data_28IU # _entry.id 28IU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.416 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 28IU pdb_000028iu 10.2210/pdb28iu/pdb WWPDB D_1292151972 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-07-15 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 28IU _pdbx_database_status.recvd_initial_deposition_date 2026-02-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 28IO PDB . unspecified 28IP PDB . unspecified 28IQ PDB . unspecified 28IR PDB . unspecified 28IS PDB . unspecified 28IT PDB . unspecified 28IV PDB . unspecified 28IW PDB . unspecified 28IX PDB . unspecified 28LL PDB . unspecified 28LM PDB . # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 laurent.maveyraud@ipbs.fr Laurent Maveyraud ? 'principal investigator/group leader' 0000-0003-4610-8319 3 lionel.mourey@ipbs.fr Lionel Mourey ? 'principal investigator/group leader' 0000-0002-8259-1259 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Tamhaev, R.' 1 0009-0003-9101-7042 'Lherbet, C.' 2 0000-0001-5427-5040 'Azema-Despeyroux, J.' 3 ? 'Mourey, L.' 4 0000-0002-8259-1259 'Maveyraud, L.' 5 0000-0003-4610-8319 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Rational Design of Diaryl Ether-Based Dual Inhibitors Targeting Successive Essential Enzymes HadAB and InhA in Mycobacterium tuberculosis. ; _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.6c01302 _citation.pdbx_database_id_PubMed 42415474 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tamhaev, R.' 1 ? primary 'Recchia, D.' 2 ? primary 'Zahorszka, M.' 3 ? primary 'Stelitano, G.' 4 ? primary 'Chiarelli, L.R.' 5 0000-0003-0348-9764 primary 'Rizet, J.' 6 ? primary 'Rima, J.' 7 ? primary 'Chebaiki, M.' 8 ? primary 'Valentin, L.' 9 ? primary 'Azema-Despeyroux, J.' 10 ? primary 'Hoffmann, P.' 11 ? primary 'Preuilh, N.' 12 ? primary 'Dumais, B.' 13 ? primary 'Britton, S.' 14 0000-0002-7008-5316 primary 'Degiacomi, G.' 15 ? primary 'Maveyraud, L.' 16 0000-0003-4610-8319 primary 'Kordulakova, J.' 17 ? primary 'Pasca, M.R.' 18 0000-0002-8906-4937 primary 'Mourey, L.' 19 0000-0002-8259-1259 primary 'Lherbet, C.' 20 0000-0001-5427-5040 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Enoyl-[acyl-carrier-protein] reductase [NADH]' 28837.057 1 1.3.1.9 ? ? ? 2 non-polymer syn NICOTINAMIDE-ADENINE-DINUCLEOTIDE 663.425 1 ? ? ? ? 3 non-polymer syn '(E)-2-(4-(4-((4-cyclopropyl-1H-1,2,3-triazol-1-yl)methyl)-2-hydroxyphenoxy)-3-fluorobenzylidene)hydrazine-1-carbothioamide' 426.467 1 ? ? ? ? 4 water nat water 18.015 58 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ENR,Enoyl-ACP reductase,FAS-II enoyl-ACP reductase,NADH-dependent 2-trans-enoyl-ACP reductase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMTGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPLLELDVQNEEHLASLAGR VTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNPGGSIVGMDFDPSRAMPA YNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIVGGALGEEAGAQIQLLEEGWDQRAPIGWNMKDATP VAKTVCALLSDWLPATTGDIIYADGGAHTQLL ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMTGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPLLELDVQNEEHLASLAGR VTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNPGGSIVGMDFDPSRAMPA YNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIVGGALGEEAGAQIQLLEEGWDQRAPIGWNMKDATP VAKTVCALLSDWLPATTGDIIYADGGAHTQLL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 NICOTINAMIDE-ADENINE-DINUCLEOTIDE NAD 3 '(E)-2-(4-(4-((4-cyclopropyl-1H-1,2,3-triazol-1-yl)methyl)-2-hydroxyphenoxy)-3-fluorobenzylidene)hydrazine-1-carbothioamide' A1JZC 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 THR n 1 6 GLY n 1 7 LEU n 1 8 LEU n 1 9 ASP n 1 10 GLY n 1 11 LYS n 1 12 ARG n 1 13 ILE n 1 14 LEU n 1 15 VAL n 1 16 SER n 1 17 GLY n 1 18 ILE n 1 19 ILE n 1 20 THR n 1 21 ASP n 1 22 SER n 1 23 SER n 1 24 ILE n 1 25 ALA n 1 26 PHE n 1 27 HIS n 1 28 ILE n 1 29 ALA n 1 30 ARG n 1 31 VAL n 1 32 ALA n 1 33 GLN n 1 34 GLU n 1 35 GLN n 1 36 GLY n 1 37 ALA n 1 38 GLN n 1 39 LEU n 1 40 VAL n 1 41 LEU n 1 42 THR n 1 43 GLY n 1 44 PHE n 1 45 ASP n 1 46 ARG n 1 47 LEU n 1 48 ARG n 1 49 LEU n 1 50 ILE n 1 51 GLN n 1 52 ARG n 1 53 ILE n 1 54 THR n 1 55 ASP n 1 56 ARG n 1 57 LEU n 1 58 PRO n 1 59 ALA n 1 60 LYS n 1 61 ALA n 1 62 PRO n 1 63 LEU n 1 64 LEU n 1 65 GLU n 1 66 LEU n 1 67 ASP n 1 68 VAL n 1 69 GLN n 1 70 ASN n 1 71 GLU n 1 72 GLU n 1 73 HIS n 1 74 LEU n 1 75 ALA n 1 76 SER n 1 77 LEU n 1 78 ALA n 1 79 GLY n 1 80 ARG n 1 81 VAL n 1 82 THR n 1 83 GLU n 1 84 ALA n 1 85 ILE n 1 86 GLY n 1 87 ALA n 1 88 GLY n 1 89 ASN n 1 90 LYS n 1 91 LEU n 1 92 ASP n 1 93 GLY n 1 94 VAL n 1 95 VAL n 1 96 HIS n 1 97 SER n 1 98 ILE n 1 99 GLY n 1 100 PHE n 1 101 MET n 1 102 PRO n 1 103 GLN n 1 104 THR n 1 105 GLY n 1 106 MET n 1 107 GLY n 1 108 ILE n 1 109 ASN n 1 110 PRO n 1 111 PHE n 1 112 PHE n 1 113 ASP n 1 114 ALA n 1 115 PRO n 1 116 TYR n 1 117 ALA n 1 118 ASP n 1 119 VAL n 1 120 SER n 1 121 LYS n 1 122 GLY n 1 123 ILE n 1 124 HIS n 1 125 ILE n 1 126 SER n 1 127 ALA n 1 128 TYR n 1 129 SER n 1 130 TYR n 1 131 ALA n 1 132 SER n 1 133 MET n 1 134 ALA n 1 135 LYS n 1 136 ALA n 1 137 LEU n 1 138 LEU n 1 139 PRO n 1 140 ILE n 1 141 MET n 1 142 ASN n 1 143 PRO n 1 144 GLY n 1 145 GLY n 1 146 SER n 1 147 ILE n 1 148 VAL n 1 149 GLY n 1 150 MET n 1 151 ASP n 1 152 PHE n 1 153 ASP n 1 154 PRO n 1 155 SER n 1 156 ARG n 1 157 ALA n 1 158 MET n 1 159 PRO n 1 160 ALA n 1 161 TYR n 1 162 ASN n 1 163 TRP n 1 164 MET n 1 165 THR n 1 166 VAL n 1 167 ALA n 1 168 LYS n 1 169 SER n 1 170 ALA n 1 171 LEU n 1 172 GLU n 1 173 SER n 1 174 VAL n 1 175 ASN n 1 176 ARG n 1 177 PHE n 1 178 VAL n 1 179 ALA n 1 180 ARG n 1 181 GLU n 1 182 ALA n 1 183 GLY n 1 184 LYS n 1 185 TYR n 1 186 GLY n 1 187 VAL n 1 188 ARG n 1 189 SER n 1 190 ASN n 1 191 LEU n 1 192 VAL n 1 193 ALA n 1 194 ALA n 1 195 GLY n 1 196 PRO n 1 197 ILE n 1 198 ARG n 1 199 THR n 1 200 LEU n 1 201 ALA n 1 202 MET n 1 203 SER n 1 204 ALA n 1 205 ILE n 1 206 VAL n 1 207 GLY n 1 208 GLY n 1 209 ALA n 1 210 LEU n 1 211 GLY n 1 212 GLU n 1 213 GLU n 1 214 ALA n 1 215 GLY n 1 216 ALA n 1 217 GLN n 1 218 ILE n 1 219 GLN n 1 220 LEU n 1 221 LEU n 1 222 GLU n 1 223 GLU n 1 224 GLY n 1 225 TRP n 1 226 ASP n 1 227 GLN n 1 228 ARG n 1 229 ALA n 1 230 PRO n 1 231 ILE n 1 232 GLY n 1 233 TRP n 1 234 ASN n 1 235 MET n 1 236 LYS n 1 237 ASP n 1 238 ALA n 1 239 THR n 1 240 PRO n 1 241 VAL n 1 242 ALA n 1 243 LYS n 1 244 THR n 1 245 VAL n 1 246 CYS n 1 247 ALA n 1 248 LEU n 1 249 LEU n 1 250 SER n 1 251 ASP n 1 252 TRP n 1 253 LEU n 1 254 PRO n 1 255 ALA n 1 256 THR n 1 257 THR n 1 258 GLY n 1 259 ASP n 1 260 ILE n 1 261 ILE n 1 262 TYR n 1 263 ALA n 1 264 ASP n 1 265 GLY n 1 266 GLY n 1 267 ALA n 1 268 HIS n 1 269 THR n 1 270 GLN n 1 271 LEU n 1 272 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 272 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'inhA, Rv1484, MTCY277.05' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1773 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1JZC non-polymer . '(E)-2-(4-(4-((4-cyclopropyl-1H-1,2,3-triazol-1-yl)methyl)-2-hydroxyphenoxy)-3-fluorobenzylidene)hydrazine-1-carbothioamide' '1-[({E})-[4-[4-[(4-cyclopropyl-1,2,3-triazol-1-yl)methyl]-2-oxidanyl-phenoxy]-3-fluoranyl-phenyl]methylideneamino]thiourea' 'C20 H19 F N6 O2 S' 426.467 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAD non-polymer . NICOTINAMIDE-ADENINE-DINUCLEOTIDE ? 