . F 5 HOH 27 427 252 HOH HOH A . F 5 HOH 28 428 140 HOH HOH A . F 5 HOH 29 429 4 HOH HOH A . F 5 HOH 30 430 5 HOH HOH A . F 5 HOH 31 431 88 HOH HOH A . F 5 HOH 32 432 126 HOH HOH A . F 5 HOH 33 433 23 HOH HOH A . F 5 HOH 34 434 35 HOH HOH A . F 5 HOH 35 435 87 HOH HOH A . F 5 HOH 36 436 116 HOH HOH A . F 5 HOH 37 437 36 HOH HOH A . F 5 HOH 38 438 55 HOH HOH A . F 5 HOH 39 439 125 HOH HOH A . F 5 HOH 40 440 97 HOH HOH A . F 5 HOH 41 441 25 HOH HOH A . F 5 HOH 42 442 67 HOH HOH A . F 5 HOH 43 443 155 HOH HOH A . F 5 HOH 44 444 29 HOH HOH A . F 5 HOH 45 445 3 HOH HOH A . F 5 HOH 46 446 18 HOH HOH A . F 5 HOH 47 447 57 HOH HOH A . F 5 HOH 48 448 39 HOH HOH A . F 5 HOH 49 449 161 HOH HOH A . F 5 HOH 50 450 15 HOH HOH A . F 5 HOH 51 451 12 HOH HOH A . F 5 HOH 52 452 41 HOH HOH A . F 5 HOH 53 453 120 HOH HOH A . F 5 HOH 54 454 108 HOH HOH A . F 5 HOH 55 455 106 HOH HOH A . F 5 HOH 56 456 51 HOH HOH A . F 5 HOH 57 457 202 HOH HOH A . F 5 HOH 58 458 429 HOH HOH A . F 5 HOH 59 459 75 HOH HOH A . F 5 HOH 60 460 2 HOH HOH A . F 5 HOH 61 461 452 HOH HOH A . F 5 HOH 62 462 190 HOH HOH A . F 5 HOH 63 463 28 HOH HOH A . F 5 HOH 64 464 74 HOH HOH A . F 5 HOH 65 465 257 HOH HOH A . F 5 HOH 66 466 394 HOH HOH A . F 5 HOH 67 467 149 HOH HOH A . F 5 HOH 68 468 50 HOH HOH A . F 5 HOH 69 469 181 HOH HOH A . F 5 HOH 70 470 209 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 2.0-5936_9999 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? CrystFEL ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? CrystFEL ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . ? 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 28UC _cell.details ? _cell.formula_units_Z ? _cell.length_a 58.630 _cell.length_a_esd ? _cell.length_b 58.630 _cell.length_b_esd ? _cell.length_c 135.570 _cell.length_c_esd ? _cell.volume 466018.743 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 28UC _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall 'P 4nw 2abw' _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 28UC _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.54 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.63 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'BATCH MODE' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;After limited proteolysis with subtilisin A, 7.5 mg/ml target protein were mixed with an equal volume of crystallization solution (10% w/v PEG 10000, 250 mM MgSO4 and 100 mM Tris/HCl pH 9.0) ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 293 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-12-22 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.7749 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, DESY BEAMLINE P09 HiPhaX' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.7749 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'P09 HiPhaX' _diffrn_source.pdbx_synchrotron_site 'PETRA III, DESY' # _reflns.B_iso_Wilson_estimate 24.69 _reflns.entry_id 28UC _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.82 _reflns.d_resolution_low 45.19 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 22818 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 94.4 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.978 _reflns.pdbx_CC_star 0.995 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.82 _reflns_shell.d_res_low 1.85 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1118 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.709 _reflns_shell.pdbx_CC_star 0.911 _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 33.00 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 28UC _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.82 _refine.ls_d_res_low 44.34 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 22003 _refine.ls_number_reflns_R_free 1999 _refine.ls_number_reflns_R_work 20004 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.91 _refine.ls_percent_reflns_R_free 9.09 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2008 _refine.ls_R_factor_R_free 0.2359 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1973 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.4818 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2521 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.82 _refine_hist.d_res_low 44.34 _refine_hist.number_atoms_solvent 70 _refine_hist.number_atoms_total 1487 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1373 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 44 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0123 ? 