data_29DA # _entry.id 29DA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.416 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 29DA pdb_000029da 10.2210/pdb29da/pdb WWPDB D_1292155029 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-08-19 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _database_PDB_caveat.id _database_PDB_caveat.text 1 'A1JQY A 201 HAS WRONG CHIRALITY AT ATOM C8' 2 'A1JQY A 201 HAS WRONG CHIRALITY AT ATOM C10' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 29DA _pdbx_database_status.recvd_initial_deposition_date 2026-03-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 2 _pdbx_contact_author.email haifaelkilani@yahoo.de _pdbx_contact_author.name_first Haifa _pdbx_contact_author.name_last 'El Kilani' _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-4084-3582 # _audit_author.name 'El Kilani, H.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0003-4084-3582 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Commun Chem' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2399-3669 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 9 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structure-based macrocyclization of alpha-ketoamides leads to potent inhibitors of coronaviral and enteroviral proteases.' _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s42004-026-02151-y _citation.pdbx_database_id_PubMed 42562838 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Akula, R.K.' 1 ? primary 'El Kilani, H.' 2 0000-0003-4084-3582 primary 'Metzen, A.' 3 ? primary 'Joshi, S.' 4 ? primary 'Durmaz, H.' 5 ? primary 'Veenstra, R.' 6 ? primary 'Roske, J.' 7 0009-0001-7776-9729 primary 'Hurdiss, D.L.' 8 0000-0003-3834-5808 primary 'Van Kuppeveld, F.J.M.' 9 ? primary 'Rox, K.' 10 0000-0002-8020-1384 primary 'Hilgenfeld, R.' 11 ? primary 'Bronstrup, M.' 12 0000-0002-8971-7045 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Genome polyprotein' 21024.873 1 3.4.22.29,3.6.1.15,3.4.22.28,2.7.7.48 ? ? ? 2 non-polymer syn ;1-[(3~{S},6~{S},7~{R})-7-oxidanyl-4,8-bis(oxidanylidene)-6-[[(3~{S})-2-oxidanylidenepyrrolidin-3-yl]methyl]-5,9-diazabicyclo[14.3.1]icosa-1(19),16(20),17-trien-3-yl]-3-[2,2,2-tris(fluoranyl)ethyl]urea ; 555.590 1 ? ? ? ? 3 water nat water 18.015 58 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPGFDFAQAIMKKNTVVARTEKGEFTMLGVHDRVAVIPTHASVGETIYINDVETKVLDACALRDLTDTNLEITIVKLDRN QKFRDIRHFLPRYEDDYNDAVLSVHTSKFPNMYIPVGQVTNYGFLNLGGTPTHRILMYNFPTRAGQCGGVVTTTGKVIGI HVGGNGAQGFAAMLLHSYFTDTQKHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;GPGFDFAQAIMKKNTVVARTEKGEFTMLGVHDRVAVIPTHASVGETIYINDVETKVLDACALRDLTDTNLEITIVKLDRN QKFRDIRHFLPRYEDDYNDAVLSVHTSKFPNMYIPVGQVTNYGFLNLGGTPTHRILMYNFPTRAGQCGGVVTTTGKVIGI HVGGNGAQGFAAMLLHSYFTDTQKHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;1-[(3~{S},6~{S},7~{R})-7-oxidanyl-4,8-bis(oxidanylidene)-6-[[(3~{S})-2-oxidanylidenepyrrolidin-3-yl]methyl]-5,9-diazabicyclo[14.3.1]icosa-1(19),16(20),17-trien-3-yl]-3-[2,2,2-tris(fluoranyl)ethyl]urea ; A1JQY 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 GLY n 1 4 PHE n 1 5 ASP n 1 6 PHE n 1 7 ALA n 1 8 GLN n 1 9 ALA n 1 10 ILE n 1 11 MET n 1 12 LYS n 1 13 LYS n 1 14 ASN n 1 15 THR n 1 16 VAL n 1 17 VAL n 1 18 ALA n 1 19 ARG n 1 20 THR n 1 21 GLU n 1 22 LYS n 1 23 GLY n 1 24 GLU n 1 25 PHE n 1 26 THR n 1 27 MET n 1 28 LEU n 1 29 GLY n 1 30 VAL n 1 31 HIS n 1 32 ASP n 1 33 ARG n 1 34 VAL n 1 35 ALA n 1 36 VAL n 1 37 ILE n 1 38 PRO n 1 39 THR n 1 40 HIS n 1 41 ALA n 1 42 SER n 1 43 VAL n 1 44 GLY n 1 45 GLU n 1 46 THR n 1 47 ILE n 1 48 TYR n 1 49 ILE n 1 50 ASN n 1 51 ASP n 1 52 VAL n 1 53 GLU n 1 54 THR n 1 55 LYS n 1 56 VAL n 1 57 LEU n 1 58 ASP n 1 59 ALA n 1 60 CYS n 1 61 ALA n 1 62 LEU n 1 63 ARG n 1 64 ASP n 1 65 LEU n 1 66 THR n 1 67 ASP n 1 68 THR n 1 69 ASN n 1 70 LEU n 1 71 GLU n 1 72 ILE n 1 73 THR n 1 74 ILE n 1 75 VAL n 1 76 LYS n 1 77 LEU n 1 78 ASP n 1 79 ARG n 1 80 ASN n 1 81 GLN n 1 82 LYS n 1 83 PHE n 1 84 ARG n 1 85 ASP n 1 86 ILE n 1 87 ARG n 1 88 HIS n 1 89 PHE n 1 90 LEU n 1 91 PRO n 1 92 ARG n 1 93 TYR n 1 94 GLU n 1 95 ASP n 1 96 ASP n 1 97 TYR n 1 98 ASN n 1 99 ASP n 1 100 ALA n 1 101 VAL n 1 102 LEU n 1 103 SER n 1 104 VAL n 1 105 HIS n 1 106 THR n 1 107 SER n 1 108 LYS n 1 109 PHE n 1 110 PRO n 1 111 ASN n 1 112 MET n 1 113 TYR n 1 114 ILE n 1 115 PRO n 1 116 VAL n 1 117 GLY n 1 118 GLN n 1 119 VAL n 1 120 THR n 1 121 ASN n 1 122 TYR n 1 123 GLY n 1 124 PHE n 1 125 LEU n 1 126 ASN n 1 127 LEU n 1 128 GLY n 1 129 GLY n 1 130 THR n 1 131 PRO n 1 132 THR n 1 133 HIS n 1 134 ARG n 1 135 ILE n 1 136 LEU n 1 137 MET n 1 138 TYR n 1 139 ASN n 1 140 PHE n 1 141 PRO n 1 142 THR n 1 143 ARG n 1 144 ALA n 1 145 GLY n 1 146 GLN n 1 147 CYS n 1 148 GLY n 1 149 GLY n 1 150 VAL n 1 151 VAL n 1 152 THR n 1 153 THR n 1 154 THR n 1 155 GLY n 1 156 LYS n 1 157 VAL n 1 158 ILE n 1 159 GLY n 1 160 ILE n 1 161 HIS n 1 162 VAL n 1 163 GLY n 1 164 GLY n 1 165 ASN n 1 166 GLY n 1 167 ALA n 1 168 GLN n 1 169 GLY n 1 170 PHE n 1 171 ALA n 1 172 ALA n 1 173 MET n 1 174 LEU n 1 175 LEU n 1 176 HIS n 1 177 SER n 1 178 TYR n 1 179 PHE n 1 180 THR n 1 181 ASP n 1 182 THR n 1 183 GLN n 1 184 LYS n 1 185 HIS n 1 186 HIS n 1 187 HIS n 1 188 HIS n 1 189 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 189 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name Enterovirus _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 12059 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1JQY non-polymer . ;1-[(3~{S},6~{S},7~{R})-7-oxidanyl-4,8-bis(oxidanylidene)-6-[[(3~{S})-2-oxidanylidenepyrrolidin-3-yl]methyl]-5,9-diazabicyclo[14.3.1]icosa-1(19),16(20),17-trien-3-yl]-3-[2,2,2-tris(fluoranyl)ethyl]urea ; ? 