'C21 H27 N7 O14 P2' 663.425 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 SER 2 -1 ? ? ? A . n A 1 3 HIS 3 0 ? ? ? A . n A 1 4 MET 4 1 ? ? ? A . n A 1 5 THR 5 2 ? ? ? A . n A 1 6 GLY 6 3 3 GLY GLY A . n A 1 7 LEU 7 4 4 LEU LEU A . n A 1 8 LEU 8 5 5 LEU LEU A . n A 1 9 ASP 9 6 6 ASP ASP A . n A 1 10 GLY 10 7 7 GLY GLY A . n A 1 11 LYS 11 8 8 LYS LYS A . n A 1 12 ARG 12 9 9 ARG ARG A . n A 1 13 ILE 13 10 10 ILE ILE A . n A 1 14 LEU 14 11 11 LEU LEU A . n A 1 15 VAL 15 12 12 VAL VAL A . n A 1 16 SER 16 13 13 SER SER A . n A 1 17 GLY 17 14 14 GLY GLY A . n A 1 18 ILE 18 15 15 ILE ILE A . n A 1 19 ILE 19 16 16 ILE ILE A . n A 1 20 THR 20 17 17 THR THR A . n A 1 21 ASP 21 18 18 ASP ASP A . n A 1 22 SER 22 19 19 SER SER A . n A 1 23 SER 23 20 20 SER SER A . n A 1 24 ILE 24 21 21 ILE ILE A . n A 1 25 ALA 25 22 22 ALA ALA A . n A 1 26 PHE 26 23 23 PHE PHE A . n A 1 27 HIS 27 24 24 HIS HIS A . n A 1 28 ILE 28 25 25 ILE ILE A . n A 1 29 ALA 29 26 26 ALA ALA A . n A 1 30 ARG 30 27 27 ARG ARG A . n A 1 31 VAL 31 28 28 VAL VAL A . n A 1 32 ALA 32 29 29 ALA ALA A . n A 1 33 GLN 33 30 30 GLN GLN A . n A 1 34 GLU 34 31 31 GLU GLU A . n A 1 35 GLN 35 32 32 GLN GLN A . n A 1 36 GLY 36 33 33 GLY GLY A . n A 1 37 ALA 37 34 34 ALA ALA A . n A 1 38 GLN 38 35 35 GLN GLN A . n A 1 39 LEU 39 36 36 LEU LEU A . n A 1 40 VAL 40 37 37 VAL VAL A . n A 1 41 LEU 41 38 38 LEU LEU A . n A 1 42 THR 42 39 39 THR THR A . n A 1 43 GLY 43 40 40 GLY GLY A . n A 1 44 PHE 44 41 41 PHE PHE A . n A 1 45 ASP 45 42 42 ASP ASP A . n A 1 46 ARG 46 43 43 ARG ARG A . n A 1 47 LEU 47 44 44 LEU LEU A . n A 1 48 ARG 48 45 45 ARG ARG A . n A 1 49 LEU 49 46 46 LEU LEU A . n A 1 50 ILE 50 47 47 ILE ILE A . n A 1 51 GLN 51 48 48 GLN GLN A . n A 1 52 ARG 52 49 49 ARG ARG A . n A 1 53 ILE 53 50 50 ILE ILE A . n A 1 54 THR 54 51 51 THR THR A . n A 1 55 ASP 55 52 52 ASP ASP A . n A 1 56 ARG 56 53 53 ARG ARG A . n A 1 57 LEU 57 54 54 LEU LEU A . n A 1 58 PRO 58 55 55 PRO PRO A . n A 1 59 ALA 59 56 56 ALA ALA A . n A 1 60 LYS 60 57 57 LYS LYS A . n A 1 61 ALA 61 58 58 ALA ALA A . n A 1 62 PRO 62 59 59 PRO PRO A . n A 1 63 LEU 63 60 60 LEU LEU A . n A 1 64 LEU 64 61 61 LEU LEU A . n A 1 65 GLU 65 62 62 GLU GLU A . n A 1 66 LEU 66 63 63 LEU LEU A . n A 1 67 ASP 67 64 64 ASP ASP A . n A 1 68 VAL 68 65 65 VAL VAL A . n A 1 69 GLN 69 66 66 GLN GLN A . n A 1 70 ASN 70 67 67 ASN ASN A . n A 1 71 GLU 71 68 68 GLU GLU A . n A 1 72 GLU 72 69 69 GLU GLU A . n A 1 73 HIS 73 70 70 HIS HIS A . n A 1 74 LEU 74 71 71 LEU LEU A . n A 1 75 ALA 75 72 72 ALA ALA A . n A 1 76 SER 76 73 73 SER SER A . n A 1 77 LEU 77 74 74 LEU LEU A . n A 1 78 ALA 78 75 75 ALA ALA A . n A 1 79 GLY 79 76 76 GLY GLY A . n A 1 80 ARG 80 77 77 ARG ARG A . n A 1 81 VAL 81 78 78 VAL VAL A . n A 1 82 THR 82 79 79 THR THR A . n A 1 83 GLU 83 80 80 GLU GLU A . n A 1 84 ALA 84 81 81 ALA ALA A . n A 1 85 ILE 85 82 82 ILE ILE A . n A 1 86 GLY 86 83 83 GLY GLY A . n A 1 87 ALA 87 84 84 ALA ALA A . n A 1 88 GLY 88 85 85 GLY GLY A . n A 1 89 ASN 89 86 86 ASN ASN A . n A 1 90 LYS 90 87 87 LYS LYS A . n A 1 91 LEU 91 88 88 LEU LEU A . n A 1 92 ASP 92 89 89 ASP ASP A . n A 1 93 GLY 93 90 90 GLY GLY A . n A 1 94 VAL 94 91 91 VAL VAL A . n A 1 95 VAL 95 92 92 VAL VAL A . n A 1 96 HIS 96 93 93 HIS HIS A . n A 1 97 SER 97 94 94 SER SER A . n A 1 98 ILE 98 95 95 ILE ILE A . n A 1 99 GLY 99 96 96 GLY GLY A . n A 1 100 PHE 100 97 97 PHE PHE A . n A 1 101 MET 101 98 98 MET MET A . n A 1 102 PRO 102 99 99 PRO PRO A . n A 1 103 GLN 103 100 100 GLN GLN A . n A 1 104 THR 104 101 101 THR THR A . n A 1 105 GLY 105 102 102 GLY GLY A . n A 1 106 MET 106 103 103 MET MET A . n A 1 107 GLY 107 104 104 GLY GLY A . n A 1 108 ILE 108 105 105 ILE ILE A . n A 1 109 ASN 109 106 106 ASN ASN A . n A 1 110 PRO 110 107 107 PRO PRO A . n A 1 111 PHE 111 108 108 PHE PHE A . n A 1 112 PHE 112 109 109 PHE PHE A . n A 1 113 ASP 113 110 110 ASP ASP A . n A 1 114 ALA 114 111 111 ALA ALA A . n A 1 115 PRO 115 112 112 PRO PRO A . n A 1 116 TYR 116 113 113 TYR TYR A . n A 1 117 ALA 117 114 114 ALA ALA A . n A 1 118 ASP 118 115 115 ASP ASP A . n A 1 119 VAL 119 116 116 VAL VAL A . n A 1 120 SER 120 117 117 SER SER A . n A 1 121 LYS 121 118 118 LYS LYS A . n A 1 122 GLY 122 119 119 GLY GLY A . n A 1 123 ILE 123 120 120 ILE ILE A . n A 1 124 HIS 124 121 121 HIS HIS A . n A 1 125 ILE 125 122 122 ILE ILE A . n A 1 126 SER 126 123 123 SER SER A . n A 1 127 ALA 127 124 124 ALA ALA A . n A 1 128 TYR 128 125 125 TYR TYR A . n A 1 129 SER 129 126 126 SER SER A . n A 1 130 TYR 130 127 127 TYR TYR A . n A 1 131 ALA 131 128 128 ALA ALA A . n A 1 132 SER 132 129 129 SER SER A . n A 1 133 MET 133 130 130 MET MET A . n A 1 134 ALA 134 131 131 ALA ALA A . n A 1 135 LYS 135 132 132 LYS LYS A . n A 1 136 ALA 136 133 133 ALA ALA A . n A 1 137 LEU 137 134 134 LEU LEU A . n A 1 138 LEU 138 135 135 LEU LEU A . n A 1 139 PRO 139 136 136 PRO PRO A . n A 1 140 ILE 140 137 137 ILE ILE A . n A 1 141 MET 141 138 138 MET MET A . n A 1 142 ASN 142 139 139 ASN ASN A . n A 1 143 PRO 143 140 140 PRO PRO A . n A 1 144 GLY 144 141 141 GLY GLY A . n A 1 145 GLY 145 142 142 GLY GLY A . n A 1 146 SER 146 143 143 SER SER A . n A 1 147 ILE 147 144 144 ILE ILE A . n A 1 148 VAL 148 145 145 VAL VAL A . n A 1 149 GLY 149 146 146 GLY GLY A . n A 1 150 MET 150 147 147 MET MET A . n A 1 151 ASP 151 148 148 ASP ASP A . n A 1 152 PHE 152 149 149 PHE PHE A . n A 1 153 ASP 153 150 150 ASP ASP A . n A 1 154 PRO 154 151 151 PRO PRO A . n A 1 155 SER 155 152 152 SER SER A . n A 1 156 ARG 156 153 153 ARG ARG A . n A 1 157 ALA 157 154 154 ALA ALA A . n A 1 158 MET 158 155 155 MET MET A . n A 1 159 PRO 159 156 156 PRO PRO A . n A 1 160 ALA 160 157 157 ALA ALA A . n A 1 161 TYR 161 158 158 TYR TYR A . n A 1 162 ASN 162 159 159 ASN ASN A . n A 1 163 TRP 163 160 160 TRP TRP A . n A 1 164 MET 164 161 161 MET MET A . n A 1 165 THR 165 162 162 THR THR A . n A 1 166 VAL 166 163 163 VAL VAL A . n A 1 167 ALA 167 164 164 ALA ALA A . n A 1 168 LYS 168 165 165 LYS LYS A . n A 1 169 SER 169 166 166 SER SER A . n A 1 170 ALA 170 167 167 ALA ALA A . n A 1 171 LEU 171 168 168 LEU LEU A . n A 1 172 GLU 172 169 169 GLU GLU A . n A 1 173 SER 173 170 170 SER SER A . n A 1 174 VAL 174 171 171 VAL VAL A . n A 1 175 ASN 175 172 172 ASN ASN A . n A 1 176 ARG 176 173 173 ARG ARG A . n A 1 177 PHE 177 174 174 PHE PHE A . n A 1 178 VAL 178 175 175 VAL VAL A . n A 1 179 ALA 179 176 176 ALA ALA A . n A 1 180 ARG 180 177 177 ARG ARG A . n A 1 181 GLU 181 178 178 GLU GLU A . n A 1 182 ALA 182 179 179 ALA ALA A . n A 1 183 GLY 183 180 180 GLY GLY A . n A 1 184 LYS 184 181 181 LYS LYS A . n A 1 185 TYR 185 182 182 TYR TYR A . n A 1 186 GLY 186 183 183 GLY GLY A . n A 1 187 VAL 187 184 184 VAL VAL A . n A 1 188 ARG 188 185 185 ARG ARG A . n A 1 189 SER 189 186 186 SER SER A . n A 1 190 ASN 190 187 187 ASN ASN A . n A 1 191 LEU 191 188 188 LEU LEU A . n A 1 192 VAL 192 189 189 VAL VAL A . n A 1 193 ALA 193 190 190 ALA ALA A . n A 1 194 ALA 194 191 191 ALA ALA A . n A 1 195 GLY 195 192 192 GLY GLY A . n A 1 196 PRO 196 193 193 PRO PRO A . n A 1 197 ILE 197 194 194 ILE ILE A . n A 1 198 ARG 198 195 195 ARG ARG A . n A 1 199 THR 199 196 196 THR THR A . n A 1 200 LEU 200 197 197 LEU LEU A . n A 1 201 ALA 201 198 198 ALA ALA A . n A 1 202 MET 202 199 199 MET MET A . n A 1 203 SER 203 200 200 SER SER A . n A 1 204 ALA 204 201 201 ALA ALA A . n A 1 205 ILE 205 202 