1465 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 1.2075 ? 1986 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0681 ? 225 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0140 ? 263 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 14.7058 ? 588 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.82 1.87 . . 137 1380 99.09 . . . . 0.3457 . . . . . . . . . . . . . . . 0.4221 'X-RAY DIFFRACTION' 1.87 1.92 . . 140 1398 100.00 . . . . 0.3067 . . . . . . . . . . . . . . . 0.3353 'X-RAY DIFFRACTION' 1.92 1.97 . . 139 1397 99.93 . . . . 0.2450 . . . . . . . . . . . . . . . 0.3107 'X-RAY DIFFRACTION' 1.97 2.04 . . 140 1399 99.87 . . . . 0.2230 . . . . . . . . . . . . . . . 0.2434 'X-RAY DIFFRACTION' 2.04 2.11 . . 140 1398 100.00 . . . . 0.2231 . . . . . . . . . . . . . . . 0.2202 'X-RAY DIFFRACTION' 2.11 2.19 . . 141 1408 100.00 . . . . 0.2174 . . . . . . . . . . . . . . . 0.2458 'X-RAY DIFFRACTION' 2.19 2.29 . . 141 1406 99.94 . . . . 0.1975 . . . . . . . . . . . . . . . 0.2474 'X-RAY DIFFRACTION' 2.29 2.41 . . 141 1415 99.94 . . . . 0.1864 . . . . . . . . . . . . . . . 0.2193 'X-RAY DIFFRACTION' 2.41 2.57 . . 142 1425 100.00 . . . . 0.1885 . . . . . . . . . . . . . . . 0.2255 'X-RAY DIFFRACTION' 2.57 2.76 . . 143 1428 100.00 . . . . 0.2042 . . . . . . . . . . . . . . . 0.2526 'X-RAY DIFFRACTION' 2.76 3.04 . . 144 1435 100.00 . . . . 0.1817 . . . . . . . . . . . . . . . 0.2379 'X-RAY DIFFRACTION' 3.04 3.48 . . 145 1455 100.00 . . . . 0.1777 . . . . . . . . . . . . . . . 0.2341 'X-RAY DIFFRACTION' 3.48 4.38 . . 148 1476 100.00 . . . . 0.1691 . . . . . . . . . . . . . . . 0.1894 'X-RAY DIFFRACTION' 4.39 44.34 . . 158 1584 99.94 . . . . 0.1954 . . . . . . . . . . . . . . . 0.2346 # _struct.entry_id 28UC _struct.title 'LASV cap-snatching endonuclease in complex with BXA - serial synchrotron crystallography' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 28UC _struct_keywords.text 'drug development, Lassa hemorrhagic fever, L protein, Arenaviridae, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q6GWS2_LASSJ _struct_ref.pdbx_db_accession Q6GWS2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEEDIACVKDLVSKYLVDNERLSRQKLAFLVQTEPRMLLMEGLKLLSLCIEVDSCNANGCEHNSEDKSVERILHDHGILT PSLCFVVPDGYKLTGNVLILLECFVRSSPANFEQKYIEDFKKLEQLKEDLKSVDINLIPLIDGRTSFYNEQIPDWVNDKL RDTLFSLLKYAQESNSLFEESEYSRLCESLSMTSGRLSGV ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 28UC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 200 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6GWS2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 200 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 200 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 380 ? 1 MORE -22 ? 1 'SSA (A^2)' 9960 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 MET A 1 ? LYS A 14 ? MET A 1 LYS A 14 1 ? 14 HELX_P HELX_P2 AA2 ASN A 19 ? VAL A 31 ? ASN A 19 VAL A 31 1 ? 13 HELX_P HELX_P3 AA3 GLU A 34 ? ASN A 58 ? GLU A 34 ASN A 58 1 ? 25 HELX_P HELX_P4 AA4 SER A 68 ? HIS A 76 ? SER A 68 HIS A 76 1 ? 9 HELX_P HELX_P5 AA5 SER A 108 ? GLN A 125 ? SER A 108 GLN A 125 1 ? 18 HELX_P HELX_P6 AA6 LEU A 126 ? SER A 132 ? LEU A 126 SER A 132 1 ? 7 HELX_P HELX_P7 AA7 PRO A 153 ? LEU A 167 ? PRO A 153 LEU A 167 1 ? 15 HELX_P HELX_P8 AA8 LEU A 168 ? TYR A 170 ? LEU A 168 TYR A 170 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ALA 6 C ? ? ? 1_555 A CSO 7 N ? ? A ALA 6 A CSO 7 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale2 covale both ? A CSO 7 C ? ? ? 1_555 A VAL 8 N ? ? A CSO 7 A VAL 8 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale3 covale none ? A CYS 84 SG ? ? ? 1_555 E DTT . S1 ? ? A CYS 84 A DTT 304 1_555 ? ? ? ? ? ? ? 2.010 ? ? metalc1 metalc ? ? A ASP 89 OD2 ? ? ? 1_555 B MG . MG ? ? A ASP 89 A MG 301 1_555 ? ? ? ? ? ? ? 2.031 ? ? metalc2 metalc ? ? A ASP 89 OD1 ? ? ? 