'C26 H36 F3 N5 O5' 555.590 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 MET 11 11 11 MET MET A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 MET 27 27 27 MET MET A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 HIS 105 105 105 HIS HIS A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 PHE 109 109 109 PHE PHE A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 MET 112 112 112 MET MET A . n A 1 113 TYR 113 113 113 TYR TYR A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 GLN 118 118 118 GLN GLN A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 ASN 121 121 121 ASN ASN A . n A 1 122 TYR 122 122 122 TYR TYR A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 PHE 124 124 124 PHE PHE A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 PRO 131 131 131 PRO PRO A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 HIS 133 133 133 HIS HIS A . n A 1 134 ARG 134 134 134 ARG ARG A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 MET 137 137 137 MET MET A . n A 1 138 TYR 138 138 138 TYR TYR A . n A 1 139 ASN 139 139 139 ASN ASN A . n A 1 140 PHE 140 140 140 PHE PHE A . n A 1 141 PRO 141 141 141 PRO PRO A . n A 1 142 THR 142 142 142 THR THR A . n A 1 143 ARG 143 143 143 ARG ARG A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 GLN 146 146 146 GLN GLN A . n A 1 147 CYS 147 147 147 CYS CYS A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 VAL 150 150 150 VAL VAL A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 THR 152 152 152 THR THR A . n A 1 153 THR 153 153 153 THR THR A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 LYS 156 156 156 LYS LYS A . n A 1 157 VAL 157 157 157 VAL VAL A . n A 1 158 ILE 158 158 158 ILE ILE A . n A 1 159 GLY 159 159 159 GLY GLY A . n A 1 160 ILE 160 160 160 ILE ILE A . n A 1 161 HIS 161 161 161 HIS HIS A . n A 1 162 VAL 162 162 162 VAL VAL A . n A 1 163 GLY 163 163 163 GLY GLY A . n A 1 164 GLY 164 164 164 GLY GLY A . n A 1 165 ASN 165 165 165 ASN ASN A . n A 1 166 GLY 166 166 166 GLY GLY A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 GLN 168 168 168 GLN GLN A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 PHE 170 170 170 PHE PHE A . n A 1 171 ALA 171 171 171 ALA ALA A . n A 1 172 ALA 172 172 172 ALA ALA A . n A 1 173 MET 173 173 173 MET MET A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 HIS 176 176 176 HIS HIS A . n A 1 177 SER 177 177 177 SER SER A . n A 1 178 TYR 178 178 178 TYR TYR A . n A 1 179 PHE 179 179 179 PHE PHE A . n A 1 180 THR 180 180 180 THR THR A . n A 1 181 ASP 181 181 181 ASP ASP A . n A 1 182 THR 182 182 182 THR THR A . n A 1 183 GLN 183 183 183 GLN GLN A . n A 1 184 LYS 184 184 184 LYS LYS A . n A 1 185 HIS 185 185 185 HIS HIS A . n A 1 186 HIS 186 186 186 HIS HIS A . n A 1 187 HIS 187 187 187 HIS HIS A . n A 1 188 HIS 188 188 188 HIS HIS A . n A 1 189 HIS 189 189 189 HIS HIS A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1JQY _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1JQY _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 A1JQY 1 201 201 A1JQY LIG A . C 3 HOH 1 301 33 HOH HOH A . C 3 HOH 2 302 58 HOH HOH A . C 3 HOH 3 303 2 HOH HOH A . C 3 HOH 4 304 17 HOH HOH A . C 3 HOH 5 305 10 HOH HOH A . C 3 HOH 6 306 45 HOH HOH A . C 3 HOH 7 307 38 HOH HOH A . C 3 HOH 8 308 44 HOH HOH A . C 3 HOH 9 309 31 HOH HOH A . C 3 HOH 10 310 42 HOH HOH A . C 3 HOH 11 311 18 HOH HOH A . C 3 HOH 12 312 41 HOH HOH A . C 3 HOH 13 313 11 HOH HOH A . C 3 HOH 14 314 21 HOH HOH A . C 3 HOH 15 315 19 HOH HOH A . C 3 HOH 16 316 29 HOH HOH A . C 3 HOH 17 317 26 HOH HOH A . C 3 HOH 18 318 16 HOH HOH A . C 3 HOH 19 319 20 HOH HOH A . C 3 HOH 20 320 8 HOH HOH A . C 3 HOH 21 321 5 HOH HOH A . C 3 HOH 22 322 30 HOH HOH A . C 3 HOH 23 323 12 HOH HOH A . C 3 HOH 24 324 49 HOH HOH A . C 3 HOH 25 325 13 HOH HOH A . C 3 HOH 26 326 57 HOH HOH A . C 3 HOH 27 327 15 HOH HOH A . C 3 HOH 28 328 54 HOH HOH A . C 3 HOH 29 329 36 HOH HOH A . C 3 HOH 30 330 14 HOH HOH A . C 3 HOH 31 331 46 HOH HOH A . C 3 HOH 32 332 28 HOH HOH A . C 3 HOH 33 333 52 HOH HOH A . C 3 HOH 34 334 23 HOH HOH A . C 3 HOH 35 335 56 HOH HOH A . C 3 HOH 36 336 40 HOH HOH A . C 3 HOH 37 337 43 HOH HOH A . C 3 HOH 38 338 9 HOH HOH A . C 3 HOH 39 339 47 HOH HOH A . C 3 HOH 40 340 32 HOH HOH A . C 3 HOH 41 341 35 HOH HOH A . C 3 HOH 42 342 25 HOH HOH A . C 3 HOH 43 343 1 HOH HOH A . C 3 HOH 44 344 50 HOH HOH A . C 3 HOH 45 345 27 HOH HOH A . C 3 HOH 46 346 7 HOH HOH A . C 3 HOH 47 347 3 HOH HOH A . C 3 HOH 48 348 48 HOH HOH A . C 3 HOH 49 349 22 HOH HOH A . C 3 HOH 50 350 37 HOH HOH A . C 3 HOH 51 351 6 HOH HOH A . C 3 HOH 52 352 55 HOH HOH A . C 3 HOH 53 353 39 HOH HOH A . C 3 HOH 54 354 24 HOH HOH A . C 3 HOH 55 355 34 HOH HOH A . C 3 HOH 56 356 51 HOH HOH A . C 3 HOH 57 357 4 HOH HOH A . C 3 HOH 58 358 53 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLY 1 ? N ? A GLY 1 N 2 1 Y 1 A HIS 189 ? CA ? A HIS 189 CA 3 1 Y 1 A HIS 189 ? C ? A HIS 189 C 4 1 Y 1 A HIS 189 ? O ? A HIS 189 O 5 1 Y 1 A HIS 189 ? CB ? A HIS 189 CB 6 1 Y 1 A HIS 189 ? CG ? A HIS 189 CG 7 1 Y 1 A HIS 189 ? ND1 ? A HIS 189 ND1 8 1 Y 1 A HIS 189 ? CD2 ? A HIS 189 CD2 9 1 Y 1 A HIS 189 ? CE1 ? A HIS 189 CE1 10 1 Y 1 A HIS 189 ? NE2 ? A HIS 189 NE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0425 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . ? 