202 ILE ILE A . n A 1 206 VAL 206 203 203 VAL VAL A . n A 1 207 GLY 207 204 204 GLY GLY A . n A 1 208 GLY 208 205 205 GLY GLY A . n A 1 209 ALA 209 206 206 ALA ALA A . n A 1 210 LEU 210 207 207 LEU LEU A . n A 1 211 GLY 211 208 208 GLY GLY A . n A 1 212 GLU 212 209 209 GLU GLU A . n A 1 213 GLU 213 210 210 GLU GLU A . n A 1 214 ALA 214 211 211 ALA ALA A . n A 1 215 GLY 215 212 212 GLY GLY A . n A 1 216 ALA 216 213 213 ALA ALA A . n A 1 217 GLN 217 214 214 GLN GLN A . n A 1 218 ILE 218 215 215 ILE ILE A . n A 1 219 GLN 219 216 216 GLN GLN A . n A 1 220 LEU 220 217 217 LEU LEU A . n A 1 221 LEU 221 218 218 LEU LEU A . n A 1 222 GLU 222 219 219 GLU GLU A . n A 1 223 GLU 223 220 220 GLU GLU A . n A 1 224 GLY 224 221 221 GLY GLY A . n A 1 225 TRP 225 222 222 TRP TRP A . n A 1 226 ASP 226 223 223 ASP ASP A . n A 1 227 GLN 227 224 224 GLN GLN A . n A 1 228 ARG 228 225 225 ARG ARG A . n A 1 229 ALA 229 226 226 ALA ALA A . n A 1 230 PRO 230 227 227 PRO PRO A . n A 1 231 ILE 231 228 228 ILE ILE A . n A 1 232 GLY 232 229 229 GLY GLY A . n A 1 233 TRP 233 230 230 TRP TRP A . n A 1 234 ASN 234 231 231 ASN ASN A . n A 1 235 MET 235 232 232 MET MET A . n A 1 236 LYS 236 233 233 LYS LYS A . n A 1 237 ASP 237 234 234 ASP ASP A . n A 1 238 ALA 238 235 235 ALA ALA A . n A 1 239 THR 239 236 236 THR THR A . n A 1 240 PRO 240 237 237 PRO PRO A . n A 1 241 VAL 241 238 238 VAL VAL A . n A 1 242 ALA 242 239 239 ALA ALA A . n A 1 243 LYS 243 240 240 LYS LYS A . n A 1 244 THR 244 241 241 THR THR A . n A 1 245 VAL 245 242 242 VAL VAL A . n A 1 246 CYS 246 243 243 CYS CYS A . n A 1 247 ALA 247 244 244 ALA ALA A . n A 1 248 LEU 248 245 245 LEU LEU A . n A 1 249 LEU 249 246 246 LEU LEU A . n A 1 250 SER 250 247 247 SER SER A . n A 1 251 ASP 251 248 248 ASP ASP A . n A 1 252 TRP 252 249 249 TRP TRP A . n A 1 253 LEU 253 250 250 LEU LEU A . n A 1 254 PRO 254 251 251 PRO PRO A . n A 1 255 ALA 255 252 252 ALA ALA A . n A 1 256 THR 256 253 253 THR THR A . n A 1 257 THR 257 254 254 THR THR A . n A 1 258 GLY 258 255 255 GLY GLY A . n A 1 259 ASP 259 256 256 ASP ASP A . n A 1 260 ILE 260 257 257 ILE ILE A . n A 1 261 ILE 261 258 258 ILE ILE A . n A 1 262 TYR 262 259 259 TYR TYR A . n A 1 263 ALA 263 260 260 ALA ALA A . n A 1 264 ASP 264 261 261 ASP ASP A . n A 1 265 GLY 265 262 262 GLY GLY A . n A 1 266 GLY 266 263 263 GLY GLY A . n A 1 267 ALA 267 264 264 ALA ALA A . n A 1 268 HIS 268 265 265 HIS HIS A . n A 1 269 THR 269 266 266 THR THR A . n A 1 270 GLN 270 267 267 GLN GLN A . n A 1 271 LEU 271 268 268 LEU LEU A . n A 1 272 LEU 272 269 269 LEU LEU A . n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 A1JZC ? ? A1JZC ? ? 'SUBJECT OF INVESTIGATION' ? 2 NAD ? ? NAD ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NAD 1 301 301 NAD NAD A . C 3 A1JZC 1 302 302 A1JZC LIG A . D 4 HOH 1 401 36 HOH HOH A . D 4 HOH 2 402 33 HOH HOH A . D 4 HOH 3 403 17 HOH HOH A . D 4 HOH 4 404 43 HOH HOH A . D 4 HOH 5 405 4 HOH HOH A . D 4 HOH 6 406 8 HOH HOH A . D 4 HOH 7 407 10 HOH HOH A . D 4 HOH 8 408 54 HOH HOH A . D 4 HOH 9 409 25 HOH HOH A . D 4 HOH 10 410 14 HOH HOH A . D 4 HOH 11 411 16 HOH HOH A . D 4 HOH 12 412 55 HOH HOH A . D 4 HOH 13 413 52 HOH HOH A . D 4 HOH 14 414 15 HOH HOH A . D 4 HOH 15 415 20 HOH HOH A . D 4 HOH 16 416 1 HOH HOH A . D 4 HOH 17 417 41 HOH HOH A . D 4 HOH 18 418 13 HOH HOH A . D 4 HOH 19 419 2 HOH HOH A . D 4 HOH 20 420 12 HOH HOH A . D 4 HOH 21 421 9 HOH HOH A . D 4 HOH 22 422 5 HOH HOH A . D 4 HOH 23 423 7 HOH HOH A . D 4 HOH 24 424 6 HOH HOH A . D 4 HOH 25 425 29 HOH HOH A . D 4 HOH 26 426 3 HOH HOH A . D 4 HOH 27 427 27 HOH HOH A . D 4 HOH 28 428 47 HOH HOH A . D 4 HOH 29 429 18 HOH HOH A . D 4 HOH 30 430 53 HOH HOH A . D 4 HOH 31 431 19 HOH HOH A . D 4 HOH 32 432 34 HOH HOH A . D 4 HOH 33 433 40 HOH HOH A . D 4 HOH 34 434 42 HOH HOH A . D 4 HOH 35 435 38 HOH HOH A . D 4 HOH 36 436 30 HOH HOH A . D 4 HOH 37 437 51 HOH HOH A . D 4 HOH 38 438 22 HOH HOH A . D 4 HOH 39 439 28 HOH HOH A . D 4 HOH 40 440 46 HOH HOH A . D 4 HOH 41 441 32 HOH HOH A . D 4 HOH 42 442 21 HOH HOH A . D 4 HOH 43 443 49 HOH HOH A . D 4 HOH 44 444 50 HOH HOH A . D 4 HOH 45 445 11 HOH HOH A . D 4 HOH 46 446 39 HOH HOH A . D 4 HOH 47 447 48 HOH HOH A . D 4 HOH 48 448 24 HOH HOH A . D 4 HOH 49 449 31 HOH HOH A . D 4 HOH 50 450 23 HOH HOH A . D 4 HOH 51 451 35 HOH HOH A . D 4 HOH 52 452 37 HOH HOH A . D 4 HOH 53 453 26 HOH HOH A . D 4 HOH 54 454 56 HOH HOH A . D 4 HOH 55 455 44 HOH HOH A . D 4 HOH 56 456 58 HOH HOH A . D 4 HOH 57 457 45 HOH HOH A . D 4 HOH 58 458 57 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 48 ? CG ? A GLN 51 CG 2 1 Y 1 A GLN 48 ? CD ? A GLN 51 CD 3 1 Y 1 A GLN 48 ? OE1 ? A GLN 51 OE1 4 1 Y 1 A GLN 48 ? NE2 ? A GLN 51 NE2 5 1 Y 1 A ARG 49 ? CG ? A ARG 52 CG 6 1 Y 1 A ARG 49 ? CD ? A ARG 52 CD 7 1 Y 1 A ARG 49 ? NE ? A ARG 52 NE 8 1 Y 1 A ARG 49 ? CZ ? A ARG 52 CZ 9 1 Y 1 A ARG 49 ? NH1 ? A ARG 52 NH1 10 1 Y 1 A ARG 49 ? NH2 ? A ARG 52 NH2 11 1 Y 1 A LYS 57 ? CG ? A LYS 60 CG 12 1 Y 1 A LYS 57 ? CD ? A LYS 60 CD 13 1 Y 1 A LYS 57 ? CE ? A LYS 60 CE 14 1 Y 1 A LYS 57 ? NZ ? A LYS 60 NZ 15 1 Y 1 A GLN 100 ? CG ? A GLN 103 CG 16 1 Y 1 A GLN 100 ? CD ? A GLN 103 CD 17 1 Y 1 A GLN 100 ? OE1 ? A GLN 103 OE1 18 1 Y 1 A GLN 100 ? NE2 ? A GLN 103 NE2 19 1 Y 1 A ILE 105 ? CD1 ? A ILE 108 CD1 20 1 Y 1 A ARG 195 ? CD ? A ARG 198 CD 21 1 Y 1 A ARG 195 ? NE ? A ARG 198 NE 22 1 Y 1 A ARG 195 ? CZ ? A ARG 198 CZ 23 1 Y 1 A ARG 195 ? NH1 ? A ARG 198 NH1 24 1 Y 1 A ARG 195 ? NH2 ? A ARG 198 NH2 25 1 Y 1 A LYS 233 ? CD ? A LYS 236 CD 26 1 Y 1 A LYS 233 ? CE ? A LYS 236 CE 27 1 Y 1 A LYS 233 ? NZ ? A LYS 236 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.10.4 ? 1 ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? '1.0.5 20230726' ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.8.2 ? 3 ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? TRUNCATE ? ? ? 9.0.003 ? 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . ? 5 ? phasing ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? . ? 6 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 7 # _cell.angle_alpha 90 _cell.angle_alpha_esd ? _cell.angle_beta 90 _cell.angle_beta_esd ? _cell.angle_gamma 90 _cell.angle_gamma_esd ? _cell.entry_id 28IU _cell.details ? _cell.formula_units_Z ? _cell.length_a 91.657 _cell.length_a_esd ? _cell.length_b 91.657 _cell.length_b_esd ? _cell.length_c 185.386 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 28IU _symmetry.cell_setting ? _symmetry.Int_Tables_number 98 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 28IU _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.38 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 63.56 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;PEG 4000 14 % (w/v) ADA buffer 0.1 M Ammonium Acetate 0.1 M DMSO 5 % (v/v) NAD+ 1.4 mM Compound 2.5 mM ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-09-13 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.65004 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALBA BEAMLINE XALOC' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.65004 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline XALOC _diffrn_source.pdbx_synchrotron_site ALBA # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 28IU _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.547 _reflns.d_resolution_low 82.163 _reflns.details ;Some remarks regarding the mmCIF items written, the