1_555 C MG . MG ? ? A ASP 89 A MG 302 1_555 ? ? ? ? ? ? ? 1.702 ? ? metalc3 metalc ? ? A CYS 103 O A ? ? 1_555 B MG . MG ? ? A CYS 103 A MG 301 1_555 ? ? ? ? ? ? ? 2.105 ? ? metalc4 metalc ? ? A CYS 103 O B ? ? 1_555 B MG . MG ? ? A CYS 103 A MG 301 1_555 ? ? ? ? ? ? ? 2.143 ? ? metalc5 metalc ? ? B MG . MG ? ? ? 1_555 D E4Z . O2 ? ? A MG 301 A E4Z 303 1_555 ? ? ? ? ? ? ? 2.033 ? ? metalc6 metalc ? ? B MG . MG ? ? ? 1_555 D E4Z . O1 ? ? A MG 301 A E4Z 303 1_555 ? ? ? ? ? ? ? 2.151 ? ? metalc7 metalc ? ? B MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 301 A HOH 412 1_555 ? ? ? ? ? ? ? 1.825 ? ? metalc8 metalc ? ? B MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 301 A HOH 425 1_555 ? ? ? ? ? ? ? 2.164 ? ? metalc9 metalc ? ? C MG . MG ? ? ? 1_555 D E4Z . O2 ? ? A MG 302 A E4Z 303 1_555 ? ? ? ? ? ? ? 2.183 ? ? metalc10 metalc ? ? C MG . MG ? ? ? 1_555 D E4Z . O3 ? ? A MG 302 A E4Z 303 1_555 ? ? ? ? ? ? ? 1.751 ? ? metalc11 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 302 A HOH 403 1_555 ? ? ? ? ? ? ? 2.084 ? ? metalc12 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 302 A HOH 405 1_555 ? ? ? ? ? ? ? 2.194 ? ? metalc13 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 302 A HOH 416 1_555 ? ? ? ? ? ? ? 2.049 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 89 ? A ASP 89 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O A A CYS 103 ? A CYS 103 ? 1_555 93.7 ? 2 OD2 ? A ASP 89 ? A ASP 89 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O B A CYS 103 ? A CYS 103 ? 1_555 93.7 ? 3 O A A CYS 103 ? A CYS 103 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O B A CYS 103 ? A CYS 103 ? 1_555 1.1 ? 4 OD2 ? A ASP 89 ? A ASP 89 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O2 ? D E4Z . ? A E4Z 303 ? 1_555 100.0 ? 5 O A A CYS 103 ? A CYS 103 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O2 ? D E4Z . ? A E4Z 303 ? 1_555 165.8 ? 6 O B A CYS 103 ? A CYS 103 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O2 ? D E4Z . ? A E4Z 303 ? 1_555 165.4 ? 7 OD2 ? A ASP 89 ? A ASP 89 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O1 ? D E4Z . ? A E4Z 303 ? 1_555 174.4 ? 8 O A A CYS 103 ? A CYS 103 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O1 ? D E4Z . ? A E4Z 303 ? 1_555 87.2 ? 9 O B A CYS 103 ? A CYS 103 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O1 ? D E4Z . ? A E4Z 303 ? 1_555 87.1 ? 10 O2 ? D E4Z . ? A E4Z 303 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O1 ? D E4Z . ? A E4Z 303 ? 1_555 78.8 ? 11 OD2 ? A ASP 89 ? A ASP 89 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 412 ? 1_555 86.6 ? 12 O A A CYS 103 ? A CYS 103 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 412 ? 1_555 92.0 ? 13 O B A CYS 103 ? A CYS 103 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 412 ? 1_555 90.9 ? 14 O2 ? D E4Z . ? A E4Z 303 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 412 ? 1_555 84.9 ? 15 O1 ? D E4Z . ? A E4Z 303 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 412 ? 1_555 87.9 ? 16 OD2 ? A ASP 89 ? A ASP 89 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 425 ? 1_555 91.4 ? 17 O A A CYS 103 ? A CYS 103 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 425 ? 1_555 88.0 ? 18 O B A CYS 103 ? A CYS 103 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 425 ? 1_555 89.1 ? 19 O2 ? D E4Z . ? A E4Z 303 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 425 ? 1_555 95.5 ? 20 O1 ? D E4Z . ? A E4Z 303 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 425 ? 1_555 94.1 ? 21 O ? F HOH . ? A HOH 412 ? 1_555 MG ? B MG . ? A MG 301 ? 1_555 O ? F HOH . ? A HOH 425 ? 1_555 178.1 ? 22 OD1 ? A ASP 89 ? A ASP 89 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 O2 ? D E4Z . ? A E4Z 303 ? 1_555 92.5 ? 23 OD1 ? A ASP 89 ? A ASP 89 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 O3 ? D E4Z . ? A E4Z 303 ? 1_555 171.9 ? 24 O2 ? D E4Z . ? A E4Z 303 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 O3 ? D E4Z . ? A E4Z 303 ? 1_555 82.6 ? 25 OD1 ? A ASP 89 ? A ASP 89 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 403 ? 1_555 105.5 ? 26 O2 ? D E4Z . ? A E4Z 303 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 403 ? 