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 29DA _cell.details ? _cell.formula_units_Z ? _cell.length_a 56.210 _cell.length_a_esd ? _cell.length_b 56.210 _cell.length_b_esd ? _cell.length_c 170.660 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 29DA _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 29DA _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.70 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 66.77 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Tris-HCl pH 8, 0.2 M Ammonium acetate, 25% PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 277 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2026-01-09 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0332 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, DESY BEAMLINE P11' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0332 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline P11 _diffrn_source.pdbx_synchrotron_site 'PETRA III, DESY' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 29DA _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.08 _reflns.d_resolution_low 48.68 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 19582 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.87 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.07 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.08 _reflns_shell.d_res_low 2.154 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1930 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.674 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 1.809 _refine.aniso_B[1][2] 0.904 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] 1.809 _refine.aniso_B[2][3] -0.000 _refine.aniso_B[3][3] -5.868 _refine.B_iso_max ? _refine.B_iso_mean 60.368 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.968 _refine.correlation_coeff_Fo_to_Fc_free 0.957 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 29DA _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.080 _refine.ls_d_res_low 48.679 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 19582 _refine.ls_number_reflns_R_free 980 _refine.ls_number_reflns_R_work 18602 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.883 _refine.ls_percent_reflns_R_free 5.005 _refine.ls_R_factor_all 0.202 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2338 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2002 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.151 _refine.pdbx_overall_ESU_R_Free 0.144 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 6.094 _refine.overall_SU_ML 0.147 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1469 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 39 _refine_hist.number_atoms_solvent 58 _refine_hist.number_atoms_total 1566 _refine_hist.d_res_high 2.080 _refine_hist.d_res_low 48.679 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 0.012 1545 ? r_bond_refined_d ? ? ? 'X-RAY DIFFRACTION' ? 0.001 0.016 1436 ? r_bond_other_d ? ? ? 'X-RAY DIFFRACTION' ? 1.775 1.825 2096 ? r_angle_refined_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.677 1.762 3295 ? r_angle_other_deg ? ? ? 'X-RAY DIFFRACTION' ? 7.631 5.000 187 ? r_dihedral_angle_1_deg ? ? ? 'X-RAY DIFFRACTION' ? 7.231 5.000 13 ? r_dihedral_angle_2_deg ? ? ? 'X-RAY DIFFRACTION' ? 5.370 5.000 4 ? r_dihedral_angle_other_2_deg ? ? ? 'X-RAY DIFFRACTION' ? 15.699 10.000 242 ? r_dihedral_angle_3_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.430 10.000 1 ? r_dihedral_angle_other_3_deg ? ? ? 'X-RAY DIFFRACTION' ? 13.868 10.000 71 ? r_dihedral_angle_6_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.097 0.200 235 ? r_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 1818 ? r_gen_planes_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 366 ? r_gen_planes_other ? ? ? 'X-RAY DIFFRACTION' ? 0.202 0.200 270 ? r_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.207 0.200 1302 ? r_symmetry_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? 0.183 0.200 761 ? r_nbtor_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.093 0.200 836 ? r_symmetry_nbtor_other ? ? ? 'X-RAY DIFFRACTION' ? 0.123 0.200 39 ? r_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.233 0.200 8 ? r_symmetry_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.195 0.200 76 ? r_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? 0.178 0.200 2 ? r_symmetry_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 5.065 5.869 751 ? r_mcbond_it ? ? ? 'X-RAY DIFFRACTION' ? 5.064 5.874 752 ? r_mcbond_other ? ? ? 'X-RAY DIFFRACTION' ? 6.796 10.531 938 ? r_mcangle_it ? ? ? 'X-RAY DIFFRACTION' ? 6.786 10.529 938 ? r_mcangle_other ? ? ? 'X-RAY DIFFRACTION' ? 7.150 6.781 794 ? r_scbond_it ? ? ? 'X-RAY DIFFRACTION' ? 7.146 6.776 792 ? r_scbond_other ? ? ? 'X-RAY DIFFRACTION' ? 10.323 12.048 1158 ? r_scangle_it ? ? ? 'X-RAY DIFFRACTION' ? 10.319 12.048 1159 ? r_scangle_other ? ? ? 'X-RAY DIFFRACTION' ? 12.132 59.248 1614 ? r_lrange_it ? ? ? 