PDB Exchange Dictionary (PDBx/mmCIF) Version 5.0 supporting the data files in the current PDB archive (dictionary version 5.325, last updated 2020-04-13: http://mmcif.wwpdb.org/dictionaries/mmcif_pdbx_v50.dic/Index/) and the actual quantities provided by MRFANA (https://github.com/githubgphl/MRFANA) from the autoPROC package (https://www.globalphasing.com/autoproc/). In general, the mmCIF categories here should provide items that are currently used in the PDB archive. If there are alternatives, the one recommended by the PDB developers has been selected. The distinction between *_all and *_obs quantities is not always clear: often only one version is actively used within the PDB archive (or is the one recommended by PDB developers). The intention of distinguishing between classes of reflections before and after some kind of observation criterion was applied, can in principle be useful - but such criteria change in various ways throughout the data processing steps (rejection of overloaded or too partial reflections, outlier/misfit rejections during scaling etc) and there is no retrospect computation of data scaling/merging statistics for the reflections used in the final refinement (where another observation criterion might have been applied). Typical data processing will usually only provide one version of statistics at various stages and these are given in the recommended item here, irrespective of the "_all" and "_obs" connotation, see e.g. the use of _reflns.pdbx_Rmerge_I_obs, _reflns.pdbx_Rrim_I_all and _reflns.pdbx_Rpim_I_all. Please note that all statistics related to "merged intensities" (or "merging") are based on inverse-variance weighting of the individual measurements making up a symmetry-unique reflection. This is standard for several decades now, even if some of the dictionary definitions seem to suggest that a simple "mean" or "average" intensity is being used instead. R-values are always given for all symmetry-equivalent reflections following Friedel's law, i.e. Bijvoet pairs are not treated separately (since we want to describe the overall mean intensity and not the mean I(+) and I(-) here). The Rrim metric is identical to the Rmeas R-value and only differs in name. _reflns.pdbx_number_measured_all is the number of measured intensities just before the final merging step (at which point no additional rejection takes place). _reflns.number_obs is the number of symmetry-unique observations, i.e. the result of merging those measurements via inverse-variance weighting. _reflns.pdbx_netI_over_sigmaI is based on the merged intensities (_reflns.number_obs) as expected. _reflns.pdbx_redundancy is synonymous with "multiplicity". The per-shell item _reflns_shell.number_measured_all corresponds to the overall value _reflns.pdbx_number_measured_all. The per-shell item _reflns_shell.number_unique_all corresponds to the overall value _reflns.number_obs. The per-shell item _reflns_shell.percent_possible_all corresponds to the overall value _reflns.percent_possible_obs. The per-shell item _reflns_shell.meanI_over_sigI_obs corresponds to the overall value given as _reflns.pdbx_netI_over_sigmaI. But be aware of the incorrect definition of the former in the current dictionary! ; _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13335 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 15.81 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17.50 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.0994 _reflns.pdbx_Rpim_I_all 0.0240 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 210871 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.993 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.0962 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous 8.45 _reflns.pdbx_CC_half_anomalous 0.051 _reflns.pdbx_absDiff_over_sigma_anomalous 0.787 _reflns.pdbx_percent_possible_anomalous 99.9 _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 6.913 82.163 ? 42.82 11410 11410 ? 751 751 ? ? ? ? ? ? ? ? ? ? ? 15.19 ? ? ? 0.0672 0.0172 ? 1 ? 0.991 ? ? 99.6 ? 0.0646 ? ? ? ? ? 9.01 0.088 1.000 99.2 5.487 6.913 ? 37.14 10942 10942 ? 698 698 ? ? ? ? ? ? ? ? ? ? ? 15.68 ? ? ? 0.0607 0.0141 ? 2 ? 0.997 ? ? 100.0 ? 0.0589 ? ? ? ? ? 8.71 0.129 0.899 99.8 4.794 5.487 ? 37.63 11302 11302 ? 684 684 ? ? ? ? ? ? ? ? ? ? ? 16.52 ? ? ? 0.0638 0.0144 ? 3 ? 0.999 ? ? 99.9 ? 0.0621 ? ? ? ? ? 9.11 0.126 0.838 99.6 4.355 4.794 ? 37.92 11111 11111 ? 670 670 ? ? ? ? ? ? ? ? ? ? ? 16.58 ? ? ? 0.0603 0.0138 ? 4 ? 0.999 ? ? 100.0 ? 0.0586 ? ? ? ? ? 8.95 0.078 0.731 100.0 4.043 4.355 ? 34.07 11298 11298 ? 678 678 ? ? ? ? ? ? ? ? ? ? ? 16.66 ? ? ? 0.0668 0.0151 ? 5 ? 0.999 ? ? 99.9 ? 0.0649 ? ? ? ? ? 8.96 0.042 0.797 100.0 3.805 4.043 ? 27.85 10886 10886 ? 673 673 ? ? ? ? ? ? ? ? ? ? ? 16.18 ? ? ? 0.0824 0.0189 ? 6 ? 0.999 ? ? 100.0 ? 0.0800 ? ? ? ? ? 8.67 -0.101 0.782 100.0 3.614 3.805 ? 21.87 11106 11106 ? 663 663 ? ? ? ? ? ? ? ? ? ? ? 16.75 ? ? ? 0.1079 0.0246 ? 7 ? 0.998 ? ? 100.0 ? 0.1049 ? ? ? ? ? 8.92 -0.044 0.780 100.0 3.457 3.614 ? 20.10 11326 11326 ? 665 665 ? ? ? ? ? ? ? ? ? ? ? 17.03 ? ? ? 0.1168 0.0264 ? 8 ? 0.999 ? ? 100.0 ? 0.1136 ? ? ? ? ? 9.10 -0.056 0.797 99.8 3.324 3.457 ? 16.46 10407 10407 ? 655 655 ? ? ? ? ? ? ? ? ? ? ? 15.89 ? ? ? 0.1585 0.0380 ? 9 ? 0.996 ? ? 100.0 ? 0.1537 ? ? ? ? ? 8.46 0.019 0.812 100.0 3.209 3.324 ? 13.82 11116 11116 ? 666 666 ? ? ? ? ? ? ? ? ? ? ? 16.69 ? ? ? 0.1811 0.0427 ? 10 ? 0.998 ? ? 100.0 ? 0.1758 ? ? ? ? ? 8.85 0.005 0.786 100.0 3.109 3.209 ? 11.05 10510 10510 ? 661 661 ? ? ? ? ? ? ? ? ? ? ? 15.90 ? ? ? 0.2329 0.0564 ? 11 ? 0.995 ? ? 100.0 ? 0.2256 ? ? ? ? ? 8.38 -0.056 0.773 100.0 3.020 3.109 ? 8.17 10987 10987 ? 659 659 ? ? ? ? ? ? ? ? ? ? ? 16.67 ? ? ? 0.3426 0.0822 ? 12 ? 0.994 ? ? 100.0 ? 0.3321 ? ? ? ? ? 8.81 -0.082 0.713 100.0 2.941 3.020 ? 7.38 10894 10894 ? 653 653 ? ? ? ? ? ? ? ? ? ? ? 16.68 ? ? ? 0.3783 0.0901 ? 13 ? 0.981 ? ? 100.0 ? 0.3668 ? ? ? ? ? 8.84 -0.013 0.788 100.0 2.869 2.941 ? 6.38 11055 11055 ? 646 646 ? ? ? ? ? ? ? ? ? ? ? 17.11 ? ? ? 0.4339 0.1030 ? 14 ? 0.989 ? ? 100.0 ? 0.4208 ? ? ? ? ? 9.02 0.019 0.765 100.0 2.804 2.869 ? 5.18 10669 10669 ? 665 665 ? ? ? ? ? ? ? ? ? ? ? 16.04 ? ? ? 0.5444 0.1330 ? 15 ? 0.953 ? ? 100.0 ? 0.5272 ? ? ? ? ? 8.43 0.042 0.769 100.0 2.744 2.804 ? 3.99 10814 10814 ? 649 649 ? ? ? ? ? ? ? ? ? ? ? 16.66 ? ? ? 0.6941 0.1669 ? 16 ? 0.951 ? ? 100.0 ? 0.6727 ? ? ? ? ? 8.75 0.058 0.744 100.0 2.689 2.744 ? 3.47 10304 10304 ? 638 638 ? ? ? ? ? ? ? ? ? ? ? 16.15 ? ? ? 0.8280 0.2027 ? 17 ? 0.947 ? ? 100.0 ? 0.8015 ? ? ? ? ? 8.48 -0.035 0.763 100.0 2.638 2.689 ? 2.96 9224 9224 ? 662 662 ? ? ? ? ? ? ? ? ? ? ? 13.93 ? ? ? 0.8415 0.2216 ? 18 ? 0.920 ? ? 100.0 ? 0.8104 ? ? ? ? ? 7.25 0.045 0.753 100.0 2.591 2.638 ? 2.37 9158 9158 ? 659 659 ? ? ? ? ? ? ? ? ? ? ? 13.90 ? ? ? 1.1215 0.2968 ? 19 ? 0.851 ? ? 100.0 ? 1.0795 ? ? ? ? ? 7.27 0.037 0.756 100.0 2.547 2.591 ? 1.66 6352 6352 ? 640 640 ? ? ? ? ? ? ? ? ? ? ? 9.93 ? ? ? 1.3007 0.4009 ? 20 ? 0.909 ? ? 100.0 ? 1.2316 ? ? ? ? ? 