1_555 162.0 ? 27 O3 ? D E4Z . ? A E4Z 303 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 403 ? 1_555 79.4 ? 28 OD1 ? A ASP 89 ? A ASP 89 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 405 ? 1_555 93.6 ? 29 O2 ? D E4Z . ? A E4Z 303 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 405 ? 1_555 95.2 ? 30 O3 ? D E4Z . ? A E4Z 303 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 405 ? 1_555 80.5 ? 31 O ? F HOH . ? A HOH 403 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 405 ? 1_555 83.5 ? 32 OD1 ? A ASP 89 ? A ASP 89 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 416 ? 1_555 98.4 ? 33 O2 ? D E4Z . ? A E4Z 303 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 416 ? 1_555 86.9 ? 34 O3 ? D E4Z . ? A E4Z 303 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 416 ? 1_555 87.9 ? 35 O ? F HOH . ? A HOH 403 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 416 ? 1_555 90.7 ? 36 O ? F HOH . ? A HOH 405 ? 1_555 MG ? C MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 416 ? 1_555 167.8 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CSO A 7 ? . . . . CSO A 7 ? 1_555 . . . . . . . CYS 1 CSO Hydroxylation 'Named protein modification' 2 DTT E . ? CYS A 84 ? DTT A 304 ? 1_555 CYS A 84 ? 1_555 S1 SG CYS 1 DTT None Crosslinker # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 61 ? HIS A 62 ? GLU A 61 HIS A 62 AA1 2 GLY A 90 ? THR A 94 ? GLY A 90 THR A 94 AA1 3 VAL A 97 ? VAL A 105 ? VAL A 97 VAL A 105 AA1 4 ASN A 136 ? ARG A 144 ? ASN A 136 ARG A 144 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 61 ? N GLU A 61 O TYR A 91 ? O TYR A 91 AA1 2 3 N LYS A 92 ? N LYS A 92 O ILE A 99 ? O ILE A 99 AA1 3 4 N LEU A 100 ? N LEU A 100 O LEU A 140 ? O LEU A 140 # _pdbx_entry_details.entry_id 28UC _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 71 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.088 _pdbx_validate_planes.type 'SIDE CHAIN' # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id CSO _pdbx_struct_mod_residue.label_seq_id 7 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id CSO _pdbx_struct_mod_residue.auth_seq_id 7 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id CYS _pdbx_struct_mod_residue.details 'modified residue' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x+1/2,z+3/4 3 y+1/2,-x+1/2,z+1/4 4 x+1/2,-y+1/2,-z+1/4 5 -x+1/2,y+1/2,-z+3/4 6 -x,-y,z+1/2 7 y,x,-z 8 -y,-x,-z+1/2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 171 ? A ALA 171 2 1 Y 1 A GLN 172 ? A GLN 172 3 1 Y 1 A GLU 173 ? A GLU 173 4 1 Y 1 A SER 174 ? A SER 174 5 1 Y 1 A ASN 175 ? A ASN 175 6 1 Y 1 A SER 176 ? A SER 176 7 1 Y 1 A LEU 177 ? A LEU 177 8 1 Y 1 A PHE 178 ? A PHE 178 9 1 Y 1 A GLU 179 ? A GLU 179 10 1 Y 1 A GLU 180 ? A GLU 180 11 1 Y 1 A SER 181 ? A SER 181 12 1 Y 1 A GLU 182 ? A GLU 182 13 1 Y 1 A TYR 183 ? A TYR 183 14 1 Y 1 A SER 184 ? A SER 184 15 1 Y 1 A ARG 185 ? A ARG 185 16 1 Y 1 A LEU 186 ? A LEU 186 17 1 Y 1 A CYS 187 ? A CYS 187 18 1 Y 1 A GLU 188 ? A GLU 188 19 1 Y 1 A SER 189 ? A SER 189 20 1 Y 1 A LEU 190 ? A LEU 190 21 1 Y 1 A SER 191 ? A SER 191 22 1 Y 1 A MET 192 ? A MET 192 23 1 Y 1 A THR 193 ? A THR 193 24 1 Y 1 A SER 194 ? A SER 194 25 1 Y 1 A GLY 195 ? A GLY 195 26 1 Y 1 A ARG 196 ? A ARG 196 27 1 Y 1 A LEU 197 ? A LEU 197 28 1 Y 1 A SER 198 ? A SER 198 29 1 Y 1 A GLY 199 ? A GLY 199 30 1 Y 1 A VAL 200 ? A VAL 200 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CSO N N N N 74 CSO CA C N R 75 CSO CB C N N 76 CSO SG S N N 77 CSO C C N N 78 CSO O O N N 79 CSO OXT O N N 80 CSO OD O N N 81 CSO H H N N 82 CSO H2 H N N 83 CSO HA H N N 84 CSO HB2 H N N 85 CSO HB3 H N N 86 CSO HXT H N N 87 CSO HD H N N 88 CYS N N N N 89 CYS CA C N R 90 CYS C C N N 91 CYS O O N N 92 CYS CB C N N 93 CYS SG S N N 94 CYS OXT O N N 95 CYS H H N N 96 CYS H2 H N N 97 CYS HA H N N 98 CYS HB2 H N N 99 CYS HB3 H N N 100 CYS HG H N N 101 CYS HXT H N N 102 DTT S1 S N N 103 DTT C1 C N N 104 DTT C2 C N R 105 DTT O2 O N N 106 DTT C3 C N R 107 DTT O3 O N N 108 DTT C4 C N N 109 DTT S4 S N N 110 DTT HS1 H N N 111 DTT H11 H N N 112 DTT H12 H N N 113 DTT H2 H N N 114 DTT HO2 H N N 115 DTT H3 H N N 116 DTT HO3 H N N 117 DTT H41 H N N 118 DTT H42 H N N 119 DTT HS2 