'X-RAY DIFFRACTION' ? 12.128 59.270 1614 ? r_lrange_other ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.080 2.134 1420 . 71 1347 99.8592 . 0.386 . . 0.386 . . . . . 0.381 . . . . . 20 . 0.863 0.853 0.383 'X-RAY DIFFRACTION' 2.134 2.192 1370 . 69 1298 99.7810 . 0.387 . . 0.384 . . . . . 0.370 . . . . . 20 . 0.853 0.823 0.442 'X-RAY DIFFRACTION' 2.192 2.256 1368 . 68 1297 99.7807 . 0.354 . . 0.353 . . . . . 0.335 . . . . . 20 . 0.878 0.860 0.379 'X-RAY DIFFRACTION' 2.256 2.325 1297 . 65 1231 99.9229 . 0.317 . . 0.315 . . . . . 0.297 . . . . . 20 . 0.908 0.917 0.353 'X-RAY DIFFRACTION' 2.325 2.401 1262 . 63 1198 99.9208 . 0.280 . . 0.275 . . . . . 0.252 . . . . . 20 . 0.935 0.871 0.398 'X-RAY DIFFRACTION' 2.401 2.485 1230 . 61 1168 99.9187 . 0.246 . . 0.244 . . . . . 0.219 . . . . . 20 . 0.955 0.955 0.279 'X-RAY DIFFRACTION' 2.485 2.579 1187 . 60 1127 100.0000 . 0.238 . . 0.236 . . . . . 0.206 . . . . . 20 . 0.961 0.939 0.270 'X-RAY DIFFRACTION' 2.579 2.684 1147 . 57 1088 99.8256 . 0.228 . . 0.225 . . . . . 0.196 . . . . . 20 . 0.967 0.940 0.285 'X-RAY DIFFRACTION' 2.684 2.803 1112 . 55 1057 100.0000 . 0.187 . . 0.185 . . . . . 0.155 . . . . . 20 . 0.978 0.967 0.222 'X-RAY DIFFRACTION' 2.803 2.939 1054 . 53 1001 100.0000 . 0.175 . . 0.171 . . . . . 0.146 . . . . . 20 . 0.981 0.968 0.255 'X-RAY DIFFRACTION' 2.939 3.097 1012 . 51 961 100.0000 . 0.192 . . 0.188 . . . . . 0.164 . . . . . 20 . 0.975 0.947 0.259 'X-RAY DIFFRACTION' 3.097 3.284 963 . 48 915 100.0000 . 0.203 . . 0.201 . . . . . 0.180 . . . . . 20 . 0.974 0.957 0.237 'X-RAY DIFFRACTION' 3.284 3.510 913 . 46 867 100.0000 . 0.212 . . 0.210 . . . . . 0.195 . . . . . 20 . 0.974 0.961 0.241 'X-RAY DIFFRACTION' 3.510 3.789 834 . 41 793 100.0000 . 0.214 . . 0.213 . . . . . 0.200 . . . . . 20 . 0.974 0.972 0.236 'X-RAY DIFFRACTION' 3.789 4.149 781 . 39 742 100.0000 . 0.194 . . 0.193 . . . . . 0.190 . . . . . 20 . 0.979 0.978 0.200 'X-RAY DIFFRACTION' 4.149 4.634 726 . 37 688 99.8623 . 0.148 . . 0.147 . . . . . 0.154 . . . . . 20 . 0.987 0.986 0.171 'X-RAY DIFFRACTION' 4.634 5.343 632 . 31 593 98.7342 . 0.134 . . 0.132 . . . . . 0.148 . . . . . 20 . 0.990 0.985 0.162 'X-RAY DIFFRACTION' 5.343 6.524 560 . 28 532 100.0000 . 0.201 . . 0.196 . . . . . 0.204 . . . . . 20 . 0.981 0.973 0.283 'X-RAY DIFFRACTION' 6.524 9.145 447 . 22 425 100.0000 . 0.205 . . 0.202 . . . . . 0.216 . . . . . 20 . 0.978 0.963 0.269 'X-RAY DIFFRACTION' 9.145 48.679 289 . 15 274 100.0000 . 0.173 . . 0.175 . . . . . 0.208 . . . . . 20 . 0.980 0.982 0.135 # _struct.entry_id 29DA _struct.title 'Crystal structure of enterovirus D68-3Cpro in complex with RK-496' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 29DA _struct_keywords.text '3Cpro, enterovirus, inhibitor, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A1E4A3_HED68 _struct_ref.pdbx_db_accession A1E4A3 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GPGFDFAQAIMKKNTVVARTEKGEFTMLGVHDRVAVIPTHASVGETIYINDVETKVLDACALRDLTDTNLEITIVKLDRN QKFRDIRHFLPRYEDDYNDAVLSVHTSKFPNMYIPVGQVTNYGFLNLGGTPTHRILMYNFPTRAGQCGGVVTTTGKVIGI HVGGNGAQGFAAMLLHSYFTDTQ ; _struct_ref.pdbx_align_begin 1549 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 29DA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 183 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A1E4A3 _struct_ref_seq.db_align_beg 1549 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1731 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 183 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 29DA LYS A 184 ? UNP A1E4A3 ? ? 'expression tag' 184 1 1 29DA HIS A 185 ? UNP A1E4A3 ? ? 'expression tag' 185 2 1 29DA HIS A 186 ? UNP A1E4A3 ? ? 'expression tag' 186 3 1 29DA HIS A 187 ? UNP A1E4A3 ? ? 'expression tag' 187 4 1 29DA HIS A 188 ? UNP A1E4A3 ? ? 'expression tag' 188 5 1 29DA HIS A 189 ? UNP A1E4A3 ? ? 'expression tag' 189 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 9150 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'native gel electrophoresis' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 3 ? ASN A 14 ? GLY A 3 ASN A 14 1 ? 12 HELX_P HELX_P2 AA2 HIS A 40 ? SER A 42 ? HIS A 40 SER A 42 5 ? 3 HELX_P HELX_P3 AA3 ILE A 86 ? LEU A 90 ? ILE A 86 LEU A 90 5 ? 5 HELX_P HELX_P4 AA4 LEU A 175 ? PHE A 179 ? LEU A 175 PHE A 179 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 147 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id A1JQY _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C11 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 147 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id A1JQY _struct_conn.ptnr2_auth_seq_id 201 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.786 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id A1JQY _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 147 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id A1JQY _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 201 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 147 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom C11 _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id A1JQY _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Covalent chemical modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 15 ? THR A 20 ? THR A 15 THR A 20 AA1 2 GLY A 23 ? HIS A 31 ? GLY