5.19 -0.027 0.740 99.5 # _refine.aniso_B[1][1] -10.6485 _refine.aniso_B[1][2] 0 _refine.aniso_B[1][3] 0 _refine.aniso_B[2][2] -10.6485 _refine.aniso_B[2][3] 0 _refine.aniso_B[3][3] 21.297 _refine.B_iso_max ? _refine.B_iso_mean 83.17 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.919 _refine.correlation_coeff_Fo_to_Fc_free 0.93 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 28IU _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.547 _refine.ls_d_res_low 82.16 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13330 _refine.ls_number_reflns_R_free 679 _refine.ls_number_reflns_R_work 12651 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9 _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2029 _refine.ls_R_factor_R_free 0.2220 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2019 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.225 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.226 _refine.pdbx_overall_SU_R_Blow_DPI 0.355 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.339 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 28IU _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.31 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.547 _refine_hist.d_res_low 82.16 _refine_hist.number_atoms_solvent 58 _refine_hist.number_atoms_total 2094 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1962 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 74 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 2110 ? t_bond_d 2 ? HARMONIC 'X-RAY DIFFRACTION' ? 0.9 ? 2884 ? t_angle_deg 2 ? HARMONIC 'X-RAY DIFFRACTION' ? ? ? 710 ? t_dihedral_angle_d 2 ? SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? 377 ? t_gen_planes 5 ? HARMONIC 'X-RAY DIFFRACTION' ? ? ? 2110 ? t_it 10 ? HARMONIC 'X-RAY DIFFRACTION' ? ? ? 282 ? t_chiral_improper_torsion 5 ? SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? 3 ? t_sum_occupancies 1 ? HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1815 ? t_ideal_dist_contact 4 ? SEMIHARMONIC 'X-RAY DIFFRACTION' ? 2.96 ? ? ? t_omega_torsion ? ? ? 'X-RAY DIFFRACTION' ? 16.89 ? ? ? t_other_torsion ? ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.55 _refine_ls_shell.d_res_low 2.58 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs 404 _refine_ls_shell.number_reflns_R_free 25 _refine_ls_shell.number_reflns_R_work 379 _refine_ls_shell.percent_reflns_obs 98.79 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs 0.3353 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.3312 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.correlation_coeff_Fo_to_Fc ? _refine_ls_shell.correlation_coeff_Fo_to_Fc_free ? _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work ? _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.4018 # _struct.entry_id 28IU _struct.title ;structure of InhA from Mycobacterium tuberculosis in complex with (E)-2-(4-(4-((4-cyclopropyl-1H-1,2,3-triazol-1-yl)methyl)-2-hydroxyphenoxy)-3-fluorobenzylidene)hydrazine-1-carbothioamide (compound 6c) ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 28IU _struct_keywords.text 'ENOYL-ACP-REDUCTASE TYPE II FATTY ACID SYNTHASE MYCOLIC ACIDS TUBERCULOSIS THERAPEUTIC TARGET OXIDOREDUCTASE, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code INHA_MYCTU _struct_ref.pdbx_db_accession P9WGR1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPLLELDVQNEEHLASLAGRVTE AIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNPGGSIVGMDFDPSRAMPAYNW MTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIVGGALGEEAGAQIQLLEEGWDQRAPIGWNMKDATPVAK TVCALLSDWLPATTGDIIYADGGAHTQLL ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 28IU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 272 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P9WGR1 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 269 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 269 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 28IU GLY A 1 ? UNP P9WGR1 ? ? 'expression tag' -2 1 1 28IU SER A 2 ? UNP P9WGR1 ? ? 'expression tag' -1 2 1 28IU HIS A 3 ? UNP P9WGR1 ? ? 'expression tag' 0 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 19020 ? 1 MORE -126 ? 1 'SSA (A^2)' 32670 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_555 -y,-x,-z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 3 'crystal symmetry operation' 10_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 15_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 23 ? GLN A 35 ? SER A 20 GLN A 32 1 ? 13 HELX_P HELX_P2 AA2 ARG A 46 ? THR A 54 ? ARG A 43 THR A 51 1 ? 9 HELX_P HELX_P3 AA3 ASP A 55 ? LEU A 57 ? ASP A 52 LEU A 54 5 ? 3 HELX_P HELX_P4 AA4 ASN A 70 ? SER A 76 ? ASN A 67 SER A 73 1 ? 7 HELX_P HELX_P5 AA5 SER A 76 ? GLY A 86 ? SER A 73 GLY A 83 1 ? 11 HELX_P HELX_P6 AA6 PRO A 102 ? MET A 106 ? PRO A 99 MET A 103 5 ? 5 HELX_P HELX_P7 AA7 PRO A 110 ? ALA A 114 ? PRO A 107 ALA A 111 5 ? 5 HELX_P HELX_P8 AA8 PRO A 115 ? ALA A 127 ? PRO A 112 ALA A 124 1 ? 13 HELX_P HELX_P9 AA9 ALA A 127 ? LEU A 138 ? ALA A 124 LEU A 135 1 ? 12 HELX_P HELX_P10 AB1 TYR A 161 ? LYS A 184 ? TYR A 158 LYS A 181 1 ? 24 HELX_P HELX_P11 AB2 ALA A 201 ? ALA A 209 ? ALA A 198 ALA A 206 1 ? 9 HELX_P HELX_P12 AB3 GLU A 212 ? ALA A 229 ? GLU A 209 ALA A 226 1 ? 18 HELX_P HELX_P13 AB4 ALA A 238 ? SER A 250 ? ALA A 235 SER A 247 1 ? 13 HELX_P HELX_P14 AB5 GLY A 266 ? GLN A 270 ? GLY A 263 GLN A 267 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 63 ? GLU A 65 ? LEU A 60 GLU A 62 AA1 2 GLN A 38 ? GLY A 43 ? GLN A 35 GLY A 40 AA1 3 ARG A 12 ? SER A 16 ? ARG A 9 SER A 13 AA1 4 LEU A 91 ? HIS A 96 ? LEU A 88 HIS A 93 AA1 5 MET A 141 ? ASP A 151 ? MET A 138 ASP A 148 AA1 6 ARG A 188 ? ALA A 194 ? ARG A 185 ALA A 191 AA1 7 ILE A 260 ? ALA A 263 ? ILE A 257 ALA A 260 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LEU A 64 ? O LEU A 61 N GLY A 43 ? N GLY A 40 AA1 2 3 O VAL A 40 ? O VAL A 37 N VAL A 15 ? N VAL A 12 AA1 3 4 N ARG A 12 ? N ARG A 9 O ASP A 92 ? O ASP A 89 AA1 4 5 N HIS A 96 ? N HIS A 93 O VAL A 148 ? O VAL A 145 AA1 5 6 N ILE A 147 ? N ILE A 144 O ARG A 188 ? O ARG A 185 AA1 6 7 N LEU A 191 ? N LEU A 188 O ILE A 261 ? O ILE A 258 # _pdbx_entry_details.entry_id 28IU _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 20 ? ? -37.22 133.66 2 1 ASP A 42 ? ? 61.80 -67.23 3 1 SER A 94 ? ? -119.67 52.01 4 1 PRO A 99 ? ? -48.26 159.73 5 1 PRO A 99 ? ? -48.26 159.62 6 1 ALA A 124 ? ? -122.84 -51.38 7 1 ASP A 150 ? ? -35.26 105.35 8 1 ALA A 157 ? ? 65.95 -37.73 9 1 ASN A 159 ? ? 36.16 -112.95 10 1 ARG A 195 ? ? -67.88 91.51 11 1 ALA A 260 ? ? -115.74 66.60 # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method ? _pdbx_refine_tls.origin_x 0.5262 _pdbx_refine_tls.origin_y -21.4254 _pdbx_refine_tls.origin_z 5.8711 _pdbx_refine_tls.T[1][1] 0.2767 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0301 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0396 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] -0.1159 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.1112 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] -0.0375 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 1.8674 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.0499 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.1883 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 2.603 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.0838 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 3.6592 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.0509 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.3011 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.4989 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.0106 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.0352 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.0266 