H N N 120 E4Z C1 C N N 121 E4Z N1 N N N 122 E4Z O1 O N N 123 E4Z C2 C N N 124 E4Z O2 O N N 125 E4Z O3 O N N 126 E4Z C4 C N N 127 E4Z O4 O N N 128 E4Z C5 C N N 129 E4Z C6 C N N 130 E4Z C7 C N R 131 E4Z C13 C Y N 132 E4Z C14 C N N 133 E4Z C15 C Y N 134 E4Z C16 C Y N 135 E4Z C17 C Y N 136 E4Z C18 C Y N 137 E4Z C19 C Y N 138 E4Z C20 C Y N 139 E4Z C21 C Y N 140 E4Z C22 C Y N 141 E4Z C23 C Y N 142 E4Z C24 C Y N 143 E4Z F2 F N N 144 E4Z C12 C Y N 145 E4Z F1 F N N 146 E4Z S3 S N N 147 E4Z C11 C N S 148 E4Z N2 N N N 149 E4Z C8 C N N 150 E4Z C9 C N N 151 E4Z C10 C N N 152 E4Z N3 N N N 153 E4Z C3 C N N 154 E4Z H1 H N N 155 E4Z H3 H N N 156 E4Z H4 H N N 157 E4Z H5 H N N 158 E4Z H6 H N N 159 E4Z H7 H N N 160 E4Z H8 H N N 161 E4Z H9 H N N 162 E4Z H10 H N N 163 E4Z H11 H N N 164 E4Z H12 H N N 165 E4Z H13 H N N 166 E4Z H14 H N N 167 E4Z H15 H N N 168 E4Z H16 H N N 169 E4Z H17 H N N 170 E4Z H18 H N N 171 E4Z H19 H N N 172 E4Z H20 H N N 173 GLN N N N N 174 GLN CA C N S 175 GLN C C N N 176 GLN O O N N 177 GLN CB C N N 178 GLN CG C N N 179 GLN CD C N N 180 GLN OE1 O N N 181 GLN NE2 N N N 182 GLN OXT O N N 183 GLN H H N N 184 GLN H2 H N N 185 GLN HA H N N 186 GLN HB2 H N N 187 GLN HB3 H N N 188 GLN HG2 H N N 189 GLN HG3 H N N 190 GLN HE21 H N N 191 GLN HE22 H N N 192 GLN HXT H N N 193 GLU N N N N 194 GLU CA C N S 195 GLU C C N N 196 GLU O O N N 197 GLU CB C N N 198 GLU CG C N N 199 GLU CD C N N 200 GLU OE1 O N N 201 GLU OE2 O N N 202 GLU OXT O N N 203 GLU H H N N 204 GLU H2 H N N 205 GLU HA H N N 206 GLU HB2 H N N 207 GLU HB3 H N N 208 GLU HG2 H N N 209 GLU HG3 H N N 210 GLU HE2 H N N 211 GLU HXT H N N 212 GLY N N N N 213 GLY CA C N N 214 GLY C C N N 215 GLY O O N N 216 GLY OXT O N N 217 GLY H H N N 218 GLY H2 H N N 219 GLY HA2 H N N 220 GLY HA3 H N N 221 GLY HXT H N N 222 HIS N N N N 223 HIS CA C N S 224 HIS C C N N 225 HIS O O N N 226 HIS CB C N N 227 HIS CG C Y N 228 HIS ND1 N Y N 229 HIS CD2 C Y N 230 HIS CE1 C Y N 231 HIS NE2 N Y N 232 HIS OXT O N N 233 HIS H H N N 234 HIS H2 H N N 235 HIS HA H N N 236 HIS HB2 H N N 237 HIS HB3 H N N 238 HIS HD1 H N N 239 HIS HD2 H N N 240 HIS HE1 H N N 241 HIS HE2 H N N 242 HIS HXT H N N 243 HOH O O N N 244 HOH H1 H N N 245 HOH H2 H N N 246 ILE N N N N 247 ILE CA C N S 248 ILE C C N N 249 ILE O O N N 250 ILE CB C N S 251 ILE CG1 C N N 252 ILE CG2 C N N 253 ILE CD1 C N N 254 ILE OXT O N N 255 ILE H H N N 256 ILE H2 H N N 257 ILE HA H N N 258 ILE HB H N N 259 ILE HG12 H N N 260 ILE HG13 H N N 261 ILE HG21 H N N 262 ILE HG22 H N N 263 ILE HG23 H N N 264 ILE HD11 H N N 265 ILE HD12 H N N 266 ILE HD13 H N N 267 ILE HXT H N N 268 LEU N N N N 269 LEU CA C N S 270 LEU C C N N 271 LEU O O N N 272 LEU CB C N N 273 LEU CG C N N 274 LEU CD1 C N N 275 LEU CD2 C N N 276 LEU OXT O N N 277 LEU H H N N 278 LEU H2 H N N 279 LEU HA H N N 280 LEU HB2 H N N 281 LEU HB3 H N N 282 LEU HG H N N 283 LEU HD11 H N N 284 LEU HD12 H N N 285 LEU HD13 H N N 286 LEU HD21 H N N 287 LEU HD22 H N N 288 LEU HD23 H N N 289 LEU HXT H N N 290 LYS N N N N 291 LYS CA C N S 292 LYS C C N N 293 LYS O O N N 294 LYS CB C N N 295 LYS CG C N N 296 LYS CD C N N 297 LYS CE C N N 298 LYS NZ N N N 299 LYS OXT O N N 300 LYS H H N N 301 LYS H2 H N N 302 LYS HA H N N 303 LYS HB2 H N N 304 LYS HB3 H N N 305 LYS HG2 H N N 306 LYS HG3 H N N 307 LYS HD2 H N N 308 LYS HD3 H N N 309 LYS HE2 H N N 310 LYS HE3 H N N 311 LYS HZ1 H N N 312 LYS HZ2 H N N 313 LYS HZ3 H N N 314 LYS HXT H N N 315 MET N N N N 316 MET CA C N S 317 MET C C N N 318 MET O O N N 319 MET CB C N N 320 MET CG C N N 321 MET SD S N N 322 MET CE C N N 323 MET OXT O N N 324 MET H H N N 325 MET H2 H N N 326 MET HA H N N 327 MET HB2 H N N 328 MET HB3 H N N 329 MET HG2 H N N 330 MET HG3 H N N 331 MET HE1 H N N 332 MET HE2 H N N 333 MET HE3 H N N 334 MET HXT H N N 335 MG MG MG N N 336 PHE N N N N 337 PHE CA C N S 338 PHE C C N N 339 PHE O O N N 340 PHE CB C N N 341 PHE CG C Y N 342 PHE CD1 C Y N 343 PHE CD2 C Y N 344 PHE CE1 C Y N 345 PHE CE2 C Y N 346 PHE CZ C Y N 347 PHE OXT O N N 348 PHE H H N N 349 PHE H2 H N N 350 PHE HA H N N 351 PHE HB2 H N N 352 PHE HB3 H N N 353 PHE HD1 H N N 354 PHE HD2 H N N 355 PHE HE1 H N N 356 PHE HE2 H N N 357 PHE HZ H N N 358 PHE HXT H N N 359 PRO N N