A 23 HIS A 31 AA1 3 VAL A 34 ? PRO A 38 ? VAL A 34 PRO A 38 AA1 4 ASN A 69 ? ASP A 78 ? ASN A 69 ASP A 78 AA1 5 VAL A 52 ? ARG A 63 ? VAL A 52 ARG A 63 AA1 6 THR A 46 ? ILE A 49 ? THR A 46 ILE A 49 AA1 7 THR A 15 ? THR A 20 ? THR A 15 THR A 20 AA2 1 TYR A 97 ? VAL A 104 ? TYR A 97 VAL A 104 AA2 2 MET A 112 ? LEU A 127 ? MET A 112 LEU A 127 AA2 3 THR A 130 ? TYR A 138 ? THR A 130 TYR A 138 AA2 4 GLY A 169 ? MET A 173 ? GLY A 169 MET A 173 AA2 5 LYS A 156 ? GLY A 164 ? LYS A 156 GLY A 164 AA2 6 VAL A 150 ? THR A 153 ? VAL A 150 THR A 153 AA2 7 TYR A 97 ? VAL A 104 ? TYR A 97 VAL A 104 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ALA A 18 ? N ALA A 18 O PHE A 25 ? O PHE A 25 AA1 2 3 N HIS A 31 ? N HIS A 31 O VAL A 34 ? O VAL A 34 AA1 3 4 N ALA A 35 ? N ALA A 35 O VAL A 75 ? O VAL A 75 AA1 4 5 O ASP A 78 ? O ASP A 78 N LYS A 55 ? N LYS A 55 AA1 5 6 O THR A 54 ? O THR A 54 N ILE A 47 ? N ILE A 47 AA1 6 7 O TYR A 48 ? O TYR A 48 N ARG A 19 ? N ARG A 19 AA2 1 2 N TYR A 97 ? N TYR A 97 O VAL A 119 ? O VAL A 119 AA2 2 3 N THR A 120 ? N THR A 120 O MET A 137 ? O MET A 137 AA2 3 4 N LEU A 136 ? N LEU A 136 O ALA A 171 ? O ALA A 171 AA2 4 5 O PHE A 170 ? O PHE A 170 N VAL A 162 ? N VAL A 162 AA2 5 6 O GLY A 159 ? O GLY A 159 N VAL A 151 ? N VAL A 151 AA2 6 7 O THR A 152 ? O THR A 152 N VAL A 101 ? N VAL A 101 # _pdbx_entry_details.entry_id 29DA _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 79 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 79 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH2 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 79 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 117.15 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation -3.15 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 32 ? ? 47.82 -115.07 2 1 LEU A 65 ? ? -68.52 0.23 3 1 ASN A 111 ? ? -167.15 98.71 4 1 THR A 182 ? ? -126.21 -130.60 5 1 GLN A 183 ? ? -159.22 -156.90 # loop_ _pdbx_validate_chiral.id _pdbx_validate_chiral.PDB_model_num _pdbx_validate_chiral.auth_atom_id _pdbx_validate_chiral.label_alt_id _pdbx_validate_chiral.auth_asym_id _pdbx_validate_chiral.auth_comp_id _pdbx_validate_chiral.auth_seq_id _pdbx_validate_chiral.PDB_ins_code _pdbx_validate_chiral.details _pdbx_validate_chiral.omega 1 1 C8 ? A A1JQY 201 ? 'WRONG HAND' . 2 1 C10 ? A A1JQY 201 ? 'WRONG HAND' . # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 357 ? . 7.14 2 1 O ? A HOH 358 ? 7.79 . # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1JQY N1 N N N 1 A1JQY N3 N N N 2 A1JQY C4 C Y N 3 A1JQY C5 C Y N 4 A1JQY C6 C Y N 5 A1JQY C7 C N N 6 A1JQY C8 C N S 7 A1JQY C10 C N S 8 A1JQY C13 C N S 9 A1JQY C15 C N N 10 A1JQY C17 C N N 11 A1JQY C20 C N N 12 A1JQY C21 C N N 13 A1JQY C22 C N N 14 A1JQY C24 C N N 15 A1JQY C26 C N N 16 A1JQY C1 C Y N 17 A1JQY C2 C Y N 18 A1JQY C3 C Y N 19 A1JQY C9 C N N 20 A1JQY N2 N N N 21 A1JQY O1 O N N 22 A1JQY C11 C N R 23 A1JQY C12 C N N 24 A1JQY C14 C N N 25 A1JQY C16 C N N 26 A1JQY O2 O N N 27 A1JQY O3 O N N 28 A1JQY N4 N N N 29 A1JQY O4 O N N 30 A1JQY C18 C N N 31 A1JQY C19 C N N 32 A1JQY C23 C N N 33 A1JQY N5 N N N 34 A1JQY O5 O N N 35 A1JQY C25 C N N 36 A1JQY F1 F N N 37 A1JQY F2 F N N 38 A1JQY F3 F N N 39 A1JQY H8 H N N 40 A1JQY H19 H N N 41 A1JQY H3 H N N 42 A1JQY H4 H N N 43 A1JQY H5 H N N 44 A1JQY H6 H N N 45 A1JQY H7 H N N 46 A1JQY H10 H N N 47 A1JQY H14 H N N 48 A1JQY H17 H N N 49 A1JQY H18 H N N 50 A1JQY H26 H N N 51 A1JQY H27 H N N 52 A1JQY H28 H N N 53 A1JQY H29 H N N 54 A1JQY H30 H N N 55 A1JQY H31 H N N 56 A1JQY H1 H N N 57 A1JQY H2 H N N 58 A1JQY H9 H N N 59 A1JQY H11 H N N 60 A1JQY H12 H N N 61 A1JQY H13 H N N 62 A1JQY H15 H N N 63 A1JQY H16 H N N 64 A1JQY H20 H N N 65 A1JQY H21 H N N 66 A1JQY H22 H N N 67 A1JQY H23 H N N 68 A1JQY H24 H N N 69 A1JQY H25 H N N 70 A1JQY H32 H N N 71 A1JQY H33 H N N 72 A1JQY H34 H N N 73 A1JQY H35 H N N 74 A1JQY H36 H N N 75 ALA N N N N 76 ALA CA C N S 77 ALA C C N N 78 ALA O O N N 79 ALA CB C N N 80 ALA OXT O N N 81 ALA H H N N 82 ALA H2 H N N 83 ALA HA H N N 84 ALA HB1 H N N 85 ALA HB2 H N N 86 ALA HB3 H N N 87 ALA HXT H N N 88 ARG N N N N 89 ARG CA C N S 90 ARG C C N N 91 ARG O O N N 92 ARG CB C N N 93 ARG CG C N N 94 ARG CD C N N 95 ARG NE N N N 96 ARG CZ C N N 97 ARG NH1 N N N 98 ARG NH2 N N N 99 ARG OXT O N N 100 ARG H H N N 101 ARG H2 H N N 102 ARG HA H N N 103 ARG HB2 H N N 104 ARG HB3 H N N 105 ARG HG2 H N N 106 ARG HG3 H N N 107 ARG HD2 H N N 108 ARG HD3 H N N 109 ARG HE H N N 110 ARG HH11 H N N 111 ARG HH12 H N N 112 ARG HH21 H N N 113 ARG HH22 H N N 114 ARG HXT H N N 115 ASN N N N N 116 ASN CA C N S 117 ASN C C N N 118 ASN O O N N 119 ASN CB C N N 120 ASN CG C N N 121 ASN OD1 O N N 122 ASN ND2 N N N 123 ASN OXT O N N 124 ASN H H N N 125 ASN H2 H N N 126 ASN HA H N N 127 ASN HB2 H N N 128 ASN HB3 H N N 129 ASN HD21 H N N 130 ASN HD22 H N N 131 ASN HXT H N N 132 ASP N N N N 133 ASP CA C N S 134 ASP C C N N 135 ASP O O N N 136 ASP CB C N N 137 ASP CG C N N 138 ASP OD1 O N N 139 ASP OD2 O N N 140 ASP OXT O N N 141 ASP H H N N 142 ASP H2 H N N 143 ASP HA H N N 144 ASP HB2 H N N 145 ASP HB3 H N N 146 ASP HD2 H N N 147 ASP HXT H N N 148 CYS N N N N 149 CYS CA C N R 150 CYS C C N N 151 CYS O O N N 152 CYS CB C N N 153 CYS SG S N N 154 CYS OXT O N N 155 CYS H H N N 156 CYS H2 H N N 157 CYS HA H N N 158 CYS HB2 H N N 159 CYS HB3 H N N 160 CYS HG H N N 161 CYS HXT H N N 162 GLN N N N N 163 GLN CA C N S 164 GLN C C N N 165 GLN O O N N 166 GLN CB C N N 167 GLN CG C N N 168 GLN CD C N N 169 GLN OE1 O N N 170 GLN NE2 N N N 171 GLN OXT O N N 172 GLN H H N N 173 GLN H2 H N N 174 GLN HA H N N 175 GLN HB2 H N N 176 GLN HB3 H N N 177 GLN HG2 H N N 178 GLN HG3 H N N 179 GLN HE21 H N N 180 GLN HE22 H N N 181 GLN HXT H N N 182 GLU N N N N 183 GLU CA C N S 184 GLU C C N N 185 GLU O O N N 186 GLU CB C N N 187 GLU CG C N N 188 GLU CD C N N 189 GLU OE1 O N N 190 GLU OE2 O N N 191 GLU OXT O N N 192 GLU H H N N 193 GLU H2 H N N 194 GLU HA H N N 195 GLU HB2 H N N 196 GLU HB3 H N N 197 GLU HG2 H N N 198 GLU HG3 H N N 199 GLU HE2 H N N 200 GLU HXT H N N 201 GLY N N N N 202 GLY CA C N N 203 GLY C C N N 204 GLY O O N N 205 GLY OXT O N N 206 GLY H H N N 207 GLY H2 H N N 208 GLY HA2 H N N 209 GLY HA3 H N N 210 GLY HXT H N N 211 HIS N N N N 212 HIS CA C N S 213 HIS C C N N 214 HIS O O N N 215 HIS CB C N N 216 HIS CG C Y N 217 HIS ND1 N Y N 218 HIS CD2 C Y N 219 HIS CE1 C Y N 220 HIS NE2 N Y N 221 HIS OXT O N N 222 HIS H H N N 223 HIS H2 H N N 224 HIS HA H N N 225 HIS HB2 H N N 226 HIS HB3 H N N 227 HIS HD1 H N N 228 HIS HD2 H N N 229 HIS HE1 H N N 230 HIS HE2 H N N 231 HIS HXT H N N 232 HOH O O N N 233 HOH H1 H N N 234 HOH H2 H N N 235 ILE N N N N 236 ILE CA C N S 237 ILE C C N N 238 ILE O O N N 239 ILE CB C N S 240 ILE CG1 C N N 241 ILE CG2 C N N 242 ILE CD1 C N N 243 ILE OXT O N N 244 ILE H H N N 245 ILE H2 H N N 246 ILE HA H N N 247 ILE HB H N N 248 ILE HG12 H N N 249 ILE HG13 H N N 250 ILE HG21 H N N 251 ILE HG22 H N N 252 ILE HG23 H N N 253 ILE HD11 H N N 254 ILE HD12 H N N 255 ILE HD13 H N N 256 ILE HXT H N N 257 LEU N N N N 258 LEU CA C N S 259 LEU C C N N 260 LEU O O N N 261 LEU CB C N N 262 LEU CG C N N 263 LEU CD1 C N N 264 LEU CD2 C N N 265 LEU OXT O N N 266 LEU H H N N 267 LEU H2 H N N 268 LEU HA H N N 269 LEU HB2 H N N 270 LEU HB3 H N N 271 LEU HG H N N 272 LEU HD11 H N N 273 LEU HD12 H N N 274 LEU HD13 H N N 275 LEU HD21 H N N 276 LEU HD22 H N N 277 LEU HD23 H N N 278 LEU HXT H N N 279 LYS N N N N 280 LYS CA C N S 281 LYS C C N N 282 LYS O O N N 283 LYS CB C N N 284 LYS CG C N N 285 LYS CD C N N 286 LYS CE C N N 287 LYS NZ N N N 288 LYS OXT O N N 289 LYS H H N N 290 LYS H2 H N N 291 LYS HA H N N 292 LYS HB2 H N N 293 LYS HB3 H N N 294 LYS HG2 H N N 295 LYS HG3 H N N 296 LYS HD2 H N N 297 LYS HD3 H N N 298 LYS HE2 H N N 299 LYS HE3 H N N 300 LYS HZ1 H N N 301 LYS HZ2 H N N 302 LYS HZ3 H N N 303 LYS HXT H N N 304 MET N N N N 305 MET CA C N S 306 MET C C N N 307 MET O O N N 308 MET CB C N N 309 MET CG C N N 310 MET SD S N N 311 MET CE C N N 312 MET OXT O N N 313 MET H H N N 314 MET H2 H N N 315 MET HA H N N 316 MET HB2 H N N 317 MET HB3 H N N 318 MET HG2 H N N 319 MET HG3 H N N 320 MET HE1 H N N 321 MET HE2 H N N 322 MET HE3 H N N 323 MET HXT H N N 324 PHE N N N N 325 PHE CA C N S 326 PHE C C N N 327 PHE O O N N 328 PHE CB C N N 329 PHE CG C Y N 330 PHE CD1 C Y N 331 PHE CD2 C Y N 332 PHE CE1 C Y N 333 PHE CE2 C Y N 334 PHE CZ C Y N 335 PHE OXT O N N 336 PHE H H N N 337 PHE H2 H N N 338 PHE HA H N N 339 PHE HB2 H N N 340 PHE HB3 H N N 341 PHE HD1 H N N 342 PHE HD2 H N N 343 PHE HE1 H N N 344 PHE HE2 H N N 345 PHE HZ H N N 346 PHE HXT H N N 347 PRO N N N N 348 PRO CA C N S 349 PRO C C N N 350 PRO O O N N 351 PRO CB C N N 352 PRO CG C N N 353 PRO CD C N N 354 PRO OXT O N N 355 PRO H H N N 356 PRO HA H N N 357 PRO HB2 H N N 358 PRO HB3 H N N 359 PRO HG2 H N N 360 PRO HG3 H N N 361 PRO HD2 H N N 362 PRO HD3 H N N 363 PRO HXT H N N 364 SER N N N N 365 SER CA C N S 366 SER C C N N 367 SER O O N N 368 SER CB C N N 369 SER OG O N N 370 SER OXT O N N 371 SER H H N N 372 SER H2 H N N 373 SER HA H N N 374 SER HB2 H N N 375 SER HB3 H N N 376 SER HG H N N 377 SER HXT H N N 378 THR N N N N 379 THR CA C N S 380 THR C C N N 381 THR O O N N 382 THR CB C N R 383 THR OG1 O N N 384 THR CG2 C N N 385 THR OXT O N N 386 THR H H N N 387 THR H2 H N N 388 THR HA H N N 389 THR HB H N N 390 THR HG1 H N N 391 THR HG21 H N N 392 THR HG22 H N N 393 THR HG23 H N N 394 THR HXT H N N 395 TYR N N N N 396 TYR CA C N S 397 TYR C C N N 398 TYR O O N N 399 TYR CB C N N 400 TYR CG C Y N 401 TYR CD1 C Y N 402 TYR CD2 C Y N 403 TYR CE1 C Y N 404 TYR CE2 C Y N 405 TYR CZ C Y N 406 TYR OH O N N 407 TYR OXT O N N 408 TYR H H N N 409 TYR H2 H N N 410 TYR HA H N N 411 TYR HB2 H N N 412 TYR HB3 H N N 413 TYR HD1 H N N 414 TYR HD2 H N N 415 TYR HE1 H N N 416 TYR HE2 H N N 417 TYR HH H N N 418 TYR HXT H N N 419 VAL N N N N 420 VAL CA C N S 421 VAL C C N N 422 VAL O O N N 423 VAL CB C N N 424 VAL CG1 C N N 425 VAL CG2 C N N 426 VAL OXT O N N 427 VAL H H N N 428 VAL H2 H N N 429 VAL HA H N N 430 VAL HB H N N 431 VAL HG11 H N N 432 VAL HG12 H N N 433 VAL HG13 H N N 434 VAL HG21 H N N 435 VAL HG22 H N N 436 VAL HG23 H N N 437 VAL HXT H N N 438 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1JQY C1 C2 doub Y N 1 A1JQY C2 C3 sing Y N 2 A1JQY C3 C4 doub Y N 3 A1JQY C4 C5 sing Y N 4 A1JQY C5 C6 doub Y N 5 A1JQY C1 C6 sing Y N 6 A1JQY C6 C7 sing N N 7 A1JQY C7 C8 sing N N 8 A1JQY C8 C9 sing N N 9 A1JQY C8 N1 sing N N 10 A1JQY C9 N2 sing N N 11 A1JQY C9 O1 doub N N 12 A1JQY N2 C10 sing N N 13 A1JQY C10 C11 sing N N 14 A1JQY C10 C12 sing N N 15 A1JQY C12 C13 sing N N 16 A1JQY C13 C14 sing N N 17 A1JQY C14 C15 sing N N 18 A1JQY C15 N3 sing N N 19 A1JQY N3 C16 sing N N 20 A1JQY C13 C16 sing N N 21 A1JQY C16 O2 doub N N 22 A1JQY C11 C17 sing N N 23 A1JQY C17 O3 doub N N 24 A1JQY C17 N4 sing N N 25 A1JQY C11 O4 sing N N 26 A1JQY C2 C18 sing N N 27 A1JQY C18 C19 sing N N 28 A1JQY C19 C20 sing N N 29 A1JQY C20 C21 sing N N 30 A1JQY C21 C22 sing N N 31 A1JQY C22 C23 sing N N 32 A1JQY N4 C23 sing N N 33 A1JQY N1 C24 sing N N 34 A1JQY C24 N5 sing N N 35 A1JQY C24 O5 doub N N 36 A1JQY N5 C25 sing N N 37 A1JQY C25 C26 sing N N 38 A1JQY C26 F1 sing N N 39 A1JQY C26 F2 sing N N 40 A1JQY C26 F3 sing N N 41 A1JQY N1 H8 sing N N 42 A1JQY N3 H19 sing N N 43 A1JQY C4 H3 sing N N 44 A1JQY C5 H4 sing N N 45 A1JQY C7 H5 sing N N 46 A1JQY C7 H6 sing N N 47 A1JQY C8 H7 sing N N 48 A1JQY C10 H10 sing N N 49 A1JQY C13 H14 sing N N 50 A1JQY C15 H17 sing N N 51 A1JQY C15 H18 sing N N 52 A1JQY C20 H26 sing N N 53 A1JQY C20 H27 sing N N 54 A1JQY C21 H28 sing N N 55 A1JQY C21 H29 sing N N 56 A1JQY C22 H30 sing N N 57 A1JQY C22 H31 sing N N 58 A1JQY C1 H1 sing N N 59 A1JQY C3 H2 sing N N 60 A1JQY N2 H9 sing N N 61 A1JQY C11 H11 sing N N 62 A1JQY C12 H12 sing N N 63 A1JQY C12 H13 sing N N 64 A1JQY C14 H15 sing N N 65 A1JQY C14 H16 sing N N 66 A1JQY N4 H20 sing N N 67 A1JQY O4 H21 sing N N 68 A1JQY C18 H22 sing N N 69 A1JQY C18 H23 sing N N 70 A1JQY C19 H24 sing N N 71 A1JQY C19 H25 sing N N 72 A1JQY C23 H32 sing N N 73 A1JQY C23 H33 sing N N 74 A1JQY N5 H34 sing N N 75 A1JQY C25 H35 sing N N 76 A1JQY C25 H36 sing N N 77 ALA N CA sing N N 78 ALA N H sing N N 79 ALA N H2 sing N N 80 ALA CA C sing N N 81 ALA CA CB sing N N 82 ALA CA HA sing N N 83 ALA C O doub N N 84 ALA C OXT sing N N 85 ALA CB HB1 sing N N 86 ALA CB HB2 sing N N 87 ALA CB HB3 sing N N 88 ALA OXT HXT sing N N 89 ARG N CA sing N N 90 ARG N H sing N N 91 ARG N H2 sing N N 92 ARG CA C sing N N 93 ARG CA CB sing N N 94 ARG CA HA sing N N 95 ARG C O doub N N 96 ARG C OXT sing N N 97 ARG CB CG sing N N 98 ARG CB HB2 sing N N 99 ARG CB HB3 sing N N 100 ARG CG CD sing N N 101 ARG CG HG2 sing N N 102 ARG CG HG3 sing N N 103 ARG CD NE sing N N 104 ARG CD HD2 sing N N 105 ARG CD HD3 sing N N 106 ARG NE CZ sing N N 107 ARG NE HE sing N N 108 ARG CZ NH1 sing N N 109 ARG CZ NH2 doub N N 110 ARG NH1 HH11 sing N N 111 ARG NH1 HH12 sing N N 112 ARG NH2 HH21 sing N N 113 ARG NH2 HH22 sing N N 114 ARG OXT HXT sing N N 115 ASN N CA sing N N 116 ASN N H sing N N 117 ASN N H2 sing N N 118 ASN CA C sing N N 119 ASN CA CB sing N N 120 ASN CA HA sing N N 121 ASN C O doub N N 122 ASN C OXT sing N N 123 ASN CB CG sing N N 124 ASN CB HB2 sing N N 125 ASN CB HB3 sing N N 126 ASN CG OD1 doub N N 127 ASN CG ND2 sing N N 128 ASN ND2 HD21 sing N N 129 ASN ND2 HD22 sing N N 130 ASN OXT HXT sing N N 131 ASP N CA sing N N 132 ASP N H sing N N 133 ASP N H2 sing N N 134 ASP CA C sing N N 135 ASP CA CB sing N N 136 ASP CA HA sing N N 137 ASP C O doub N N 138 ASP C OXT sing N N 139 ASP CB CG sing N N 140 ASP CB HB2 sing N N 141 ASP CB HB3 sing N N 142 ASP CG OD1 doub N N 143 ASP CG OD2 sing N N 144 ASP OD2 HD2 sing N N 145 ASP OXT HXT sing N N 146 CYS N CA sing N N 147 CYS N H sing N N 148 CYS N H2 sing N N 149 CYS CA C sing N N 150 CYS CA CB sing N N 151 CYS CA HA sing N N 152 CYS C O doub N N 153 CYS C OXT sing N N 154 CYS CB SG sing N N 155 CYS CB HB2 sing N N 156 CYS CB HB3 sing N N 157 CYS SG HG sing N N 158 CYS OXT HXT sing N N 159 GLN N CA sing N N 160 GLN N H sing N N 161 GLN N H2 sing N N 162 GLN CA C sing N N 163 GLN CA CB sing N N 164 GLN CA HA sing N N 165 GLN C O doub N N 166 GLN C OXT sing N N 167 GLN CB CG sing N N 168 GLN CB HB2 sing N N 169 GLN CB HB3 sing N N 170 GLN CG CD sing N N 171 GLN CG HG2 sing N N 172 GLN CG HG3 sing N N 173 GLN CD OE1 doub N N 174 GLN CD NE2 sing N N 175 GLN NE2 HE21 sing N N 176 GLN NE2 HE22 sing N N 177 GLN OXT HXT sing N N 178 GLU N CA sing N N 179 GLU N H sing N N 180 GLU N H2 sing N N 181 GLU CA C sing N N 182 GLU CA CB sing N N 183 GLU CA HA sing N N 184 GLU C O doub N N 185 GLU C OXT sing N N 186 GLU CB CG sing N N 187 GLU CB HB2 sing N N 188 GLU CB HB3 sing N N 189 GLU CG CD sing N N 190 GLU CG HG2 sing N N 191 GLU CG HG3 sing N N 192 GLU CD OE1 doub N N 193 GLU CD OE2 sing N N 194 GLU OE2 HE2 sing N N 195 GLU OXT HXT sing N N 196 GLY N CA sing N N 197 GLY N H sing N N 198 GLY N H2 sing N N 199 GLY CA C sing N N 200 GLY CA HA2 sing N N 201 GLY CA HA3 sing N N 202 GLY C O doub N N 203 GLY C OXT sing N N 204 GLY OXT HXT sing N N 205 HIS N CA sing N N 206 HIS N H sing N N 207 HIS N H2 sing N N 208 HIS CA C sing N N 209 HIS CA CB sing N N 210 HIS CA HA sing N N 211 HIS C O doub N N 212 HIS C OXT sing N N 213 HIS CB CG sing N N 214 HIS CB HB2 sing N N 215 HIS CB HB3 sing N N 216 HIS CG ND1 sing Y N 217 HIS CG CD2 doub Y N 218 HIS ND1 CE1 doub Y N 219 HIS ND1 HD1 sing N N 220 HIS CD2 NE2 sing Y N 221 HIS CD2 HD2 sing N N 222 HIS CE1 NE2 sing Y N 223 HIS CE1 HE1 sing N N 224 HIS NE2 HE2 sing N N 225 HIS OXT HXT sing N N 226 HOH O H1 sing N N 227 HOH O H2 sing N N 228 ILE N CA sing N N 229 ILE N H sing N N 230 ILE N H2 sing N N 231 ILE CA C sing N N 232 ILE CA CB sing N N 233 ILE CA HA sing N N 234 ILE C O doub N N 235 ILE C OXT sing N N 236 ILE CB CG1 sing N N 237 ILE CB CG2 sing N N 238 ILE CB HB sing N N 239 ILE CG1 CD1 sing N N 240 ILE CG1 HG12 sing N N 241 ILE CG1 HG13 sing N N 242 ILE CG2 HG21 sing N N 243 ILE CG2 HG22 sing N N 244 ILE CG2 HG23 sing N N 245 ILE CD1 HD11 sing N N 246 ILE CD1 HD12 sing N N 247 ILE CD1 HD13 sing N N 248 ILE OXT HXT sing N N 249 LEU N CA sing N N 250 LEU N H sing N N 251 LEU N H2 sing N N 252 LEU CA C sing N N 253 LEU CA CB sing N N 254 LEU CA HA sing N N 255 LEU C O doub N N 256 LEU C OXT sing N N 257 LEU CB CG sing N N 258 LEU CB HB2 sing N N 259 LEU CB HB3 sing N N 260 LEU CG CD1 sing N N 261 LEU CG CD2 sing N N 262 LEU CG HG sing N N 263 LEU CD1 HD11 sing N N 264 LEU CD1 HD12 sing N N 265 LEU CD1 HD13 sing N N 266 LEU CD2 HD21 sing N N 267 LEU CD2 HD22 sing N N 268 LEU CD2 HD23 sing N N 269 LEU OXT HXT sing N N 270 LYS N CA sing N N 271 LYS N H sing N N 272 LYS N H2 sing N N 273 LYS CA C sing N N 274 LYS CA CB sing N N 275 LYS CA HA sing N N 276 LYS C O doub N N 277 LYS C OXT sing N N 278 LYS CB CG sing N N 279 LYS CB HB2 sing N N 280 LYS CB HB3 sing N N 281 LYS CG CD sing N N 282 LYS CG HG2 sing N N 283 LYS CG HG3 sing N N 284 LYS CD CE sing N N 285 LYS CD HD2 sing N N 286 LYS CD HD3 sing N N 287 LYS CE NZ sing N N 288 LYS CE HE2 sing N N 289 LYS CE HE3 sing N N 290 LYS NZ HZ1 sing N N 291 LYS NZ HZ2 sing N N 292 LYS NZ HZ3 sing N N 293 LYS OXT HXT sing N N 294 MET N CA sing N N 295 MET N H sing N N 296 MET N H2 sing N N 297 MET CA C sing N N 298 MET CA CB sing N N 299 MET CA HA sing N N 300 MET C O doub N N 301 MET C OXT sing N N 302 MET CB CG sing N N 303 MET CB HB2 sing N N 304 MET CB HB3 sing N N 305 MET CG SD sing N N 306 MET CG HG2 sing N N 307 MET CG HG3 sing N N 308 MET SD CE sing N N 309 MET CE HE1 sing N N 310 MET CE HE2 sing N N 311 MET CE HE3 sing N N 312 MET OXT HXT sing N N 313 PHE N CA sing N N 314 PHE N H sing N N 315 PHE N H2 sing N N 316 PHE CA C sing N N 317 PHE CA CB sing N N 318 PHE CA HA sing N N 319 PHE C O doub N N 320 PHE C OXT sing N N 321 PHE CB CG sing N N 322 PHE CB HB2 sing N N 323 PHE CB HB3 sing N N 324 PHE CG CD1 doub Y N 325 PHE CG CD2 sing Y N 326 PHE CD1 CE1 sing Y N 327 PHE CD1 HD1 sing N N 328 PHE CD2 CE2 doub Y N 329 PHE CD2 HD2 sing N N 330 PHE CE1 CZ doub Y N 331 PHE CE1 HE1 sing N N 332 PHE CE2 CZ sing Y N 333 PHE CE2 HE2 sing N N 334 PHE CZ HZ sing N N 335 PHE OXT HXT sing N N 336 PRO N CA sing N N 337 PRO N CD sing N N 338 PRO N H sing N N 339 PRO CA C sing N N 340 PRO CA CB sing N N 341 PRO CA HA sing N N 342 PRO C O doub N N 343 PRO C OXT sing N N 344 PRO CB CG sing N N 345 PRO CB HB2 sing N N 346 PRO CB HB3 sing N N 347 PRO CG CD sing N N 348 PRO CG HG2 sing N N 349 PRO CG HG3 sing N N 350 PRO CD HD2 sing N N 351 PRO CD HD3 sing N N 352 PRO OXT HXT sing N N 353 SER N CA sing N N 354 SER N H sing N N 355 SER N H2 sing N N 356 SER CA C sing N N 357 SER CA CB sing N N 358 SER CA HA sing N N 359 SER C O doub N N 360 SER C OXT sing N N 361 SER CB OG sing N N 362 SER CB HB2 sing N N 363 SER CB HB3 sing N N 364 SER OG HG sing N N 365 SER OXT HXT sing N N 366 THR N CA sing N N 367 THR N H sing N N 368 THR N H2 sing N N 369 THR CA C sing N N 370 THR CA CB sing N N 371 THR CA HA sing N N 372 THR C O doub N N 373 THR C OXT sing N N 374 THR CB OG1 sing N N 375 THR CB CG2 sing N N 376 THR CB HB sing N N 377 THR OG1 HG1 sing N N 378 THR CG2 HG21 sing N N 379 THR CG2 HG22 sing N N 380 THR CG2 HG23 sing N N 381 THR OXT HXT sing N N 382 TYR N CA sing N N 383 TYR N H sing N N 384 TYR N H2 sing N N 385 TYR CA C sing N N 386 TYR CA CB sing N N 387 TYR CA HA sing N N 388 TYR C O doub N N 389 TYR C OXT sing N N 390 TYR CB CG sing N N 391 TYR CB HB2 sing N N 392 TYR CB HB3 sing N N 393 TYR CG CD1 doub Y N 394 TYR CG CD2 sing Y N 395 TYR CD1 CE1 sing Y N 396 TYR CD1 HD1 sing N N 397 TYR CD2 CE2 doub Y N 398 TYR CD2 HD2 sing N N 399 TYR CE1 CZ doub Y N 400 TYR CE1 HE1 sing N N 401 TYR CE2 CZ sing Y N 402 TYR CE2 HE2 sing N N 403 TYR CZ OH sing N N 404 TYR OH HH sing N N 405 TYR OXT HXT sing N N 406 VAL N CA sing N N 407 VAL N H sing N N 408 VAL N H2 sing N N 409 VAL CA C sing N N 410 VAL CA CB sing N N 411 VAL CA HA sing N N 412 VAL C O doub N N 413 VAL C OXT sing N N 414 VAL CB CG1 sing N N 415 VAL CB CG2 sing N N 416 VAL CB HB sing N N 417 VAL CG1 HG11 sing N N 418 VAL CG1 HG12 sing N N 419 VAL CG1 HG13 sing N N 420 VAL CG2 HG21 sing N N 421 VAL CG2 HG22 sing N N 422 VAL CG2 HG23 sing N N 423 VAL OXT HXT sing N N 424 # _pdbx_audit_support.funding_organization 'European Commission' _pdbx_audit_support.country 'European Union' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3zv8 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 29DA _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.017790 _atom_sites.fract_transf_matrix[1][2] 0.010271 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020543 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005860 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.3103 20.8439 1.0201 10.2075 1.5888 0.5687 0.8651 51.6512 0.2156 F 9 9 3.5395 10.2825 2.6414 4.2944 1.5171 0.2615 1.0244 26.1476 0.3080 H 1 1 0.4930 10.5109 0.3229 26.1257 0.1402 3.1424 0.0408 57.7997 0.0030 N 7 7 12.2220 0.0057 3.1346 9.8933 2.0141 28.9975 1.1672 0.5826 -11.5379 O 8 8 3.0487 13.2771 2.2870 5.7011 1.5464 0.3239 0.8671 32.9089 0.2508 S 16 16 6.9054 1.4679 5.2035 22.2151 1.4379 0.2536 1.5863 56.1720 1.0650 # loop_ #