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 1.1537 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.0665 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.0861 _pdbx_refine_tls.S[3][3]_esd ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 3 ? ? ? A 269 ? ? '{ A|* }' 2 'X-RAY DIFFRACTION' 1 ? ? A 301 ? ? ? A 302 ? ? '{ A|* }' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A SER -1 ? A SER 2 3 1 Y 1 A HIS 0 ? A HIS 3 4 1 Y 1 A MET 1 ? A MET 4 5 1 Y 1 A THR 2 ? A THR 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1JZC N1 N N N 1 A1JZC C6 C N N 2 A1JZC C7 C Y N 3 A1JZC C8 C Y N 4 A1JZC C10 C Y N 5 A1JZC C13 C Y N 6 A1JZC C15 C Y N 7 A1JZC C22 C N N 8 A1JZC C24 C N N 9 A1JZC C26 C Y N 10 A1JZC C28 C Y N 11 A1JZC C2 C N N 12 A1JZC S3 S N N 13 A1JZC N4 N N N 14 A1JZC N5 N N N 15 A1JZC C9 C Y N 16 A1JZC O11 O N N 17 A1JZC C12 C Y N 18 A1JZC C14 C Y N 19 A1JZC C16 C N N 20 A1JZC N17 N Y N 21 A1JZC C18 C Y N 22 A1JZC C19 C Y N 23 A1JZC N20 N Y N 24 A1JZC N21 N Y N 25 A1JZC C23 C N N 26 A1JZC C25 C Y N 27 A1JZC O27 O N N 28 A1JZC F29 F N N 29 A1JZC C30 C Y N 30 A1JZC H1A H N N 31 A1JZC H1B H N N 32 A1JZC H6 H N N 33 A1JZC H8 H N N 34 A1JZC H13 H N N 35 A1JZC H22 H N N 36 A1JZC H24A H N N 37 A1JZC H24B H N N 38 A1JZC H4 H N N 39 A1JZC H9 H N N 40 A1JZC H14 H N N 41 A1JZC H16A H N N 42 A1JZC H16B H N N 43 A1JZC H18 H N N 44 A1JZC H23A H N N 45 A1JZC H23B H N N 46 A1JZC H25 H N N 47 A1JZC H27 H N N 48 A1JZC H30 H N N 49 ALA N N N N 50 ALA CA C N S 51 ALA C C N N 52 ALA O O N N 53 ALA CB C N N 54 ALA OXT O N N 55 ALA H H N N 56 ALA H2 H N N 57 ALA HA H N N 58 ALA HB1 H N N 59 ALA HB2 H N N 60 ALA HB3 H N N 61 ALA HXT H N N 62 ARG N N N N 63 ARG CA C N S 64 ARG C C N N 65 ARG O O N N 66 ARG CB C N N 67 ARG CG C N N 68 ARG CD C N N 69 ARG NE N N N 70 ARG CZ C N N 71 ARG NH1 N N N 72 ARG NH2 N N N 73 ARG OXT O N N 74 ARG H H N N 75 ARG H2 H N N 76 ARG HA H N N 77 ARG HB2 H N N 78 ARG HB3 H N N 79 ARG HG2 H N N 80 ARG HG3 H N N 81 ARG HD2 H N N 82 ARG HD3 H N N 83 ARG HE H N N 84 ARG HH11 H N N 85 ARG HH12 H N N 86 ARG HH21 H N N 87 ARG HH22 H N N 88 ARG HXT H N N 89 ASN N N N N 90 ASN CA C N S 91 ASN C C N N 92 ASN O O N N 93 ASN CB C N N 94 ASN CG C N N 95 ASN OD1 O N N 96 ASN ND2 N N N 97 ASN OXT O N N 98 ASN H H N N 99 ASN H2 H N N 100 ASN HA H N N 101 ASN HB2 H N N 102 ASN HB3 H N N 103 ASN HD21 H N N 104 ASN HD22 H N N 105 ASN HXT H N N 106 ASP N N N N 107 ASP CA C N S 108 ASP C C N N 109 ASP O O N N 110 ASP CB C N N 111 ASP CG C N N 112 ASP OD1 O N N 113 ASP OD2 O N N 114 ASP OXT O N N 115 ASP H H N N 116 ASP H2 H N N 117 ASP HA H N N 118 ASP HB2 H N N 119 ASP HB3 H N N 120 ASP HD2 H N N 121 ASP HXT H N N 122 CYS N N N N 123 CYS CA C N R 124 CYS C C N N 125 CYS O O N N 126 CYS CB C N N 127 CYS SG S N N 128 CYS OXT O N N 129 CYS H H N N 130 CYS H2 H N N 131 CYS HA H N N 132 CYS HB2 H N N 133 CYS HB3 H N N 134 CYS HG H N N 135 CYS HXT H N N 136 GLN N N N N 137 GLN CA C N S 138 GLN C C N N 139 GLN O O N N 140 GLN CB C N N 141 GLN CG C N N 142 GLN CD C N N 143 GLN OE1 O N N 144 GLN NE2 N N N 145 GLN OXT O N N 146 GLN H H N N 147 GLN H2 H N N 148 GLN HA H N N 149 GLN HB2 H N N 150 GLN HB3 H N N 151 GLN HG2 H N N 152 GLN HG3 H N N 153 GLN HE21 H N N 154 GLN HE22 H N N 155 GLN HXT H N N 156 GLU N N N N 157 GLU CA C N S 158 GLU C C N N 159 GLU O O N N 160 GLU CB C N N 161 GLU CG C N N 162 GLU CD C N N 163 GLU OE1 O N N 164 GLU OE2 O N N 165 GLU OXT O N N 166 GLU H H N N 167 GLU H2 H N N 168 GLU HA H N N 169 GLU HB2 H N N 170 GLU HB3 H N N 171 GLU HG2 H N N 172 GLU HG3 H N N 173 GLU HE2 H N N 174 GLU HXT H N N 175 GLY N N N N 176 GLY CA C N N 177 GLY C C N N 178 GLY O O N N 179 GLY OXT O N N 180 GLY H H N N 181 GLY H2 H N N 182 GLY HA2 H N N 183 GLY HA3 H N N 184 GLY HXT H N N 185 HIS N N N N 186 HIS CA C N S 187 HIS C C N N 188 HIS O O N N 189 HIS CB C N N 190 HIS CG C Y N 191 HIS ND1 N Y N 192 HIS CD2 C Y N 193 HIS CE1 C Y N 194 HIS NE2 N Y N 195 HIS OXT O N N 196 HIS H H N N 197 HIS H2 H N N 198 HIS HA H N N 199 HIS HB2 H N N 200 HIS HB3 H N N 201 HIS HD1 H N N 202 HIS HD2 H N N 203 HIS HE1 H N N 204 HIS HE2 H N N 205 HIS HXT H N N 206 HOH O O N N 207 HOH H1 H N N 208 HOH H2 H N N 209 ILE N N N N 210 ILE CA C N S 211 ILE C C N N 212 ILE O O N N 213 ILE CB C N S 214 ILE CG1 C N N 215 ILE CG2 C N N 216 ILE CD1 C N N 217 ILE OXT O N N 218 ILE H H N N 219 ILE H2 H N N 220 ILE HA H N N 221 ILE HB H N N 222 ILE HG12 H N N 223 ILE HG13 H N N 224 ILE HG21 H N N 225 ILE HG22 H N N 226 ILE HG23 H N N 227 ILE HD11 H N N 228 ILE HD12 H N N 229 ILE HD13 H N N 230 ILE HXT H N N 231 LEU N N N N 232 LEU CA C N S 233 LEU C C N N 234 LEU O O N N 235 LEU CB C N N 236 LEU CG C N N 237 LEU CD1 C N N 238 LEU CD2 C N N 239 LEU OXT O N N 240 LEU H H N N 241 LEU H2 H N N 242 LEU HA H N N 243 LEU HB2 H N N 244 LEU HB3 H N N 245 LEU HG H N N 246 LEU HD11 H N N 247 LEU HD12 H N N 248 LEU HD13 H N N 249 LEU HD21 H N N 250 LEU HD22 H N N 251 LEU HD23 H N N 252 LEU HXT H N N 253 LYS N N N N 254 LYS CA C N S 255 LYS C C N N 256 LYS O O N N 257 LYS CB C N N 258 LYS CG C N N 259 LYS CD C N N 260 LYS CE C N N 261 LYS NZ N N N 262 LYS OXT O N N 263 LYS H H N N 264 LYS H2 H N N 265 LYS HA H N N 266 LYS HB2 H N N 267 LYS HB3 H N N 268 LYS HG2 H N N 269 LYS HG3 H N N 270 LYS HD2 H N N 271 LYS HD3 H N N 272 LYS HE2 H N N 273 LYS HE3 H N N 274 LYS HZ1 H N N 275 LYS HZ2 H N N 276 LYS HZ3 H N N 277 LYS HXT H N N 278 MET N N N N 279 MET CA C N S 280 MET C C N N 281 MET O O N N 282 MET CB C N N 283 MET CG C N N 284 MET SD S N N 285 MET CE C N N 286 MET OXT O N N 287 MET H H N N 288 MET H2 H N N 289 MET HA H N N 290 MET HB2 H N N 291 MET HB3 H N N 292 MET HG2 H N N 293 MET HG3 H N N 294 MET HE1 H N N 295 MET HE2 H N N 296 MET HE3 H N N 297 MET HXT H N N 298 NAD PA P N S 299 NAD O1A O N N 300 NAD O2A O N N 301 NAD O5B O N N 302 NAD C5B C N N 303 NAD C4B C N R 304 NAD O4B O N N 305 NAD C3B C N S 306 NAD O3B O N N 307 NAD C2B C N R 308 NAD O2B O N N 309 NAD C1B C N R 310 NAD N9A N Y N 311 NAD C8A C Y N 312 NAD N7A N Y N 313 NAD C5A C Y N 314 NAD C6A C Y N 315 NAD N6A N N N 316 NAD N1A N Y N 317 NAD C2A C Y N 318 NAD N3A N Y N 319 NAD C4A C Y N 320 NAD O3 O N N 321 NAD PN P N N 322 NAD O1N O N N 323 NAD O2N O N N 324 NAD O5D O N N 325 NAD C5D C N N 326 NAD C4D C N R 327 NAD O4D O N N 328 NAD C3D C N S 329 NAD O3D O N N 330 NAD C2D C N R 331 NAD O2D O N N 332 NAD C1D C N R 333 NAD N1N N Y N 334 NAD C2N C Y N 335 NAD C3N C Y N 336 NAD C7N C N N 337 NAD O7N O N N 338 NAD N7N N N N 339 NAD C4N C Y N 340 NAD C5N C Y N 341 NAD C6N C Y N 342 NAD HOA2 H N N 343 NAD H51A H N N 344 NAD H52A H N N 345 NAD H4B H N N 346 NAD H3B H N N 347 NAD HO3A H N N 348 NAD H2B H N N 349 NAD HO2A H N N 350 NAD H1B H N N 351 NAD H8A H N N 352 NAD H61A H N N 353 NAD H62A H N N 354 NAD H2A H N N 355 NAD H51N H N N 356 NAD H52N H N N 357 NAD H4D H N N 358 NAD H3D H N N 359 NAD HO3N H N N 360 NAD H2D H N N 361 NAD HO2N H N N 362 NAD H1D H N N 363 NAD H2N H N N 364 NAD H71N H N N 365 NAD H72N H N N 366 NAD H4N H N N 367 NAD H5N H N N 368 NAD H6N H N N 369 PHE N N N N 370 PHE CA C N S 371 PHE C C N N 372 PHE O O N N 373 PHE CB C N N 374 PHE CG C Y N 375 PHE CD1 C Y N 376 PHE CD2 C Y N 377 PHE CE1 C Y N 378 PHE CE2 C Y N 379 PHE CZ C Y N 380 PHE OXT O N N 381 PHE H H N N 382 PHE H2 H N N 383 PHE HA H N N 384 PHE HB2 H N N 385 PHE HB3 H N N 386 PHE HD1 H N N 387 PHE HD2 H N N 388 PHE