N N 360 PRO CA C N S 361 PRO C C N N 362 PRO O O N N 363 PRO CB C N N 364 PRO CG C N N 365 PRO CD C N N 366 PRO OXT O N N 367 PRO H H N N 368 PRO HA H N N 369 PRO HB2 H N N 370 PRO HB3 H N N 371 PRO HG2 H N N 372 PRO HG3 H N N 373 PRO HD2 H N N 374 PRO HD3 H N N 375 PRO HXT H N N 376 SER N N N N 377 SER CA C N S 378 SER C C N N 379 SER O O N N 380 SER CB C N N 381 SER OG O N N 382 SER OXT O N N 383 SER H H N N 384 SER H2 H N N 385 SER HA H N N 386 SER HB2 H N N 387 SER HB3 H N N 388 SER HG H N N 389 SER HXT H N N 390 THR N N N N 391 THR CA C N S 392 THR C C N N 393 THR O O N N 394 THR CB C N R 395 THR OG1 O N N 396 THR CG2 C N N 397 THR OXT O N N 398 THR H H N N 399 THR H2 H N N 400 THR HA H N N 401 THR HB H N N 402 THR HG1 H N N 403 THR HG21 H N N 404 THR HG22 H N N 405 THR HG23 H N N 406 THR HXT H N N 407 TRP N N N N 408 TRP CA C N S 409 TRP C C N N 410 TRP O O N N 411 TRP CB C N N 412 TRP CG C Y N 413 TRP CD1 C Y N 414 TRP CD2 C Y N 415 TRP NE1 N Y N 416 TRP CE2 C Y N 417 TRP CE3 C Y N 418 TRP CZ2 C Y N 419 TRP CZ3 C Y N 420 TRP CH2 C Y N 421 TRP OXT O N N 422 TRP H H N N 423 TRP H2 H N N 424 TRP HA H N N 425 TRP HB2 H N N 426 TRP HB3 H N N 427 TRP HD1 H N N 428 TRP HE1 H N N 429 TRP HE3 H N N 430 TRP HZ2 H N N 431 TRP HZ3 H N N 432 TRP HH2 H N N 433 TRP HXT H N N 434 TYR N N N N 435 TYR CA C N S 436 TYR C C N N 437 TYR O O N N 438 TYR CB C N N 439 TYR CG C Y N 440 TYR CD1 C Y N 441 TYR CD2 C Y N 442 TYR CE1 C Y N 443 TYR CE2 C Y N 444 TYR CZ C Y N 445 TYR OH O N N 446 TYR OXT O N N 447 TYR H H N N 448 TYR H2 H N N 449 TYR HA H N N 450 TYR HB2 H N N 451 TYR HB3 H N N 452 TYR HD1 H N N 453 TYR HD2 H N N 454 TYR HE1 H N N 455 TYR HE2 H N N 456 TYR HH H N N 457 TYR HXT H N N 458 VAL N N N N 459 VAL CA C N S 460 VAL C C N N 461 VAL O O N N 462 VAL CB C N N 463 VAL CG1 C N N 464 VAL CG2 C N N 465 VAL OXT O N N 466 VAL H H N N 467 VAL H2 H N N 468 VAL HA H N N 469 VAL HB H N N 470 VAL HG11 H N N 471 VAL HG12 H N N 472 VAL HG13 H N N 473 VAL HG21 H N N 474 VAL HG22 H N N 475 VAL HG23 H N N 476 VAL HXT H N N 477 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CSO N CA sing N N 70 CSO N H sing N N 71 CSO N H2 sing N N 72 CSO CA CB sing N N 73 CSO CA C sing N N 74 CSO CA HA sing N N 75 CSO CB SG sing N N 76 CSO CB HB2 sing N N 77 CSO CB HB3 sing N N 78 CSO SG OD sing N N 79 CSO C O doub N N 80 CSO C OXT sing N N 81 CSO OXT HXT sing N N 82 CSO OD HD sing N N 83 CYS N CA sing N N 84 CYS N H sing N N 85 CYS N H2 sing N N 86 CYS CA C sing N N 87 CYS CA CB sing N N 88 CYS CA HA sing N N 89 CYS C O doub N N 90 CYS C OXT sing N N 91 CYS CB SG sing N N 92 CYS CB HB2 sing N N 93 CYS CB HB3 sing N N 94 CYS SG HG sing N N 95 CYS OXT HXT sing N N 96 DTT S1 C1 sing N N 97 DTT S1 HS1 sing N N 98 DTT C1 C2 sing N N 99 DTT C1 H11 sing N N 100 DTT C1 H12 sing N N 101 DTT C2 O2 sing N N 102 DTT C2 C3 sing N N 103 DTT C2 H2 sing N N 104 DTT O2 HO2 sing N N 105 DTT C3 O3 sing N N 106 DTT C3 C4 sing N N 107 DTT C3 H3 sing N N 108 DTT O3 HO3 sing N N 109 DTT C4 S4 sing N N 110 DTT C4 H41 sing N N 111 DTT C4 H42 sing N N 112 DTT S4 HS2 sing N N 113 E4Z C9 O4 sing N N 114 E4Z C9 C10 sing N N 115 E4Z O4 C8 sing N N 116 E4Z C10 N3 sing N N 117 E4Z C8 C7 sing N N 118 E4Z O3 C6 doub N N 119 E4Z N3 C6 sing N N 120 E4Z N3 C7 sing N N 121 E4Z C6 C4 sing N N 122 E4Z C7 N2 sing N N 123 E4Z O2 C5 sing N N 124 E4Z C4 C5 doub N N 125 E4Z C4 N1 sing N N 126 E4Z C5 C1 sing N N 127 E4Z N2 N1 sing N N 128 E4Z N2 C11 sing N N 129 E4Z N1 C3 sing N N 130 E4Z C1 O1 doub N N 131 E4Z C1 C2 sing N N 132 E4Z C3 C2 doub N N 133 E4Z C11 C12 sing N N 134 E4Z C11 C16 sing N N 135 E4Z C21 C22 doub Y N 136 E4Z C21 C12 sing Y N 137 E4Z C22 C23 sing Y N 138 E4Z C12 C13 doub Y N 139 E4Z C23 F2 sing N N 140 E4Z C23 C24 doub Y N 141 E4Z C13 C24 sing Y N 142 E4Z C13 C14 sing N N 143 E4Z C24 F1 sing N N 144 E4Z C14 S3 sing N N 145 E4Z C16 C20 doub Y N 146 E4Z C16 C15 sing Y N 147 E4Z C20 C19 sing Y N 148 E4Z S3 C15 sing N N 149 E4Z C15 C17 doub Y N 150 E4Z C19 C18 doub Y N 151 E4Z C17 C18 sing Y N 152 E4Z C2 H1 sing N N 153 E4Z C7 H3 sing N N 154 E4Z C14 H4 sing N N 155 E4Z C14 H5 sing N N 156 E4Z C17 H6 sing N N 157 E4Z C18 H7 sing N N 158 E4Z C19 H8 sing N N 159 E4Z C20 H9 sing N N 160 E4Z C21 H10 sing N N 161 E4Z C22 H11 sing N N 162 E4Z C11 H12 sing N N 163 E4Z C8 H13 sing N N 164 E4Z C8 H14 sing N N 165 E4Z C9 H15 sing N N 166 E4Z C9 H16 sing N N 167 E4Z C10 H17 sing N N 168 E4Z C10 H18 sing N N 169 E4Z C3 H19 sing N N 170 E4Z O2 H20 sing N N 171 GLN N CA sing N N 172 GLN N H sing N N 173 GLN N H2 sing N N 174 GLN CA C sing N N 175 GLN CA CB sing N N 176 GLN CA HA sing N N 177 GLN C O doub N N 178 GLN C OXT sing N N 179 GLN CB CG sing N N 180 GLN CB HB2 sing N N 181 GLN CB HB3 sing N N 182 GLN CG CD sing N N 183 GLN CG HG2 sing N N 184 GLN CG HG3 sing N N 185 GLN CD OE1 doub N N 186 GLN CD NE2 sing N N 187 GLN NE2 HE21 sing N N 188 GLN NE2 HE22 sing N N 189 GLN OXT HXT sing N N 190 GLU N CA sing N N 191 GLU N H sing N N 192 GLU N H2 sing N N 193 GLU CA C sing N N 194 GLU CA CB sing N N 195 GLU CA HA sing N N 196 GLU C O doub N N 197 GLU C OXT sing N N 198 GLU CB CG sing N N 199 GLU CB HB2 sing N N 200 GLU CB HB3 sing N N 201 GLU CG CD sing N N 202 GLU CG HG2 sing N N 203 GLU CG HG3 sing N N 204 GLU CD OE1 doub N N 205 GLU CD OE2 sing N N 206 GLU OE2 HE2 sing N N 207 GLU OXT HXT sing N N 208 GLY N CA sing N N 209 GLY N H sing N N 210 GLY N H2 sing N N 211 GLY CA C sing N N 212 GLY CA HA2 sing N N 213 GLY CA HA3 sing N N 214 GLY C O doub N N 215 GLY C OXT sing N N 216 GLY OXT HXT sing N N 217 HIS N CA sing N N 218 HIS N H sing N N 219 HIS N H2 sing N N 220 HIS CA C sing N N 221 HIS CA CB sing N N 222 HIS CA HA sing N N 223 HIS C O doub N N 224 HIS C OXT sing N N 225 HIS CB CG sing N N 226 HIS CB HB2 sing N N 227 HIS CB HB3 sing N N 228 HIS CG ND1 sing Y N 229 HIS CG CD2 doub Y N 230 HIS ND1 CE1 doub Y N 231 HIS ND1 HD1 sing N N 232 HIS CD2 NE2 sing Y N 233 HIS CD2 HD2 sing N N 234 HIS CE1 NE2 sing Y N 235 HIS CE1 HE1 sing N N 236 HIS NE2 HE2 sing N N 237 HIS OXT HXT sing N N 238 HOH O H1 sing N N 239 HOH O H2 sing N N 240 ILE N CA sing N N 241 ILE N H sing N N 242 ILE N H2 sing N N 243 ILE CA C sing N N 244 ILE CA CB sing N N 245 ILE CA HA sing N N 246 ILE C O doub N N 247 ILE C OXT sing N N 248 ILE CB CG1 sing N N 249 ILE CB CG2 sing N N 250 ILE CB HB sing N N 251 ILE CG1 CD1 sing N N 252 ILE CG1 HG12 sing N N 253 ILE CG1 HG13 sing N N 254 ILE CG2 HG21 sing N N 255 ILE CG2 HG22 sing N N 256 ILE CG2 HG23 sing N N 257 ILE CD1 HD11 sing N N 258 ILE CD1 HD12 sing N N 259 ILE CD1 HD13 sing N N 260 ILE OXT HXT sing N N 261 LEU N CA sing N N 262 LEU N H sing N N 263 LEU N H2 sing N N 264 LEU CA C sing N N 265 LEU CA CB sing N N 266 LEU CA HA sing N N 267 LEU C O doub N N 268 LEU C OXT sing N N 269 LEU CB CG sing N N 270 LEU CB HB2 sing N N 271 LEU CB HB3 sing N N 272 LEU CG CD1 sing N N 273 LEU CG CD2 sing N N 274 LEU CG HG sing N N 275 LEU CD1 HD11 sing N N 276 LEU CD1 HD12 sing N N 277 LEU CD1 HD13 sing N N 278 LEU CD2 HD21 sing N N 279 LEU CD2 HD22 sing N N 280 LEU CD2 HD23 sing N N 281 LEU OXT HXT sing N N 282 LYS N CA sing N N 283 LYS N H sing N N 284 LYS N H2 sing N N 285 LYS CA C sing N N 286 LYS CA CB sing N N 287 LYS CA HA sing N N 288 LYS C O doub N N 289 LYS C OXT sing N N 290 LYS CB CG sing N N 291 LYS CB HB2 sing N N 292 LYS CB HB3 sing N N 293 LYS CG CD sing N N 294 LYS CG HG2 sing N N 295 LYS CG HG3 sing N N 296 LYS CD CE sing N N 297 LYS CD HD2 sing N N 298 LYS CD HD3 sing N N 299 LYS CE NZ sing N N 300 LYS CE HE2 sing N N 301 LYS CE HE3 sing N N 302 LYS NZ HZ1 sing N N 303 LYS NZ HZ2 sing N N 304 LYS NZ HZ3 sing N N 305 LYS OXT HXT sing N N 306 MET N CA sing N N 307 MET N H sing N N 308 MET N H2 sing N N 309 MET CA C sing N N 310 MET CA CB sing N N 311 MET CA HA sing N N 312 MET C O doub N N 313 MET C OXT sing N N 314 MET CB CG sing N N 315 MET CB HB2 sing N N 316 MET CB HB3 sing N N 317 MET CG SD sing N N 318 MET CG HG2 sing N N 319 MET CG HG3 sing N N 320 MET SD CE sing N N 321 MET CE HE1 sing N N 322 MET CE HE2 sing N N 323 MET CE HE3 sing N N 324 MET OXT HXT sing N N 325 PHE N CA sing N N 326 PHE N H sing N N 327 PHE N H2 sing N N 328 PHE CA C sing N N 329 PHE CA CB sing N N 330 PHE CA HA sing N N 331 PHE C O doub N N 332 PHE C OXT sing N N 333 PHE CB CG sing N N 334 PHE CB HB2 sing N N 335 PHE CB HB3 sing N N 336 PHE CG CD1 doub Y N 337 PHE CG