HE1 H N N 389 PHE HE2 H N N 390 PHE HZ H N N 391 PHE HXT H N N 392 PRO N N N N 393 PRO CA C N S 394 PRO C C N N 395 PRO O O N N 396 PRO CB C N N 397 PRO CG C N N 398 PRO CD C N N 399 PRO OXT O N N 400 PRO H H N N 401 PRO HA H N N 402 PRO HB2 H N N 403 PRO HB3 H N N 404 PRO HG2 H N N 405 PRO HG3 H N N 406 PRO HD2 H N N 407 PRO HD3 H N N 408 PRO HXT H N N 409 SER N N N N 410 SER CA C N S 411 SER C C N N 412 SER O O N N 413 SER CB C N N 414 SER OG O N N 415 SER OXT O N N 416 SER H H N N 417 SER H2 H N N 418 SER HA H N N 419 SER HB2 H N N 420 SER HB3 H N N 421 SER HG H N N 422 SER HXT H N N 423 THR N N N N 424 THR CA C N S 425 THR C C N N 426 THR O O N N 427 THR CB C N R 428 THR OG1 O N N 429 THR CG2 C N N 430 THR OXT O N N 431 THR H H N N 432 THR H2 H N N 433 THR HA H N N 434 THR HB H N N 435 THR HG1 H N N 436 THR HG21 H N N 437 THR HG22 H N N 438 THR HG23 H N N 439 THR HXT H N N 440 TRP N N N N 441 TRP CA C N S 442 TRP C C N N 443 TRP O O N N 444 TRP CB C N N 445 TRP CG C Y N 446 TRP CD1 C Y N 447 TRP CD2 C Y N 448 TRP NE1 N Y N 449 TRP CE2 C Y N 450 TRP CE3 C Y N 451 TRP CZ2 C Y N 452 TRP CZ3 C Y N 453 TRP CH2 C Y N 454 TRP OXT O N N 455 TRP H H N N 456 TRP H2 H N N 457 TRP HA H N N 458 TRP HB2 H N N 459 TRP HB3 H N N 460 TRP HD1 H N N 461 TRP HE1 H N N 462 TRP HE3 H N N 463 TRP HZ2 H N N 464 TRP HZ3 H N N 465 TRP HH2 H N N 466 TRP HXT H N N 467 TYR N N N N 468 TYR CA C N S 469 TYR C C N N 470 TYR O O N N 471 TYR CB C N N 472 TYR CG C Y N 473 TYR CD1 C Y N 474 TYR CD2 C Y N 475 TYR CE1 C Y N 476 TYR CE2 C Y N 477 TYR CZ C Y N 478 TYR OH O N N 479 TYR OXT O N N 480 TYR H H N N 481 TYR H2 H N N 482 TYR HA H N N 483 TYR HB2 H N N 484 TYR HB3 H N N 485 TYR HD1 H N N 486 TYR HD2 H N N 487 TYR HE1 H N N 488 TYR HE2 H N N 489 TYR HH H N N 490 TYR HXT H N N 491 VAL N N N N 492 VAL CA C N S 493 VAL C C N N 494 VAL O O N N 495 VAL CB C N N 496 VAL CG1 C N N 497 VAL CG2 C N N 498 VAL OXT O N N 499 VAL H H N N 500 VAL H2 H N N 501 VAL HA H N N 502 VAL HB H N N 503 VAL HG11 H N N 504 VAL HG12 H N N 505 VAL HG13 H N N 506 VAL HG21 H N N 507 VAL HG22 H N N 508 VAL HG23 H N N 509 VAL HXT H N N 510 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1JZC N1 C2 sing N N 1 A1JZC C2 S3 doub N N 2 A1JZC C2 N4 sing N N 3 A1JZC N4 N5 sing N N 4 A1JZC N5 C6 doub N E 5 A1JZC C6 C7 sing N N 6 A1JZC C7 C8 doub Y N 7 A1JZC C8 C9 sing Y N 8 A1JZC C9 C10 doub Y N 9 A1JZC C10 O11 sing N N 10 A1JZC O11 C12 sing N N 11 A1JZC C12 C13 doub Y N 12 A1JZC C13 C14 sing Y N 13 A1JZC C14 C15 doub Y N 14 A1JZC C15 C16 sing N N 15 A1JZC C16 N17 sing N N 16 A1JZC N17 C18 sing Y N 17 A1JZC C18 C19 doub Y N 18 A1JZC C19 N20 sing Y N 19 A1JZC N20 N21 doub Y N 20 A1JZC C19 C22 sing N N 21 A1JZC C22 C23 sing N N 22 A1JZC C23 C24 sing N N 23 A1JZC C15 C25 sing Y N 24 A1JZC C25 C26 doub Y N 25 A1JZC C26 O27 sing N N 26 A1JZC C10 C28 sing Y N 27 A1JZC C28 F29 sing N N 28 A1JZC C28 C30 doub Y N 29 A1JZC C30 C7 sing Y N 30 A1JZC C26 C12 sing Y N 31 A1JZC N21 N17 sing Y N 32 A1JZC C24 C22 sing N N 33 A1JZC N1 H1A sing N N 34 A1JZC N1 H1B sing N N 35 A1JZC C6 H6 sing N N 36 A1JZC C8 H8 sing N N 37 A1JZC C13 H13 sing N N 38 A1JZC C22 H22 sing N N 39 A1JZC C24 H24A sing N N 40 A1JZC C24 H24B sing N N 41 A1JZC N4 H4 sing N N 42 A1JZC C9 H9 sing N N 43 A1JZC C14 H14 sing N N 44 A1JZC C16 H16A sing N N 45 A1JZC C16 H16B sing N N 46 A1JZC C18 H18 sing N N 47 A1JZC C23 H23A sing N N 48 A1JZC C23 H23B sing N N 49 A1JZC C25 H25 sing N N 50 A1JZC O27 H27 sing N N 51 A1JZC C30 H30 sing N N 52 ALA N CA sing N N 53 ALA N H sing N N 54 ALA N H2 sing N N 55 ALA CA C sing N N 56 ALA CA CB sing N N 57 ALA CA HA sing N N 58 ALA C O doub N N 59 ALA C OXT sing N N 60 ALA CB HB1 sing N N 61 ALA CB HB2 sing N N 62 ALA CB HB3 sing N N 63 ALA OXT HXT sing N N 64 ARG N CA sing N N 65 ARG N H sing N N 66 ARG N H2 sing N N 67 ARG CA C sing N N 68 ARG CA CB sing N N 69 ARG CA HA sing N N 70 ARG C O doub N N 71 ARG C OXT sing N N 72 ARG CB CG sing N N 73 ARG CB HB2 sing N N 74 ARG CB HB3 sing N N 75 ARG CG CD sing N N 76 ARG CG HG2 sing N N 77 ARG CG HG3 sing N N 78 ARG CD NE sing N N 79 ARG CD HD2 sing N N 80 ARG CD HD3 sing N N 81 ARG NE CZ sing N N 82 ARG NE HE sing N N 83 ARG CZ NH1 sing N N 84 ARG CZ NH2 doub N N 85 ARG NH1 HH11 sing N N 86 ARG NH1 HH12 sing N N 87 ARG NH2 HH21 sing N N 88 ARG NH2 HH22 sing N N 89 ARG OXT HXT sing N N 90 ASN N CA sing N N 91 ASN N H sing N N 92 ASN N H2 sing N N 93 ASN CA C sing N N 94 ASN CA CB sing N N 95 ASN CA HA sing N N 96 ASN C O doub N N 97 ASN C OXT sing N N 98 ASN CB CG sing N N 99 ASN CB HB2 sing N N 100 ASN CB HB3 sing N N 101 ASN CG OD1 doub N N 102 ASN CG ND2 sing N N 103 ASN ND2 HD21 sing N N 104 ASN ND2 HD22 sing N N 105 ASN OXT HXT sing N N 106 ASP N CA sing N N 107 ASP N H sing N N 108 ASP N H2 sing N N 109 ASP CA C sing N N 110 ASP CA CB sing N N 111 ASP CA HA sing N N 112 ASP C O doub N N 113 ASP C OXT sing N N 114 ASP CB CG sing N N 115 ASP CB HB2 sing N N 116 ASP CB HB3 sing N N 117 ASP CG OD1 doub N N 118 ASP CG OD2 sing N N 119 ASP OD2 HD2 sing N N 120 ASP OXT HXT sing N N 121 CYS N CA sing N N 122 CYS N H sing N N 123 CYS N H2 sing N N 124 CYS CA C sing N N 125 CYS CA CB sing N N 126 CYS CA HA sing N N 127 CYS C O doub N N 128 CYS C OXT sing N N 129 CYS CB SG sing N N 130 CYS CB HB2 sing N N 131 CYS CB HB3 sing N N 132 CYS SG HG sing N N 133 CYS OXT HXT sing N N 134 GLN N CA sing N N 135 GLN N H sing N N 136 GLN N H2 sing N N 137 GLN CA C sing N N 138 GLN CA CB sing N N 139 GLN CA HA sing N N 140 GLN C O doub N N 141 GLN C OXT sing N N 142 GLN CB CG sing N N 143 GLN CB HB2 sing N N 144 GLN CB HB3 sing N N 145 GLN CG CD sing N N 146 GLN CG HG2 sing N N 147 GLN CG HG3 sing N N 148 GLN CD OE1 doub N N 149 GLN CD NE2 sing N N 150 GLN NE2 HE21 sing N N 151 GLN NE2 HE22 sing N N 152 GLN OXT HXT sing N N 153 GLU N CA sing N N 154 GLU N H sing N N 155 GLU N H2 sing N N 156 GLU CA C sing N N 157 GLU CA CB sing N N 158 GLU CA HA sing N N 159 GLU C O doub N N 160 GLU C OXT sing N N 161 GLU CB CG sing N N 162 GLU CB HB2 sing N N 163 GLU CB HB3 sing N N 164 GLU CG CD sing N N 165 GLU CG HG2 sing N N 166 GLU CG HG3 sing N N 167 GLU CD OE1 doub N N 168 GLU CD OE2 sing N N 169 GLU OE2 HE2 sing N N 170 GLU OXT HXT sing N N 171 GLY N CA sing N N 172 GLY N H sing N N 173 GLY N H2 sing N N 174 GLY CA C sing N N 175 GLY CA HA2 sing N N 176 GLY CA HA3 sing N N 177 GLY C O doub N N 178 GLY C OXT sing N N 179 GLY OXT HXT sing N N 180 HIS N CA sing N N 181 HIS N H sing N N 182 HIS N H2 sing N N 183 HIS CA C sing N N 184 HIS CA CB sing N N 185 HIS CA HA sing N N 186 HIS C O doub N N 187 HIS C OXT sing N N 188 HIS CB CG sing N N 189 HIS CB HB2 sing N N 190 HIS CB HB3 sing N N 191 HIS CG ND1 sing Y N 192 HIS CG CD2 doub Y N 193 HIS ND1 CE1 doub Y N 194 HIS ND1 HD1 sing N N 195 HIS CD2 NE2 sing Y N 196 HIS CD2 HD2 sing N N 197 HIS CE1 NE2 sing Y N 198 HIS CE1 HE1 sing N N 199 HIS NE2 HE2 sing N N 200 HIS OXT HXT sing N N 201 HOH O H1 sing N N 202 HOH O H2 sing N N 203 ILE N CA sing N N 204 ILE N H sing N N 205 ILE N H2 sing N N 206 ILE CA C sing N N 207 ILE CA CB sing N N 208 ILE CA HA sing N N 209 ILE C O doub N N 210 ILE C OXT sing N N 211 ILE CB CG1 sing N N 212 ILE CB CG2 sing N N 213 ILE CB HB sing N N 214 ILE CG1 CD1 sing N N 215 ILE CG1 HG12 sing N N 216 ILE CG1 HG13 sing N N 217 ILE CG2 HG21 sing N N 218 ILE CG2 HG22 sing N N 219 ILE CG2 HG23 sing N N 220 ILE CD1 HD11 sing N N 221 ILE CD1 HD12 sing N N 222 ILE CD1 HD13 sing N N 223 ILE OXT HXT sing N N 224 LEU N CA sing N N 225 LEU N H sing N N 226 LEU N H2 sing N N 227 LEU CA C sing N N 228 LEU CA CB sing N N 229 LEU CA HA sing N N 230 LEU C O doub N N 231 LEU C OXT sing N N 232 LEU CB CG sing N N 233 LEU CB HB2 sing N N 234 LEU CB HB3 sing N N 235 LEU CG CD1 sing N N 236 LEU CG CD2 sing N N 237 LEU CG HG sing N N 238 LEU CD1 HD11 sing N N 239 LEU CD1 HD12 sing N N 240 LEU CD1 HD13 sing N N 241 LEU CD2 HD21 sing N N 242 LEU CD2 HD22 sing N N 243 LEU CD2 HD23 sing N N 244 LEU OXT HXT sing N N 245 LYS N CA sing N N 246 LYS N H sing N N 247 LYS N H2 sing N N 248 LYS CA C sing N N 249 LYS CA CB sing N N 250 LYS CA HA sing N N 251 LYS C O doub N N 252 LYS C OXT sing N N 253 LYS CB CG sing N N 254 LYS CB HB2 sing N N 255 LYS CB HB3 sing N N 256 LYS CG CD sing N N 257 LYS CG HG2 sing N N 258 LYS CG HG3 sing N N 259 LYS CD CE sing N N 260 LYS CD HD2 sing N N 261 LYS CD HD3 sing N N 262 LYS CE NZ sing N N 263 LYS CE HE2 sing N N 264 LYS CE HE3 sing N N 265 LYS NZ HZ1 sing N N 266 LYS NZ HZ2 sing N N 267 LYS NZ HZ3 sing N N 268 LYS OXT HXT sing N N 269 MET N CA sing N N 270 MET N H sing N N 271 MET N H2 sing N N 272 MET CA C sing N N 273 MET CA CB sing N N 274 MET CA HA sing N N 275 MET C O doub N N 276 MET C OXT sing N N 277 MET CB CG sing N N 278 MET CB HB2 sing N N 279 MET CB HB3 sing N N 280 MET CG SD sing N N 281 MET CG HG2 sing N N 282 MET CG HG3 sing N N 283 MET SD CE sing N N 284 MET CE HE1 sing N N 285 MET CE HE2 sing N N 286 MET CE HE3 sing N N 287 MET OXT HXT sing N N 288 NAD PA O1A doub N N 289 NAD PA O2A sing N N 290 NAD PA O5B sing N N 291 NAD PA O3 sing N N 292 NAD O2A HOA2 sing N N 293 NAD O5B C5B sing N N 294 NAD C5B C4B sing N N 295 NAD C5B H51A sing N N 296 NAD C5B H52A sing N N 297 NAD C4B O4B sing N N 298 NAD C4B C3B sing N N 299 NAD C4B H4B sing N N 300 NAD O4B C1B sing N N 301 NAD C3B O3B sing N N 302 NAD C3B C2B sing N N 303 NAD C3B H3B sing N N 304 NAD O3B HO3A sing N N 305 NAD C2B O2B sing N N 306 NAD C2B C1B sing N N 307 NAD C2B H2B sing N N 308 NAD O2B HO2A sing N N 309 NAD C1B N9A sing N N 310 NAD C1B H1B sing N N 311 NAD N9A C8A sing Y N 312 NAD N9A C4A sing Y N 313 NAD C8A N7A doub Y N 314 NAD C8A H8A sing N N 315 NAD N7A C5A sing Y N 316 NAD C5A C6A sing Y N 317 NAD C5A C4A doub Y N 318 NAD C6A N6A sing N N 319 NAD C6A N1A doub Y N 320 NAD N6A H61A sing N N 321 NAD N6A H62A sing N N 322 NAD N1A C2A sing Y N 323 NAD C2A N3A doub Y N 324 NAD C2A H2A sing N N 325 NAD N3A C4A sing Y N 326 NAD O3 PN sing N N 327 NAD PN O1N doub N N 328 NAD PN O2N sing N N 329 NAD PN O5D sing N N 330 NAD O5D C5D sing N N 331 NAD C5D C4D sing N N 332 NAD C5D H51N sing N N 333 NAD C5D H52N sing N N 334 NAD C4D O4D sing N N 335 NAD C4D C3D sing N N 336 NAD C4D H4D sing N N 337 NAD O4D C1D sing N N 338 NAD C3D O3D sing N N 339 NAD C3D C2D sing N N 340 NAD C3D H3D sing N N 341 NAD O3D HO3N sing N N 342 NAD C2D O2D sing N N 343 NAD C2D C1D sing N N 344 NAD C2D H2D sing N N 345 NAD O2D HO2N sing N N 346 NAD C1D N1N sing N N 347 NAD C1D H1D sing N N 348 NAD N1N C2N sing Y N 349 NAD N1N C6N doub Y N 350 NAD C2N C3N doub Y N 351 NAD C2N H2N sing N N 352 NAD C3N C7N sing N N 353 NAD C3N C4N sing Y N 354 NAD C7N O7N doub N N 355 NAD C7N N7N sing N N 356 NAD N7N H71N sing N N 357 NAD N7N H72N sing N N 358 NAD C4N C5N doub Y N 359 NAD C4N H4N sing N N 360 NAD C5N C6N sing Y N 361 NAD C5N H5N sing N N 362 NAD C6N H6N sing N N 363 PHE N CA sing N N 364 PHE N H sing N N 365 PHE N H2 sing N N 366 PHE CA C sing N N 367 PHE CA CB sing N N 368 PHE CA HA sing N N 369 PHE C O doub N N 370 PHE C OXT sing N N 371 PHE CB CG sing N N 372 PHE CB HB2 sing N N 373 PHE CB HB3 sing N N 374 PHE CG CD1 doub Y N 375 PHE CG CD2 sing Y N 376 PHE CD1 CE1 sing Y N 377 PHE CD1 HD1 sing N N 378 PHE CD2 CE2 doub Y N 379 PHE CD2 HD2 sing N N 380 PHE CE1 CZ doub Y N 381 PHE CE1 HE1 sing N N 382 PHE CE2 CZ sing Y N 383 PHE CE2 HE2 sing N N 384 PHE CZ HZ sing N N 385 PHE OXT HXT sing N N 386 PRO N CA sing N N 387 PRO N CD sing N N 388 PRO N H sing N N 389 PRO CA C sing N N 390 PRO CA CB sing N N 391 PRO CA HA sing N N 392 PRO C O doub N N 393 PRO C OXT sing N N 394 PRO CB CG sing N N 395 PRO CB HB2 sing N N 396 PRO CB HB3 sing N N 397 PRO CG CD sing N N 398 PRO CG HG2 sing N N 399 PRO CG HG3 sing N N 400 PRO CD HD2 sing N N 401 PRO CD HD3 sing N N 402 PRO OXT HXT sing N N 403 SER N CA sing N N 404 SER N H sing N N 405 SER N H2 sing N N 406 SER CA C sing N N 407 SER CA CB sing N N 408 SER CA HA sing N N 409 SER C O doub N N 410 SER C OXT sing N N 411 SER CB OG sing N N 412 SER CB HB2 sing N N 413 SER CB HB3 sing N N 414 SER OG HG sing N N 415 SER OXT HXT sing N N 416 THR N CA sing N N 417 THR N H sing N N 418 THR N H2 sing N N 419 THR CA C sing N N 420 THR CA CB sing N N 421 THR CA HA sing N N 422 THR C O doub N N 423 THR C OXT sing N N 424 THR CB OG1 sing N N 425 THR CB CG2 sing N N 426 THR CB HB sing N N 427 THR OG1 HG1 sing N N 428 THR CG2 HG21 sing N N 429 THR CG2 HG22 sing N N 430 THR CG2 HG23 sing N N 431 THR OXT HXT sing N N 432 TRP N CA sing N N 433 TRP N H sing N N 434 TRP N H2 sing N N 435 TRP CA C sing N N 436 TRP CA CB sing N N 437 TRP CA HA sing N N 438 TRP C O doub N N 439 TRP C OXT sing N N 440 TRP CB CG sing N N 441 TRP CB HB2 sing N N 442 TRP CB HB3 sing N N 443 TRP CG CD1 doub Y N 444 TRP CG CD2 sing Y N 445 TRP CD1 NE1 sing Y N 446 TRP CD1 HD1 sing N N 447 TRP CD2 CE2 doub Y N 448 TRP CD2 CE3 sing Y N 449 TRP NE1 CE2 sing Y N 450 TRP NE1 HE1 sing N N 451 TRP CE2 CZ2 sing Y N 452 TRP CE3 CZ3 doub Y N 453 TRP CE3 HE3 sing N N 454 TRP CZ2 CH2 doub Y N 455 TRP CZ2 HZ2 sing N N 456 TRP CZ3 CH2 sing Y N 457 TRP CZ3 HZ3 sing N N 458 TRP CH2 HH2 sing N N 459 TRP OXT HXT sing N N 460 TYR N CA sing N N 461 TYR N H sing N N 462 TYR N H2 sing N N 463 TYR CA C sing N N 464 TYR CA CB sing N N 465 TYR CA HA sing N N 466 TYR C O doub N N 467 TYR C OXT sing N N 468 TYR CB CG sing N N 469 TYR CB HB2 sing N N 470 TYR CB HB3 sing N N 471 TYR CG CD1 doub Y N 472 TYR CG CD2 sing Y N 473 TYR CD1 CE1 sing Y N 474 TYR CD1 HD1 sing N N 475 TYR CD2 CE2 doub Y N 476 TYR CD2 HD2 sing N N 477 TYR CE1 CZ doub Y N 478 TYR CE1 HE1 sing N N 479 TYR CE2 CZ sing Y N 480 TYR CE2 HE2 sing N N 481 TYR CZ OH sing N N 482 TYR OH HH sing N N 483 TYR OXT HXT sing N N 484 VAL N CA sing N N 485 VAL N H sing N N 486 VAL N H2 sing N N 487 VAL CA C sing N N 488 VAL CA CB sing N N 489 VAL CA HA sing N N 490 VAL C O doub N N 491 VAL C OXT sing N N 492 VAL CB CG1 sing N N 493 VAL CB CG2 sing N N 494 VAL CB HB sing N N 495 VAL CG1 HG11 sing N N 496 VAL CG1 HG12 sing N N 497 VAL CG1 HG13 sing N N 498 VAL CG2 HG21 sing N N 499 VAL CG2 HG22 sing N N 500 VAL CG2 HG23 sing N N 501 VAL OXT HXT sing N N 502 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Agence Nationale de la Recherche (ANR)' France ANR-23-CE44-0002 1 'Universite de Toulouse' France ? 2 'La Region Occitanie' Italy ? 3 'Centre National de la Recherche Scientifique (CNRS)' France ? 4 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3FNG _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 28IU _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.010910 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010910 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005394 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C F N O P S # loop_ # loop_ #