CD2 sing Y N 338 PHE CD1 CE1 sing Y N 339 PHE CD1 HD1 sing N N 340 PHE CD2 CE2 doub Y N 341 PHE CD2 HD2 sing N N 342 PHE CE1 CZ doub Y N 343 PHE CE1 HE1 sing N N 344 PHE CE2 CZ sing Y N 345 PHE CE2 HE2 sing N N 346 PHE CZ HZ sing N N 347 PHE OXT HXT sing N N 348 PRO N CA sing N N 349 PRO N CD sing N N 350 PRO N H sing N N 351 PRO CA C sing N N 352 PRO CA CB sing N N 353 PRO CA HA sing N N 354 PRO C O doub N N 355 PRO C OXT sing N N 356 PRO CB CG sing N N 357 PRO CB HB2 sing N N 358 PRO CB HB3 sing N N 359 PRO CG CD sing N N 360 PRO CG HG2 sing N N 361 PRO CG HG3 sing N N 362 PRO CD HD2 sing N N 363 PRO CD HD3 sing N N 364 PRO OXT HXT sing N N 365 SER N CA sing N N 366 SER N H sing N N 367 SER N H2 sing N N 368 SER CA C sing N N 369 SER CA CB sing N N 370 SER CA HA sing N N 371 SER C O doub N N 372 SER C OXT sing N N 373 SER CB OG sing N N 374 SER CB HB2 sing N N 375 SER CB HB3 sing N N 376 SER OG HG sing N N 377 SER OXT HXT sing N N 378 THR N CA sing N N 379 THR N H sing N N 380 THR N H2 sing N N 381 THR CA C sing N N 382 THR CA CB sing N N 383 THR CA HA sing N N 384 THR C O doub N N 385 THR C OXT sing N N 386 THR CB OG1 sing N N 387 THR CB CG2 sing N N 388 THR CB HB sing N N 389 THR OG1 HG1 sing N N 390 THR CG2 HG21 sing N N 391 THR CG2 HG22 sing N N 392 THR CG2 HG23 sing N N 393 THR OXT HXT sing N N 394 TRP N CA sing N N 395 TRP N H sing N N 396 TRP N H2 sing N N 397 TRP CA C sing N N 398 TRP CA CB sing N N 399 TRP CA HA sing N N 400 TRP C O doub N N 401 TRP C OXT sing N N 402 TRP CB CG sing N N 403 TRP CB HB2 sing N N 404 TRP CB HB3 sing N N 405 TRP CG CD1 doub Y N 406 TRP CG CD2 sing Y N 407 TRP CD1 NE1 sing Y N 408 TRP CD1 HD1 sing N N 409 TRP CD2 CE2 doub Y N 410 TRP CD2 CE3 sing Y N 411 TRP NE1 CE2 sing Y N 412 TRP NE1 HE1 sing N N 413 TRP CE2 CZ2 sing Y N 414 TRP CE3 CZ3 doub Y N 415 TRP CE3 HE3 sing N N 416 TRP CZ2 CH2 doub Y N 417 TRP CZ2 HZ2 sing N N 418 TRP CZ3 CH2 sing Y N 419 TRP CZ3 HZ3 sing N N 420 TRP CH2 HH2 sing N N 421 TRP OXT HXT sing N N 422 TYR N CA sing N N 423 TYR N H sing N N 424 TYR N H2 sing N N 425 TYR CA C sing N N 426 TYR CA CB sing N N 427 TYR CA HA sing N N 428 TYR C O doub N N 429 TYR C OXT sing N N 430 TYR CB CG sing N N 431 TYR CB HB2 sing N N 432 TYR CB HB3 sing N N 433 TYR CG CD1 doub Y N 434 TYR CG CD2 sing Y N 435 TYR CD1 CE1 sing Y N 436 TYR CD1 HD1 sing N N 437 TYR CD2 CE2 doub Y N 438 TYR CD2 HD2 sing N N 439 TYR CE1 CZ doub Y N 440 TYR CE1 HE1 sing N N 441 TYR CE2 CZ sing Y N 442 TYR CE2 HE2 sing N N 443 TYR CZ OH sing N N 444 TYR OH HH sing N N 445 TYR OXT HXT sing N N 446 VAL N CA sing N N 447 VAL N H sing N N 448 VAL N H2 sing N N 449 VAL CA C sing N N 450 VAL CA CB sing N N 451 VAL CA HA sing N N 452 VAL C O doub N N 453 VAL C OXT sing N N 454 VAL CB CG1 sing N N 455 VAL CB CG2 sing N N 456 VAL CB HB sing N N 457 VAL CG1 HG11 sing N N 458 VAL CG1 HG12 sing N N 459 VAL CG1 HG13 sing N N 460 VAL CG2 HG21 sing N N 461 VAL CG2 HG22 sing N N 462 VAL CG2 HG23 sing N N 463 VAL OXT HXT sing N N 464 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Helmholtz Association' Germany FISCOV 1 'Helmholtz Association' Germany FISVIR 2 'Helmholtz Association' Germany SFragX 3 'Helmholtz Association' Germany InternLabs-0011-HIR3X 4 'German Federal Ministry for Education and Research' Germany 13K22CHB 5 'German Federal Ministry for Education and Research' Germany 16GW0277 6 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4miw _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 43 21 2' _space_group.name_Hall 'P 4nw 2abw' _space_group.IT_number 96 _space_group.crystal_system tetragonal _space_group.id 1 # _atom_sites.entry_id 28UC _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.017056 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017056 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007376 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? F ? ? 4.90428 4.07044 ? ? 12.99538 1.63651 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MG ? ? ? ? ? ? ? ? ? ? ? ? ? MG2+ ? ? 9.95820 ? ? ? 3.10187 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O1- ? ? 5.12366 3.84317 ? ? 3.49406 27.47979 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #