data_29GE # _entry.id 29GE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.416 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 29GE pdb_000029ge 10.2210/pdb29ge/pdb WWPDB D_1292155095 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-08-26 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 29GE _pdbx_database_status.recvd_initial_deposition_date 2026-03-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 3 _pdbx_contact_author.email Caflisch@bioc.uzh.ch _pdbx_contact_author.name_first Amedeo _pdbx_contact_author.name_last Caflisch _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-2317-6792 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Nai, F.' 1 0000-0002-4258-3174 'Bobileva, O.' 2 0000-0001-9600-1603 'Caflisch, A.' 3 0000-0002-2317-6792 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Adenosine 5'-Carboxamide-Based Inhibitors of METTL1 ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nai, F.' 1 0000-0002-4258-3174 primary 'Bobileva, O.' 2 0000-0001-9600-1603 primary 'Caflisch, A.' 3 0000-0002-2317-6792 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'tRNA (guanine-N(7)-)-methyltransferase' 29178.330 1 2.1.1.33,2.1.1.- ? ? ? 2 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 4 non-polymer syn ;[(2~{S},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]-[4-[[2,4-bis(oxidanyl)phenyl]methyl]piperazin-1-yl]methanone ; 471.467 1 ? ? ? ? 5 non-polymer nat 'SULFATE ION' 96.063 1 ? ? ? ? 6 water nat water 18.015 9 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Methyltransferase-like protein 1,mRNA (guanine-N(7)-)-methyltransferase,miRNA (guanine-N(7)-)-methyltransferase,tRNA (guanine(46)-N(7))-methyltransferase,tRNA(m7G46)-methyltransferase ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHSSGRENLYFQGDHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVE LSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKW RIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFP AIFRRIQDPVLQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHSSGRENLYFQGDHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVE LSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKW RIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFP AIFRRIQDPVLQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'DI(HYDROXYETHYL)ETHER' PEG 3 GLYCEROL GOL 4 ;[(2~{S},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]-[4-[[2,4-bis(oxidanyl)phenyl]methyl]piperazin-1-yl]methanone ; A1J17 5 'SULFATE ION' SO4 6 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 SER n 1 9 SER n 1 10 GLY n 1 11 ARG n 1 12 GLU n 1 13 ASN n 1 14 LEU n 1 15 TYR n 1 16 PHE n 1 17 GLN n 1 18 GLY n 1 19 ASP n 1 20 HIS n 1 21 THR n 1 22 LEU n 1 23 ARG n 1 24 TYR n 1 25 PRO n 1 26 VAL n 1 27 LYS n 1 28 PRO n 1 29 GLU n 1 30 GLU n 1 31 MET n 1 32 ASP n 1 33 TRP n 1 34 SER n 1 35 GLU n 1 36 LEU n 1 37 TYR n 1 38 PRO n 1 39 GLU n 1 40 PHE n 1 41 PHE n 1 42 ALA n 1 43 PRO n 1 44 LEU n 1 45 THR n 1 46 GLN n 1 47 ASN n 1 48 GLN n 1 49 SER n 1 50 HIS n 1 51 ASP n 1 52 ASP n 1 53 PRO n 1 54 LYS n 1 55 ASP n 1 56 LYS n 1 57 LYS n 1 58 GLU n 1 59 LYS n 1 60 ARG n 1 61 ALA n 1 62 GLN n 1 63 ALA n 1 64 GLN n 1 65 VAL n 1 66 GLU n 1 67 PHE n 1 68 ALA n 1 69 ASP n 1 70 ILE n 1 71 GLY n 1 72 CYS n 1 73 GLY n 1 74 TYR n 1 75 GLY n 1 76 GLY n 1 77 LEU n 1 78 LEU n 1 79 VAL n 1 80 GLU n 1 81 LEU n 1 82 SER n 1 83 PRO n 1 84 LEU n 1 85 PHE n 1 86 PRO n 1 87 ASP n 1 88 THR n 1 89 LEU n 1 90 ILE n 1 91 LEU n 1 92 GLY n 1 93 LEU n 1 94 GLU n 1 95 ILE n 1 96 ARG n 1 97 VAL n 1 98 LYS n 1 99 VAL n 1 100 SER n 1 101 ASP n 1 102 TYR n 1 103 VAL n 1 104 GLN n 1 105 ASP n 1 106 ARG n 1 107 ILE n 1 108 ARG n 1 109 ALA n 1 110 LEU n 1 111 ARG n 1 112 ALA n 1 113 ALA n 1 114 PRO n 1 115 ALA n 1 116 GLY n 1 117 GLY n 1 118 PHE n 1 119 GLN n 1 120 ASN n 1 121 ILE n 1 122 ALA n 1 123 CYS n 1 124 LEU n 1 125 ARG n 1 126 SER n 1 127 ASN n 1 128 ALA n 1 129 MET n 1 130 LYS n 1 131 HIS n 1 132 LEU n 1 133 PRO n 1 134 ASN n 1 135 PHE n 1 136 PHE n 1 137 TYR n 1 138 LYS n 1 139 GLY n 1 140 GLN n 1 141 LEU n 1 142 THR n 1 143 LYS n 1 144 MET n 1 145 PHE n 1 146 PHE n 1 147 LEU n 1 148 PHE n 1 149 PRO n 1 150 ASP n 1 151 PRO n 1 152 HIS n 1 153 PHE n 1 154 LYS n 1 155 ARG n 1 156 THR n 1 157 LYS n 1 158 HIS n 1 159 LYS n 1 160 TRP n 1 161 ARG n 1 162 ILE n 1 163 ILE n 1 164 SER n 1 165 PRO n 1 166 THR n 1 167 LEU n 1 168 LEU n 1 169 ALA n 1 170 GLU n 1 171 TYR n 1 172 ALA n 1 173 TYR n 1 174 VAL n 1 175 LEU n 1 176 ARG n 1 177 VAL n 1 178 GLY n 1 179 GLY n 1 180 LEU n 1 181 VAL n 1 182 TYR n 1 183 THR n 1 184 ILE n 1 185 THR n 1 186 ASP n 1 187 VAL n 1 188 LEU n 1 189 GLU n 1 190 LEU n 1 191 HIS n 1 192 ASP n 1 193 TRP n 1 194 MET n 1 195 CYS n 1 196 THR n 1 197 HIS n 1 198 PHE n 1 199 GLU n 1 200 GLU n 1 201 HIS n 1 202 PRO n 1 203 LEU n 1 204 PHE n 1 205 GLU n 1 206 ARG n 1 207 VAL n 1 208 PRO n 1 209 LEU n 1 210 GLU n 1 211 ASP n 1 212 LEU n 1 213 SER n 1 214 GLU n 1 215 ASP n 1 216 PRO n 1 217 VAL n 1 218 VAL n 1 219 GLY n 1 220 HIS n 1 221 LEU n 1 222 GLY n 1 223 THR n 1 224 SER n 1 225 THR n 1 226 GLU n 1 227 GLU n 1 228 GLY n 1 229 LYS n 1 230 LYS n 1 231 VAL n 1 232 LEU n 1 233 ARG n 1 234 ASN n 1 235 GLY n 1 236 GLY n 1 237 LYS n 1 238 ASN n 1 239 PHE n 1 240 PRO n 1 241 ALA n 1 242 ILE n 1 243 PHE n 1 244 ARG n 1 245 ARG n 1 246 ILE n 1 247 GLN n 1 248 ASP n 1 249 PRO n 1 250 VAL n 1 251 LEU n 1 252 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 252 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'METTL1, C12orf1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1J17 non-polymer . ;[(2~{S},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]-[4-[[2,4-bis(oxidanyl)phenyl]methyl]piperazin-1-yl]methanone ; ? 'C21 H25 N7 O6' 471.467 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PEG non-polymer . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3' 106.120 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -16 ? ? ? A . n A 1 2 HIS 2 -15 ? ? ? A . n A 1 3 HIS 3 -14 ? ? ? A . n A 1 4 HIS 4 -13 ? ? ? A . n A 1 5 HIS 5 -12 ? ? ? A . n A 1 6 HIS 6 -11 ? ? ? A . n A 1 7 HIS 7 -10 ? ? ? A . n A 1 8 SER 8 -9 ? ? ? A . n A 1 9 SER 9 -8 ? ? ? A . n A 1 10 GLY 10 -7 ? ? ? A . n A 1 11 ARG 11 -6 ? ? ? A . n A 1 12 GLU 12 -5 ? ? ? A . n A 1 13 ASN 13 -4 ? ? ? A . n A 1 14 LEU 14 -3 ? ? ? A . n A 1 15 TYR 15 -2 ? ? ? A . n A 1 16 PHE 16 -1 ? ? ? A . n A 1 17 GLN 17 0 ? ? ? A . n A 1 18 GLY 18 1 ? ? ? A . n A 1 19 ASP 19 2 ? ? ? A . n A 1 20 HIS 20 3 ? ? ? A . n A 1 21 THR 21 4 ? ? ? A . n A 1 22 LEU 22 5 ? ? ? A . n A 1 23 ARG 23 6 ? ? ? A . n A 1 24 TYR 24 7 7 TYR TYR A . n A 1 25 PRO 25 8 8 PRO PRO A . n A 1 26 VAL 26 9 9 VAL VAL A . n A 1 27 LYS 27 10 10 LYS LYS A . n A 1 28 PRO 28 11 11 PRO PRO A . n A 1 29 GLU 29 12 12 GLU GLU A . n A 1 30 GLU 30 13 13 GLU GLU A . n A 1 31 MET 31 14 14 MET MET A . n A 1 32 ASP 32 15 15 ASP ASP A . n A 1 33 TRP 33 16 16 TRP TRP A . n A 1 34 SER 34 17 17 SER SER A . n A 1 35 GLU 35 18 18 GLU GLU A . n A 1 36 LEU 36 19 19 LEU LEU A . n A 1 37 TYR 37 20 20 TYR TYR A . n A 1 38 PRO 38 21 21 PRO PRO A . n A 1 39 GLU 39 22 22 GLU GLU A . n A 1 40 PHE 40 23 23 PHE PHE A . n A 1 41 PHE 41 24 ? ? ? A . n A 1 42 ALA 42 25 ? ? ? A . n A 1 43 PRO 43 26 ? ? ? A . n A 1 44 LEU 44 27 ? ? ? A . n A 1 45 THR 45 28 ? ? ? A . n A 1 46 GLN 46 29 ? ? ? A . n A 1 47 ASN 47 30 ? ? ? A . n A 1 48 GLN 48 31 ? ? ? A . n A 1 49 SER 49 32 ? ? ? A . n A 1 50 HIS 50 33 ? ? ? A . n A 1 51 ASP 51 34 ? ? ? A . n A 1 52 ASP 52 35 ? ? ? A . n A 1 53 PRO 53 36 ? ? ? A . n A 1 54 LYS 54 37 ? ? ? A . n A 1 55 ASP 55 38 ? ? ? A . n A 1 56 LYS 56 39 ? ? ? A . n A 1 57 LYS 57 40 ? ? ? A . n A 1 58 GLU 58 41 ? ? ? A . n A 1 59 LYS 59 42 ? ? ? A . n A 1 60 ARG 60 43 ? ? ? A . n A 1 61 ALA 61 44 44 ALA ALA A . n A 1 62 GLN 62 45 45 GLN GLN A . n A 1 63 ALA 63 46 46 ALA ALA A . n A 1 64 GLN 64 47 47 GLN GLN A . n A 1 65 VAL 65 48 48 VAL VAL A . n A 1 66 GLU 66 49 49 GLU GLU A . n A 1 67 PHE 67 50 50 PHE PHE A . n A 1 68 ALA 68 51 51 ALA ALA A . n A 1 69 ASP 69 52 52 ASP ASP A . n A 1 70 ILE 70 53 53 ILE ILE A . n A 1 71 GLY 71 54 54 GLY GLY A . n A 1 72 CYS 72 55 55 CYS CYS A . n A 1 73 GLY 73 56 56 GLY GLY A . n A 1 74 TYR 74 57 57 TYR TYR A . n A 1 75 GLY 75 58 58 GLY GLY A . n A 1 76 GLY 76 59 59 GLY GLY A . n A 1 77 LEU 77 60 60 LEU LEU A . n A 1 78 LEU 78 61 61 LEU LEU A . n A 1 79 VAL 79 62 62 VAL VAL A . n A 1 80 GLU 80 63 63 GLU GLU A . n A 1 81 LEU 81 64 64 LEU LEU A . n A 1 82 SER 82 65 65 SER SER A . n A 1 83 PRO 83 66 66 PRO PRO A . n A 1 84 LEU 84 67 67 LEU LEU A . n A 1 85 PHE 85 68 68 PHE PHE A . n A 1 86 PRO 86 69 69 PRO PRO A . n A 1 87 ASP 87 70 70 ASP ASP A . n A 1 88 THR 88 71 71 THR THR A . n A 1 89 LEU 89 72 72 LEU LEU A . n A 1 90 ILE 90 73 73 ILE ILE A . n A 1 91 LEU 91 74 74 LEU LEU A . n A 1 92 GLY 92 75 75 GLY GLY A . n A 1 93 LEU 93 76 76 LEU LEU A . n A 1 94 GLU 94 77 77 GLU GLU A . n A 1 95 ILE 95 78 78 ILE ILE A . n A 1 96 ARG 96 79 79 ARG ARG A . n A 1 97 VAL 97 80 80 VAL VAL A . n A 1 98 LYS 98 81 81 LYS LYS A . n A 1 99 VAL 99 82 82 VAL VAL A . n A 1 100 SER 100 83 83 SER SER A . n A 1 101 ASP 101 84 84 ASP ASP A . n A 1 102 TYR 102 85 85 TYR TYR A . n A 1 103 VAL 103 86 86 VAL VAL A . n A 1 104 GLN 104 87 87 GLN GLN A . n A 1 105 ASP 105 88 88 ASP ASP A . n A 1 106 ARG 106 89 89 ARG ARG A . n A 1 107 ILE 107 90 90 ILE ILE A . n A 1 108 ARG 108 91 91 ARG ARG A . n A 1 109 ALA 109 92 92 ALA ALA A . n A 1 110 LEU 110 93 93 LEU LEU A . n A 1 111 ARG 111 94 94 ARG ARG A . n A 1 112 ALA 112 95 95 ALA ALA A . n A 1 113 ALA 113 96 96 ALA ALA A . n A 1 114 PRO 114 97 97 PRO PRO A . n A 1 115 ALA 115 98 98 ALA ALA A . n A 1 116 GLY 116 99 99 GLY GLY A . n A 1 117 GLY 117 100 100 GLY GLY A . n A 1 118 PHE 118 101 101 PHE PHE A . n A 1 119 GLN 119 102 102 GLN GLN A . n A 1 120 ASN 120 103 103 ASN ASN A . n A 1 121 ILE 121 104 104 ILE ILE A . n A 1 122 ALA 122 105 105 ALA ALA A . n A 1 123 CYS 123 106 106 CYS CYS A . n A 1 124 LEU 124 107 107 LEU LEU A . n A 1 125 ARG 125 108 108 ARG ARG A . n A 1 126 SER 126 109 109 SER SER A . n A 1 127 ASN 127 110 110 ASN ASN A . n A 1 128 ALA 128 111 111 ALA ALA A . n A 1 129 MET 129 112 112 MET MET A . n A 1 130 LYS 130 113 113 LYS LYS A . n A 1 131 HIS 131 114 114 HIS HIS A . n A 1 132 LEU 132 115 115 LEU LEU A . n A 1 133 PRO 133 116 116 PRO PRO A . n A 1 134 ASN 134 117 117 ASN ASN A . n A 1 135 PHE 135 118 118 PHE PHE A . n A 1 136 PHE 136 119 119 PHE PHE A . n A 1 137 TYR 137 120 120 TYR TYR A . n A 1 138 LYS 138 121 121 LYS LYS A . n A 1 139 GLY 139 122 122 GLY GLY A . n A 1 140 GLN 140 123 123 GLN GLN A . n A 1 141 LEU 141 124 124 LEU LEU A . n A 1 142 THR 142 125 125 THR THR A . n A 1 143 LYS 143 126 126 LYS LYS A . n A 1 144 MET 144 127 127 MET MET A . n A 1 145 PHE 145 128 128 PHE PHE A . n A 1 146 PHE 146 129 129 PHE PHE A . n A 1 147 LEU 147 130 130 LEU LEU A . n A 1 148 PHE 148 131 131 PHE PHE A . n A 1 149 PRO 149 132 132 PRO PRO A . n A 1 150 ASP 150 133 133 ASP ASP A . n A 1 151 PRO 151 134 134 PRO PRO A . n A 1 152 HIS 152 135 135 HIS HIS A . n A 1 153 PHE 153 136 136 PHE PHE A . n A 1 154 LYS 154 137 137 LYS LYS A . n A 1 155 ARG 155 138 138 ARG ARG A . n A 1 156 THR 156 139 139 THR THR A . n A 1 157 LYS 157 140 140 LYS LYS A . n A 1 158 HIS 158 141 141 HIS HIS A . n A 1 159 LYS 159 142 142 LYS LYS A . n A 1 160 TRP 160 143 143 TRP TRP A . n A 1 161 ARG 161 144 144 ARG ARG A . n A 1 162 ILE 162 145 145 ILE ILE A . n A 1 163 ILE 163 146 146 ILE ILE A . n A 1 164 SER 164 147 147 SER SER A . n A 1 165 PRO 165 148 148 PRO PRO A . n A 1 166 THR 166 149 149 THR THR A . n A 1 167 LEU 167 150 150 LEU LEU A . n A 1 168 LEU 168 151 151 LEU LEU A . n A 1 169 ALA 169 152 152 ALA ALA A . n A 1 170 GLU 170 153 153 GLU GLU A . n A 1 171 TYR 171 154 154 TYR TYR A . n A 1 172 ALA 172 155 155 ALA ALA A . n A 1 173 TYR 173 156 156 TYR TYR A . n A 1 174 VAL 174 157 157 VAL VAL A . n A 1 175 LEU 175 158 158 LEU LEU A . n A 1 176 ARG 176 159 159 ARG ARG A . n A 1 177 VAL 177 160 160 VAL VAL A . n A 1 178 GLY 178 161 161 GLY GLY A . n A 1 179 GLY 179 162 162 GLY GLY A . n A 1 180 LEU 180 163 163 LEU LEU A . n A 1 181 VAL 181 164 164 VAL VAL A . n A 1 182 TYR 182 165 165 TYR TYR A . n A 1 183 THR 183 166 166 THR THR A . n A 1 184 ILE 184 167 167 ILE ILE A . n A 1 185 THR 185 168 168 THR THR A . n A 1 186 ASP 186 169 169 ASP ASP A . n A 1 187 VAL 187 170 170 VAL VAL A . n A 1 188 LEU 188 171 171 LEU LEU A . n A 1 189 GLU 189 172 172 GLU GLU A . n A 1 190 LEU 190 173 173 LEU LEU A . n A 1 191 HIS 191 174 174 HIS HIS A . n A 1 192 ASP 192 175 175 ASP ASP A . n A 1 193 TRP 193 176 176 TRP TRP A . n A 1 194 MET 194 177 177 MET MET A . n A 1 195 CYS 195 178 178 CYS CYS A . n A 1 196 THR 196 179 179 THR THR A . n A 1 197 HIS 197 180 180 HIS HIS A . n A 1 198 PHE 198 181 181 PHE PHE A . n A 1 199 GLU 199 182 182 GLU GLU A . n A 1 200 GLU 200 183 183 GLU GLU A . n A 1 201 HIS 201 184 184 HIS HIS A . n A 1 202 PRO 202 185 185 PRO PRO A . n A 1 203 LEU 203 186 186 LEU LEU A . n A 1 204 PHE 204 187 187 PHE PHE A . n A 1 205 GLU 205 188 188 GLU GLU A . n A 1 206 ARG 206 189 189 ARG ARG A . n A 1 207 VAL 207 190 190 VAL VAL A . n A 1 208 PRO 208 191 191 PRO PRO A . n A 1 209 LEU 209 192 192 LEU LEU A . n A 1 210 GLU 210 193 193 GLU GLU A . n A 1 211 ASP 211 194 194 ASP ASP A . n A 1 212 LEU 212 195 195 LEU LEU A . n A 1 213 SER 213 196 196 SER SER A . n A 1 214 GLU 214 197 197 GLU GLU A . n A 1 215 ASP 215 198 198 ASP ASP A . n A 1 216 PRO 216 199 199 PRO PRO A . n A 1 217 VAL 217 200 200 VAL VAL A . n A 1 218 VAL 218 201 201 VAL VAL A . n A 1 219 GLY 219 202 202 GLY GLY A . n A 1 220 HIS 220 203 203 HIS HIS A . n A 1 221 LEU 221 204 204 LEU LEU A . n A 1 222 GLY 222 205 205 GLY GLY A . n A 1 223 THR 223 206 206 THR THR A . n A 1 224 SER 224 207 207 SER SER A . n A 1 225 THR 225 208 208 THR THR A . n A 1 226 GLU 226 209 209 GLU GLU A . n A 1 227 GLU 227 210 210 GLU GLU A . n A 1 228 GLY 228 211 211 GLY GLY A . n A 1 229 LYS 229 212 212 LYS LYS A . n A 1 230 LYS 230 213 213 LYS LYS A . n A 1 231 VAL 231 214 214 VAL VAL A . n A 1 232 LEU 232 215 215 LEU LEU A . n A 1 233 ARG 233 216 216 ARG ARG A . n A 1 234 ASN 234 217 217 ASN ASN A . n A 1 235 GLY 235 218 218 GLY GLY A . n A 1 236 GLY 236 219 219 GLY GLY A . n A 1 237 LYS 237 220 220 LYS LYS A . n A 1 238 ASN 238 221 221 ASN ASN A . n A 1 239 PHE 239 222 222 PHE PHE A . n A 1 240 PRO 240 223 223 PRO PRO A . n A 1 241 ALA 241 224 224 ALA ALA A . n A 1 242 ILE 242 225 225 ILE ILE A . n A 1 243 PHE 243 226 226 PHE PHE A . n A 1 244 ARG 244 227 227 ARG ARG A . n A 1 245 ARG 245 228 228 ARG ARG A . n A 1 246 ILE 246 229 229 ILE ILE A . n A 1 247 GLN 247 230 230 GLN GLN A . n A 1 248 ASP 248 231 231 ASP ASP A . n A 1 249 PRO 249 232 232 PRO PRO A . n A 1 250 VAL 250 233 ? ? ? A . n A 1 251 LEU 251 234 ? ? ? A . n A 1 252 GLN 252 235 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1J17 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1J17 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PEG 1 301 302 PEG PEG A . C 3 GOL 1 302 303 GOL GOL A . D 4 A1J17 1 303 304 A1J17 LIG A . E 5 SO4 1 304 1 SO4 SO4 A . F 6 HOH 1 401 30 HOH HOH A . F 6 HOH 2 402 1 HOH HOH A . F 6 HOH 3 403 49 HOH HOH A . F 6 HOH 4 404 134 HOH HOH A . F 6 HOH 5 405 56 HOH HOH A . F 6 HOH 6 406 38 HOH HOH A . F 6 HOH 7 407 130 HOH HOH A . F 6 HOH 8 408 10 HOH HOH A . F 6 HOH 9 409 103 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A TYR 7 ? CG ? A TYR 24 CG 2 1 Y 1 A TYR 7 ? CD1 ? A TYR 24 CD1 3 1 Y 1 A TYR 7 ? CD2 ? A TYR 24 CD2 4 1 Y 1 A TYR 7 ? CE1 ? A TYR 24 CE1 5 1 Y 1 A TYR 7 ? CE2 ? A TYR 24 CE2 6 1 Y 1 A TYR 7 ? CZ ? A TYR 24 CZ 7 1 Y 1 A TYR 7 ? OH ? A TYR 24 OH 8 1 Y 1 A VAL 9 ? CG1 ? A VAL 26 CG1 9 1 Y 1 A VAL 9 ? CG2 ? A VAL 26 CG2 10 1 Y 1 A LYS 10 ? CG ? A LYS 27 CG 11 1 Y 1 A LYS 10 ? CD ? A LYS 27 CD 12 1 Y 1 A LYS 10 ? CE ? A LYS 27 CE 13 1 Y 1 A LYS 10 ? NZ ? A LYS 27 NZ 14 1 Y 1 A GLU 13 ? CG ? A GLU 30 CG 15 1 Y 1 A GLU 13 ? CD ? A GLU 30 CD 16 1 Y 1 A GLU 13 ? OE1 ? A GLU 30 OE1 17 1 Y 1 A GLU 13 ? OE2 ? A GLU 30 OE2 18 1 Y 1 A ASP 15 ? CG ? A ASP 32 CG 19 1 Y 1 A ASP 15 ? OD1 ? A ASP 32 OD1 20 1 Y 1 A ASP 15 ? OD2 ? A ASP 32 OD2 21 1 Y 1 A GLU 18 ? CG ? A GLU 35 CG 22 1 Y 1 A GLU 18 ? CD ? A GLU 35 CD 23 1 Y 1 A GLU 18 ? OE1 ? A GLU 35 OE1 24 1 Y 1 A GLU 18 ? OE2 ? A GLU 35 OE2 25 1 Y 1 A GLN 45 ? CG ? A GLN 62 CG 26 1 Y 1 A GLN 45 ? CD ? A GLN 62 CD 27 1 Y 1 A GLN 45 ? OE1 ? A GLN 62 OE1 28 1 Y 1 A GLN 45 ? NE2 ? A GLN 62 NE2 29 1 Y 1 A GLU 63 ? OE1 ? A GLU 80 OE1 30 1 Y 1 A GLU 63 ? OE2 ? A GLU 80 OE2 31 1 Y 1 A ASP 70 ? OD1 ? A ASP 87 OD1 32 1 Y 1 A ASP 70 ? OD2 ? A ASP 87 OD2 33 1 Y 1 A LYS 81 ? CD ? A LYS 98 CD 34 1 Y 1 A LYS 81 ? CE ? A LYS 98 CE 35 1 Y 1 A LYS 81 ? NZ ? A LYS 98 NZ 36 1 Y 1 A ARG 108 ? NH1 ? A ARG 125 NH1 37 1 Y 1 A ARG 108 ? NH2 ? A ARG 125 NH2 38 1 Y 1 A LYS 113 ? CD ? A LYS 130 CD 39 1 Y 1 A LYS 113 ? CE ? A LYS 130 CE 40 1 Y 1 A LYS 113 ? NZ ? A LYS 130 NZ 41 1 Y 1 A LYS 121 ? CE ? A LYS 138 CE 42 1 Y 1 A LYS 121 ? NZ ? A LYS 138 NZ 43 1 Y 1 A LYS 137 ? CE ? A LYS 154 CE 44 1 Y 1 A LYS 137 ? NZ ? A LYS 154 NZ 45 1 Y 1 A LYS 140 ? CG ? A LYS 157 CG 46 1 Y 1 A LYS 140 ? CD ? A LYS 157 CD 47 1 Y 1 A LYS 140 ? CE ? A LYS 157 CE 48 1 Y 1 A LYS 140 ? NZ ? A LYS 157 NZ 49 1 Y 1 A LYS 142 ? CE ? A LYS 159 CE 50 1 Y 1 A LYS 142 ? NZ ? A LYS 159 NZ 51 1 Y 1 A ILE 146 ? CG1 ? A ILE 163 CG1 52 1 Y 1 A ILE 146 ? CD1 ? A ILE 163 CD1 53 1 Y 1 A LEU 158 ? CD1 ? A LEU 175 CD1 54 1 Y 1 A GLU 172 ? CG ? A GLU 189 CG 55 1 Y 1 A GLU 172 ? CD ? A GLU 189 CD 56 1 Y 1 A GLU 172 ? OE1 ? A GLU 189 OE1 57 1 Y 1 A GLU 172 ? OE2 ? A GLU 189 OE2 58 1 Y 1 A GLU 193 ? CG ? A GLU 210 CG 59 1 Y 1 A GLU 193 ? CD ? A GLU 210 CD 60 1 Y 1 A GLU 193 ? OE1 ? A GLU 210 OE1 61 1 Y 1 A GLU 193 ? OE2 ? A GLU 210 OE2 62 1 Y 1 A GLU 197 ? CG ? A GLU 214 CG 63 1 Y 1 A GLU 197 ? CD ? A GLU 214 CD 64 1 Y 1 A GLU 197 ? OE1 ? A GLU 214 OE1 65 1 Y 1 A GLU 197 ? OE2 ? A GLU 214 OE2 66 1 Y 1 A GLU 209 ? CG ? A GLU 226 CG 67 1 Y 1 A GLU 209 ? CD ? A GLU 226 CD 68 1 Y 1 A GLU 209 ? OE1 ? A GLU 226 OE1 69 1 Y 1 A GLU 209 ? OE2 ? A GLU 226 OE2 70 1 Y 1 A LYS 213 ? CG ? A LYS 230 CG 71 1 Y 1 A LYS 213 ? CD ? A LYS 230 CD 72 1 Y 1 A LYS 213 ? CE ? A LYS 230 CE 73 1 Y 1 A LYS 213 ? NZ ? A LYS 230 NZ 74 1 Y 1 A ARG 216 ? CD ? A ARG 233 CD 75 1 Y 1 A ARG 216 ? NE ? A ARG 233 NE 76 1 Y 1 A ARG 216 ? CZ ? A ARG 233 CZ 77 1 Y 1 A ARG 216 ? NH1 ? A ARG 233 NH1 78 1 Y 1 A ARG 216 ? NH2 ? A ARG 233 NH2 79 1 Y 1 A LYS 220 ? CG ? A LYS 237 CG 80 1 Y 1 A LYS 220 ? CD ? A LYS 237 CD 81 1 Y 1 A LYS 220 ? CE ? A LYS 237 CE 82 1 Y 1 A LYS 220 ? NZ ? A LYS 237 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 2.0_5936 ? 1 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? MxCuBE ? ? ? . ? 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . ? 3 ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . ? 4 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . ? 5 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . ? 6 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . ? 7 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . ? 8 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 29GE _cell.details ? _cell.formula_units_Z ? _cell.length_a 43.149 _cell.length_a_esd ? _cell.length_b 154.303 _cell.length_b_esd ? _cell.length_c 41.999 _cell.length_c_esd ? _cell.volume 279630.188 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 29GE _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall 'P 2 2ab' _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 29GE _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.40 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.66 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M phosphate-citrate buffer pH 4.2, 33% Ethanol, 1% PEG 1K, saturated with 8-(4-methylpiperazin-1-yl)-9H-purin-6-amine' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 277.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2025-04-07 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, EMBL c/o DESY BEAMLINE P13 (MX1)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'P13 (MX1)' _diffrn_source.pdbx_synchrotron_site 'PETRA III, EMBL c/o DESY' # _reflns.B_iso_Wilson_estimate 49.27 _reflns.entry_id 29GE _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.889 _reflns.d_resolution_low 77.152 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6695 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.1 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.993 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.889 _reflns_shell.d_res_low 2.938 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 317 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.9482 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 43.00 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 29GE _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.89 _refine.ls_d_res_low 40.52 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6687 _refine.ls_number_reflns_R_free 347 _refine.ls_number_reflns_R_work 6340 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.92 _refine.ls_percent_reflns_R_free 5.19 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2290 _refine.ls_R_factor_R_free 0.2993 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2250 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 33.7258 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3511 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.89 _refine_hist.d_res_low 40.52 _refine_hist.number_atoms_solvent 9 _refine_hist.number_atoms_total 1648 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1587 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 52 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0090 ? 1687 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 1.0308 ? 2299 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0566 ? 249 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0077 ? 291 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 14.4743 ? 593 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.89 3.64 . . 160 3092 98.88 . . . . 0.2713 . . . . . . . . . . . . . . . 0.3552 'X-RAY DIFFRACTION' 3.64 40.52 . . 187 3248 98.96 . . . . 0.2027 . . . . . . . . . . . . . . . 0.2728 # _struct.entry_id 29GE _struct.title 'Crystal structure of human METTL1 in complex with OBV617 (compound B19)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 29GE _struct_keywords.text 'METTL1, m7G, Inhibitor, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRMB_HUMAN _struct_ref.pdbx_db_accession Q9UBP6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVK VSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVG GLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQ ; _struct_ref.pdbx_align_begin 32 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 29GE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 19 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 252 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9UBP6 _struct_ref_seq.db_align_beg 32 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 265 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 235 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 29GE MET A 1 ? UNP Q9UBP6 ? ? 'initiating methionine' -16 1 1 29GE HIS A 2 ? UNP Q9UBP6 ? ? 'expression tag' -15 2 1 29GE HIS A 3 ? UNP Q9UBP6 ? ? 'expression tag' -14 3 1 29GE HIS A 4 ? UNP Q9UBP6 ? ? 'expression tag' -13 4 1 29GE HIS A 5 ? UNP Q9UBP6 ? ? 'expression tag' -12 5 1 29GE HIS A 6 ? UNP Q9UBP6 ? ? 'expression tag' -11 6 1 29GE HIS A 7 ? UNP Q9UBP6 ? ? 'expression tag' -10 7 1 29GE SER A 8 ? UNP Q9UBP6 ? ? 'expression tag' -9 8 1 29GE SER A 9 ? UNP Q9UBP6 ? ? 'expression tag' -8 9 1 29GE GLY A 10 ? UNP Q9UBP6 ? ? 'expression tag' -7 10 1 29GE ARG A 11 ? UNP Q9UBP6 ? ? 'expression tag' -6 11 1 29GE GLU A 12 ? UNP Q9UBP6 ? ? 'expression tag' -5 12 1 29GE ASN A 13 ? UNP Q9UBP6 ? ? 'expression tag' -4 13 1 29GE LEU A 14 ? UNP Q9UBP6 ? ? 'expression tag' -3 14 1 29GE TYR A 15 ? UNP Q9UBP6 ? ? 'expression tag' -2 15 1 29GE PHE A 16 ? UNP Q9UBP6 ? ? 'expression tag' -1 16 1 29GE GLN A 17 ? UNP Q9UBP6 ? ? 'expression tag' 0 17 1 29GE GLY A 18 ? UNP Q9UBP6 ? ? 'expression tag' 1 18 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1550 ? 1 MORE -11 ? 1 'SSA (A^2)' 10310 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 75 ? PHE A 85 ? GLY A 58 PHE A 68 1 ? 11 HELX_P HELX_P2 AA2 ARG A 96 ? ALA A 113 ? ARG A 79 ALA A 96 1 ? 18 HELX_P HELX_P3 AA3 HIS A 131 ? PHE A 136 ? HIS A 114 PHE A 119 1 ? 6 HELX_P HELX_P4 AA4 THR A 156 ? VAL A 174 ? THR A 139 VAL A 157 1 ? 19 HELX_P HELX_P5 AA5 VAL A 187 ? HIS A 201 ? VAL A 170 HIS A 184 1 ? 15 HELX_P HELX_P6 AA6 PRO A 208 ? SER A 213 ? PRO A 191 SER A 196 5 ? 6 HELX_P HELX_P7 AA7 VAL A 217 ? GLY A 219 ? VAL A 200 GLY A 202 5 ? 3 HELX_P HELX_P8 AA8 HIS A 220 ? THR A 225 ? HIS A 203 THR A 208 1 ? 6 HELX_P HELX_P9 AA9 THR A 225 ? ASN A 234 ? THR A 208 ASN A 217 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 121 ? ARG A 125 ? ILE A 104 ARG A 108 AA1 2 LEU A 89 ? GLU A 94 ? LEU A 72 GLU A 77 AA1 3 VAL A 65 ? ILE A 70 ? VAL A 48 ILE A 53 AA1 4 LEU A 141 ? LEU A 147 ? LEU A 124 LEU A 130 AA1 5 LEU A 175 ? THR A 185 ? LEU A 158 THR A 168 AA1 6 PHE A 239 ? ARG A 245 ? PHE A 222 ARG A 228 AA1 7 PHE A 204 ? ARG A 206 ? PHE A 187 ARG A 189 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ALA A 122 ? O ALA A 105 N GLY A 92 ? N GLY A 75 AA1 2 3 O LEU A 91 ? O LEU A 74 N ASP A 69 ? N ASP A 52 AA1 3 4 N GLU A 66 ? N GLU A 49 O THR A 142 ? O THR A 125 AA1 4 5 N LEU A 141 ? N LEU A 124 O ARG A 176 ? O ARG A 159 AA1 5 6 N GLY A 178 ? N GLY A 161 O ARG A 245 ? O ARG A 228 AA1 6 7 O ARG A 244 ? O ARG A 227 N GLU A 205 ? N GLU A 188 # _pdbx_entry_details.entry_id 29GE _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 14 ? ? -162.95 118.99 2 1 TYR A 20 ? ? -118.99 70.73 3 1 LEU A 195 ? ? -98.18 34.75 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x+1/2,-y+1/2,-z 3 -x+1/2,y+1/2,-z 4 -x,-y,z # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -16 ? A MET 1 2 1 Y 1 A HIS -15 ? A HIS 2 3 1 Y 1 A HIS -14 ? A HIS 3 4 1 Y 1 A HIS -13 ? A HIS 4 5 1 Y 1 A HIS -12 ? A HIS 5 6 1 Y 1 A HIS -11 ? A HIS 6 7 1 Y 1 A HIS -10 ? A HIS 7 8 1 Y 1 A SER -9 ? A SER 8 9 1 Y 1 A SER -8 ? A SER 9 10 1 Y 1 A GLY -7 ? A GLY 10 11 1 Y 1 A ARG -6 ? A ARG 11 12 1 Y 1 A GLU -5 ? A GLU 12 13 1 Y 1 A ASN -4 ? A ASN 13 14 1 Y 1 A LEU -3 ? A LEU 14 15 1 Y 1 A TYR -2 ? A TYR 15 16 1 Y 1 A PHE -1 ? A PHE 16 17 1 Y 1 A GLN 0 ? A GLN 17 18 1 Y 1 A GLY 1 ? A GLY 18 19 1 Y 1 A ASP 2 ? A ASP 19 20 1 Y 1 A HIS 3 ? A HIS 20 21 1 Y 1 A THR 4 ? A THR 21 22 1 Y 1 A LEU 5 ? A LEU 22 23 1 Y 1 A ARG 6 ? A ARG 23 24 1 Y 1 A PHE 24 ? A PHE 41 25 1 Y 1 A ALA 25 ? A ALA 42 26 1 Y 1 A PRO 26 ? A PRO 43 27 1 Y 1 A LEU 27 ? A LEU 44 28 1 Y 1 A THR 28 ? A THR 45 29 1 Y 1 A GLN 29 ? A GLN 46 30 1 Y 1 A ASN 30 ? A ASN 47 31 1 Y 1 A GLN 31 ? A GLN 48 32 1 Y 1 A SER 32 ? A SER 49 33 1 Y 1 A HIS 33 ? A HIS 50 34 1 Y 1 A ASP 34 ? A ASP 51 35 1 Y 1 A ASP 35 ? A ASP 52 36 1 Y 1 A PRO 36 ? A PRO 53 37 1 Y 1 A LYS 37 ? A LYS 54 38 1 Y 1 A ASP 38 ? A ASP 55 39 1 Y 1 A LYS 39 ? A LYS 56 40 1 Y 1 A LYS 40 ? A LYS 57 41 1 Y 1 A GLU 41 ? A GLU 58 42 1 Y 1 A LYS 42 ? A LYS 59 43 1 Y 1 A ARG 43 ? A ARG 60 44 1 Y 1 A VAL 233 ? A VAL 250 45 1 Y 1 A LEU 234 ? A LEU 251 46 1 Y 1 A GLN 235 ? A GLN 252 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1J17 C15 C Y N 1 A1J17 C17 C Y N 2 A1J17 C20 C Y N 3 A1J17 C21 C Y N 4 A1J17 C24 C N N 5 A1J17 C26 C N S 6 A1J17 C28 C N R 7 A1J17 C02 C Y N 8 A1J17 C03 C Y N 9 A1J17 C04 C Y N 10 A1J17 C06 C N R 11 A1J17 C08 C N S 12 A1J17 C09 C N N 13 A1J17 C11 C N N 14 A1J17 C12 C N N 15 A1J17 C14 C N N 16 A1J17 C16 C Y N 17 A1J17 C18 C Y N 18 A1J17 C23 C N N 19 A1J17 C30 C Y N 20 A1J17 C33 C Y N 21 A1J17 N01 N N N 22 A1J17 N05 N Y N 23 A1J17 N10 N N N 24 A1J17 N13 N N N 25 A1J17 N31 N Y N 26 A1J17 N32 N Y N 27 A1J17 N34 N Y N 28 A1J17 O07 O N N 29 A1J17 O19 O N N 30 A1J17 O22 O N N 31 A1J17 O25 O N N 32 A1J17 O27 O N N 33 A1J17 O29 O N N 34 A1J17 H171 H N N 35 A1J17 H201 H N N 36 A1J17 H241 H N N 37 A1J17 H242 H N N 38 A1J17 H261 H N N 39 A1J17 H281 H N N 40 A1J17 H061 H N N 41 A1J17 H081 H N N 42 A1J17 H111 H N N 43 A1J17 H112 H N N 44 A1J17 H121 H N N 45 A1J17 H122 H N N 46 A1J17 H141 H N N 47 A1J17 H142 H N N 48 A1J17 H161 H N N 49 A1J17 H231 H N N 50 A1J17 H232 H N N 51 A1J17 H301 H N N 52 A1J17 H331 H N N 53 A1J17 H011 H N N 54 A1J17 H012 H N N 55 A1J17 H191 H N N 56 A1J17 H221 H N N 57 A1J17 H271 H N N 58 A1J17 H291 H N N 59 ALA N N N N 60 ALA CA C N S 61 ALA C C N N 62 ALA O O N N 63 ALA CB C N N 64 ALA OXT O N N 65 ALA H H N N 66 ALA H2 H N N 67 ALA HA H N N 68 ALA HB1 H N N 69 ALA HB2 H N N 70 ALA HB3 H N N 71 ALA HXT H N N 72 ARG N N N N 73 ARG CA C N S 74 ARG C C N N 75 ARG O O N N 76 ARG CB C N N 77 ARG CG C N N 78 ARG CD C N N 79 ARG NE N N N 80 ARG CZ C N N 81 ARG NH1 N N N 82 ARG NH2 N N N 83 ARG OXT O N N 84 ARG H H N N 85 ARG H2 H N N 86 ARG HA H N N 87 ARG HB2 H N N 88 ARG HB3 H N N 89 ARG HG2 H N N 90 ARG HG3 H N N 91 ARG HD2 H N N 92 ARG HD3 H N N 93 ARG HE H N N 94 ARG HH11 H N N 95 ARG HH12 H N N 96 ARG HH21 H N N 97 ARG HH22 H N N 98 ARG HXT H N N 99 ASN N N N N 100 ASN CA C N S 101 ASN C C N N 102 ASN O O N N 103 ASN CB C N N 104 ASN CG C N N 105 ASN OD1 O N N 106 ASN ND2 N N N 107 ASN OXT O N N 108 ASN H H N N 109 ASN H2 H N N 110 ASN HA H N N 111 ASN HB2 H N N 112 ASN HB3 H N N 113 ASN HD21 H N N 114 ASN HD22 H N N 115 ASN HXT H N N 116 ASP N N N N 117 ASP CA C N S 118 ASP C C N N 119 ASP O O N N 120 ASP CB C N N 121 ASP CG C N N 122 ASP OD1 O N N 123 ASP OD2 O N N 124 ASP OXT O N N 125 ASP H H N N 126 ASP H2 H N N 127 ASP HA H N N 128 ASP HB2 H N N 129 ASP HB3 H N N 130 ASP HD2 H N N 131 ASP HXT H N N 132 CYS N N N N 133 CYS CA C N R 134 CYS C C N N 135 CYS O O N N 136 CYS CB C N N 137 CYS SG S N N 138 CYS OXT O N N 139 CYS H H N N 140 CYS H2 H N N 141 CYS HA H N N 142 CYS HB2 H N N 143 CYS HB3 H N N 144 CYS HG H N N 145 CYS HXT H N N 146 GLN N N N N 147 GLN CA C N S 148 GLN C C N N 149 GLN O O N N 150 GLN CB C N N 151 GLN CG C N N 152 GLN CD C N N 153 GLN OE1 O N N 154 GLN NE2 N N N 155 GLN OXT O N N 156 GLN H H N N 157 GLN H2 H N N 158 GLN HA H N N 159 GLN HB2 H N N 160 GLN HB3 H N N 161 GLN HG2 H N N 162 GLN HG3 H N N 163 GLN HE21 H N N 164 GLN HE22 H N N 165 GLN HXT H N N 166 GLU N N N N 167 GLU CA C N S 168 GLU C C N N 169 GLU O O N N 170 GLU CB C N N 171 GLU CG C N N 172 GLU CD C N N 173 GLU OE1 O N N 174 GLU OE2 O N N 175 GLU OXT O N N 176 GLU H H N N 177 GLU H2 H N N 178 GLU HA H N N 179 GLU HB2 H N N 180 GLU HB3 H N N 181 GLU HG2 H N N 182 GLU HG3 H N N 183 GLU HE2 H N N 184 GLU HXT H N N 185 GLY N N N N 186 GLY CA C N N 187 GLY C C N N 188 GLY O O N N 189 GLY OXT O N N 190 GLY H H N N 191 GLY H2 H N N 192 GLY HA2 H N N 193 GLY HA3 H N N 194 GLY HXT H N N 195 GOL C1 C N N 196 GOL O1 O N N 197 GOL C2 C N N 198 GOL O2 O N N 199 GOL C3 C N N 200 GOL O3 O N N 201 GOL H11 H N N 202 GOL H12 H N N 203 GOL HO1 H N N 204 GOL H2 H N N 205 GOL HO2 H N N 206 GOL H31 H N N 207 GOL H32 H N N 208 GOL HO3 H N N 209 HIS N N N N 210 HIS CA C N S 211 HIS C C N N 212 HIS O O N N 213 HIS CB C N N 214 HIS CG C Y N 215 HIS ND1 N Y N 216 HIS CD2 C Y N 217 HIS CE1 C Y N 218 HIS NE2 N Y N 219 HIS OXT O N N 220 HIS H H N N 221 HIS H2 H N N 222 HIS HA H N N 223 HIS HB2 H N N 224 HIS HB3 H N N 225 HIS HD1 H N N 226 HIS HD2 H N N 227 HIS HE1 H N N 228 HIS HE2 H N N 229 HIS HXT H N N 230 HOH O O N N 231 HOH H1 H N N 232 HOH H2 H N N 233 ILE N N N N 234 ILE CA C N S 235 ILE C C N N 236 ILE O O N N 237 ILE CB C N S 238 ILE CG1 C N N 239 ILE CG2 C N N 240 ILE CD1 C N N 241 ILE OXT O N N 242 ILE H H N N 243 ILE H2 H N N 244 ILE HA H N N 245 ILE HB H N N 246 ILE HG12 H N N 247 ILE HG13 H N N 248 ILE HG21 H N N 249 ILE HG22 H N N 250 ILE HG23 H N N 251 ILE HD11 H N N 252 ILE HD12 H N N 253 ILE HD13 H N N 254 ILE HXT H N N 255 LEU N N N N 256 LEU CA C N S 257 LEU C C N N 258 LEU O O N N 259 LEU CB C N N 260 LEU CG C N N 261 LEU CD1 C N N 262 LEU CD2 C N N 263 LEU OXT O N N 264 LEU H H N N 265 LEU H2 H N N 266 LEU HA H N N 267 LEU HB2 H N N 268 LEU HB3 H N N 269 LEU HG H N N 270 LEU HD11 H N N 271 LEU HD12 H N N 272 LEU HD13 H N N 273 LEU HD21 H N N 274 LEU HD22 H N N 275 LEU HD23 H N N 276 LEU HXT H N N 277 LYS N N N N 278 LYS CA C N S 279 LYS C C N N 280 LYS O O N N 281 LYS CB C N N 282 LYS CG C N N 283 LYS CD C N N 284 LYS CE C N N 285 LYS NZ N N N 286 LYS OXT O N N 287 LYS H H N N 288 LYS H2 H N N 289 LYS HA H N N 290 LYS HB2 H N N 291 LYS HB3 H N N 292 LYS HG2 H N N 293 LYS HG3 H N N 294 LYS HD2 H N N 295 LYS HD3 H N N 296 LYS HE2 H N N 297 LYS HE3 H N N 298 LYS HZ1 H N N 299 LYS HZ2 H N N 300 LYS HZ3 H N N 301 LYS HXT H N N 302 MET N N N N 303 MET CA C N S 304 MET C C N N 305 MET O O N N 306 MET CB C N N 307 MET CG C N N 308 MET SD S N N 309 MET CE C N N 310 MET OXT O N N 311 MET H H N N 312 MET H2 H N N 313 MET HA H N N 314 MET HB2 H N N 315 MET HB3 H N N 316 MET HG2 H N N 317 MET HG3 H N N 318 MET HE1 H N N 319 MET HE2 H N N 320 MET HE3 H N N 321 MET HXT H N N 322 PEG C1 C N N 323 PEG O1 O N N 324 PEG C2 C N N 325 PEG O2 O N N 326 PEG C3 C N N 327 PEG C4 C N N 328 PEG O4 O N N 329 PEG H11 H N N 330 PEG H12 H N N 331 PEG HO1 H N N 332 PEG H21 H N N 333 PEG H22 H N N 334 PEG H31 H N N 335 PEG H32 H N N 336 PEG H41 H N N 337 PEG H42 H N N 338 PEG HO4 H N N 339 PHE N N N N 340 PHE CA C N S 341 PHE C C N N 342 PHE O O N N 343 PHE CB C N N 344 PHE CG C Y N 345 PHE CD1 C Y N 346 PHE CD2 C Y N 347 PHE CE1 C Y N 348 PHE CE2 C Y N 349 PHE CZ C Y N 350 PHE OXT O N N 351 PHE H H N N 352 PHE H2 H N N 353 PHE HA H N N 354 PHE HB2 H N N 355 PHE HB3 H N N 356 PHE HD1 H N N 357 PHE HD2 H N N 358 PHE HE1 H N N 359 PHE HE2 H N N 360 PHE HZ H N N 361 PHE HXT H N N 362 PRO N N N N 363 PRO CA C N S 364 PRO C C N N 365 PRO O O N N 366 PRO CB C N N 367 PRO CG C N N 368 PRO CD C N N 369 PRO OXT O N N 370 PRO H H N N 371 PRO HA H N N 372 PRO HB2 H N N 373 PRO HB3 H N N 374 PRO HG2 H N N 375 PRO HG3 H N N 376 PRO HD2 H N N 377 PRO HD3 H N N 378 PRO HXT H N N 379 SER N N N N 380 SER CA C N S 381 SER C C N N 382 SER O O N N 383 SER CB C N N 384 SER OG O N N 385 SER OXT O N N 386 SER H H N N 387 SER H2 H N N 388 SER HA H N N 389 SER HB2 H N N 390 SER HB3 H N N 391 SER HG H N N 392 SER HXT H N N 393 SO4 S S N N 394 SO4 O1 O N N 395 SO4 O2 O N N 396 SO4 O3 O N N 397 SO4 O4 O N N 398 THR N N N N 399 THR CA C N S 400 THR C C N N 401 THR O O N N 402 THR CB C N R 403 THR OG1 O N N 404 THR CG2 C N N 405 THR OXT O N N 406 THR H H N N 407 THR H2 H N N 408 THR HA H N N 409 THR HB H N N 410 THR HG1 H N N 411 THR HG21 H N N 412 THR HG22 H N N 413 THR HG23 H N N 414 THR HXT H N N 415 TRP N N N N 416 TRP CA C N S 417 TRP C C N N 418 TRP O O N N 419 TRP CB C N N 420 TRP CG C Y N 421 TRP CD1 C Y N 422 TRP CD2 C Y N 423 TRP NE1 N Y N 424 TRP CE2 C Y N 425 TRP CE3 C Y N 426 TRP CZ2 C Y N 427 TRP CZ3 C Y N 428 TRP CH2 C Y N 429 TRP OXT O N N 430 TRP H H N N 431 TRP H2 H N N 432 TRP HA H N N 433 TRP HB2 H N N 434 TRP HB3 H N N 435 TRP HD1 H N N 436 TRP HE1 H N N 437 TRP HE3 H N N 438 TRP HZ2 H N N 439 TRP HZ3 H N N 440 TRP HH2 H N N 441 TRP HXT H N N 442 TYR N N N N 443 TYR CA C N S 444 TYR C C N N 445 TYR O O N N 446 TYR CB C N N 447 TYR CG C Y N 448 TYR CD1 C Y N 449 TYR CD2 C Y N 450 TYR CE1 C Y N 451 TYR CE2 C Y N 452 TYR CZ C Y N 453 TYR OH O N N 454 TYR OXT O N N 455 TYR H H N N 456 TYR H2 H N N 457 TYR HA H N N 458 TYR HB2 H N N 459 TYR HB3 H N N 460 TYR HD1 H N N 461 TYR HD2 H N N 462 TYR HE1 H N N 463 TYR HE2 H N N 464 TYR HH H N N 465 TYR HXT H N N 466 VAL N N N N 467 VAL CA C N S 468 VAL C C N N 469 VAL O O N N 470 VAL CB C N N 471 VAL CG1 C N N 472 VAL CG2 C N N 473 VAL OXT O N N 474 VAL H H N N 475 VAL H2 H N N 476 VAL HA H N N 477 VAL HB H N N 478 VAL HG11 H N N 479 VAL HG12 H N N 480 VAL HG13 H N N 481 VAL HG21 H N N 482 VAL HG22 H N N 483 VAL HG23 H N N 484 VAL HXT H N N 485 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1J17 N01 C02 sing N N 1 A1J17 C02 C03 doub Y N 2 A1J17 C02 N34 sing Y N 3 A1J17 C03 C04 sing Y N 4 A1J17 C03 N31 sing Y N 5 A1J17 C04 N05 sing Y N 6 A1J17 C04 N32 doub Y N 7 A1J17 N05 C06 sing N N 8 A1J17 N05 C30 sing Y N 9 A1J17 C06 O07 sing N N 10 A1J17 C06 C28 sing N N 11 A1J17 O07 C08 sing N N 12 A1J17 C08 C09 sing N N 13 A1J17 C08 C26 sing N N 14 A1J17 C09 N10 sing N N 15 A1J17 C09 O25 doub N N 16 A1J17 N10 C11 sing N N 17 A1J17 N10 C24 sing N N 18 A1J17 C11 C12 sing N N 19 A1J17 C12 N13 sing N N 20 A1J17 N13 C14 sing N N 21 A1J17 N13 C23 sing N N 22 A1J17 C14 C15 sing N N 23 A1J17 C15 C16 doub Y N 24 A1J17 C15 C21 sing Y N 25 A1J17 C16 C17 sing Y N 26 A1J17 C17 C18 doub Y N 27 A1J17 C18 O19 sing N N 28 A1J17 C18 C20 sing Y N 29 A1J17 C20 C21 doub Y N 30 A1J17 C21 O22 sing N N 31 A1J17 C23 C24 sing N N 32 A1J17 C26 O27 sing N N 33 A1J17 C26 C28 sing N N 34 A1J17 C28 O29 sing N N 35 A1J17 C30 N31 doub Y N 36 A1J17 N32 C33 sing Y N 37 A1J17 C33 N34 doub Y N 38 A1J17 C17 H171 sing N N 39 A1J17 C20 H201 sing N N 40 A1J17 C24 H241 sing N N 41 A1J17 C24 H242 sing N N 42 A1J17 C26 H261 sing N N 43 A1J17 C28 H281 sing N N 44 A1J17 C06 H061 sing N N 45 A1J17 C08 H081 sing N N 46 A1J17 C11 H111 sing N N 47 A1J17 C11 H112 sing N N 48 A1J17 C12 H121 sing N N 49 A1J17 C12 H122 sing N N 50 A1J17 C14 H141 sing N N 51 A1J17 C14 H142 sing N N 52 A1J17 C16 H161 sing N N 53 A1J17 C23 H231 sing N N 54 A1J17 C23 H232 sing N N 55 A1J17 C30 H301 sing N N 56 A1J17 C33 H331 sing N N 57 A1J17 N01 H011 sing N N 58 A1J17 N01 H012 sing N N 59 A1J17 O19 H191 sing N N 60 A1J17 O22 H221 sing N N 61 A1J17 O27 H271 sing N N 62 A1J17 O29 H291 sing N N 63 ALA N CA sing N N 64 ALA N H sing N N 65 ALA N H2 sing N N 66 ALA CA C sing N N 67 ALA CA CB sing N N 68 ALA CA HA sing N N 69 ALA C O doub N N 70 ALA C OXT sing N N 71 ALA CB HB1 sing N N 72 ALA CB HB2 sing N N 73 ALA CB HB3 sing N N 74 ALA OXT HXT sing N N 75 ARG N CA sing N N 76 ARG N H sing N N 77 ARG N H2 sing N N 78 ARG CA C sing N N 79 ARG CA CB sing N N 80 ARG CA HA sing N N 81 ARG C O doub N N 82 ARG C OXT sing N N 83 ARG CB CG sing N N 84 ARG CB HB2 sing N N 85 ARG CB HB3 sing N N 86 ARG CG CD sing N N 87 ARG CG HG2 sing N N 88 ARG CG HG3 sing N N 89 ARG CD NE sing N N 90 ARG CD HD2 sing N N 91 ARG CD HD3 sing N N 92 ARG NE CZ sing N N 93 ARG NE HE sing N N 94 ARG CZ NH1 sing N N 95 ARG CZ NH2 doub N N 96 ARG NH1 HH11 sing N N 97 ARG NH1 HH12 sing N N 98 ARG NH2 HH21 sing N N 99 ARG NH2 HH22 sing N N 100 ARG OXT HXT sing N N 101 ASN N CA sing N N 102 ASN N H sing N N 103 ASN N H2 sing N N 104 ASN CA C sing N N 105 ASN CA CB sing N N 106 ASN CA HA sing N N 107 ASN C O doub N N 108 ASN C OXT sing N N 109 ASN CB CG sing N N 110 ASN CB HB2 sing N N 111 ASN CB HB3 sing N N 112 ASN CG OD1 doub N N 113 ASN CG ND2 sing N N 114 ASN ND2 HD21 sing N N 115 ASN ND2 HD22 sing N N 116 ASN OXT HXT sing N N 117 ASP N CA sing N N 118 ASP N H sing N N 119 ASP N H2 sing N N 120 ASP CA C sing N N 121 ASP CA CB sing N N 122 ASP CA HA sing N N 123 ASP C O doub N N 124 ASP C OXT sing N N 125 ASP CB CG sing N N 126 ASP CB HB2 sing N N 127 ASP CB HB3 sing N N 128 ASP CG OD1 doub N N 129 ASP CG OD2 sing N N 130 ASP OD2 HD2 sing N N 131 ASP OXT HXT sing N N 132 CYS N CA sing N N 133 CYS N H sing N N 134 CYS N H2 sing N N 135 CYS CA C sing N N 136 CYS CA CB sing N N 137 CYS CA HA sing N N 138 CYS C O doub N N 139 CYS C OXT sing N N 140 CYS CB SG sing N N 141 CYS CB HB2 sing N N 142 CYS CB HB3 sing N N 143 CYS SG HG sing N N 144 CYS OXT HXT sing N N 145 GLN N CA sing N N 146 GLN N H sing N N 147 GLN N H2 sing N N 148 GLN CA C sing N N 149 GLN CA CB sing N N 150 GLN CA HA sing N N 151 GLN C O doub N N 152 GLN C OXT sing N N 153 GLN CB CG sing N N 154 GLN CB HB2 sing N N 155 GLN CB HB3 sing N N 156 GLN CG CD sing N N 157 GLN CG HG2 sing N N 158 GLN CG HG3 sing N N 159 GLN CD OE1 doub N N 160 GLN CD NE2 sing N N 161 GLN NE2 HE21 sing N N 162 GLN NE2 HE22 sing N N 163 GLN OXT HXT sing N N 164 GLU N CA sing N N 165 GLU N H sing N N 166 GLU N H2 sing N N 167 GLU CA C sing N N 168 GLU CA CB sing N N 169 GLU CA HA sing N N 170 GLU C O doub N N 171 GLU C OXT sing N N 172 GLU CB CG sing N N 173 GLU CB HB2 sing N N 174 GLU CB HB3 sing N N 175 GLU CG CD sing N N 176 GLU CG HG2 sing N N 177 GLU CG HG3 sing N N 178 GLU CD OE1 doub N N 179 GLU CD OE2 sing N N 180 GLU OE2 HE2 sing N N 181 GLU OXT HXT sing N N 182 GLY N CA sing N N 183 GLY N H sing N N 184 GLY N H2 sing N N 185 GLY CA C sing N N 186 GLY CA HA2 sing N N 187 GLY CA HA3 sing N N 188 GLY C O doub N N 189 GLY C OXT sing N N 190 GLY OXT HXT sing N N 191 GOL C1 O1 sing N N 192 GOL C1 C2 sing N N 193 GOL C1 H11 sing N N 194 GOL C1 H12 sing N N 195 GOL O1 HO1 sing N N 196 GOL C2 O2 sing N N 197 GOL C2 C3 sing N N 198 GOL C2 H2 sing N N 199 GOL O2 HO2 sing N N 200 GOL C3 O3 sing N N 201 GOL C3 H31 sing N N 202 GOL C3 H32 sing N N 203 GOL O3 HO3 sing N N 204 HIS N CA sing N N 205 HIS N H sing N N 206 HIS N H2 sing N N 207 HIS CA C sing N N 208 HIS CA CB sing N N 209 HIS CA HA sing N N 210 HIS C O doub N N 211 HIS C OXT sing N N 212 HIS CB CG sing N N 213 HIS CB HB2 sing N N 214 HIS CB HB3 sing N N 215 HIS CG ND1 sing Y N 216 HIS CG CD2 doub Y N 217 HIS ND1 CE1 doub Y N 218 HIS ND1 HD1 sing N N 219 HIS CD2 NE2 sing Y N 220 HIS CD2 HD2 sing N N 221 HIS CE1 NE2 sing Y N 222 HIS CE1 HE1 sing N N 223 HIS NE2 HE2 sing N N 224 HIS OXT HXT sing N N 225 HOH O H1 sing N N 226 HOH O H2 sing N N 227 ILE N CA sing N N 228 ILE N H sing N N 229 ILE N H2 sing N N 230 ILE CA C sing N N 231 ILE CA CB sing N N 232 ILE CA HA sing N N 233 ILE C O doub N N 234 ILE C OXT sing N N 235 ILE CB CG1 sing N N 236 ILE CB CG2 sing N N 237 ILE CB HB sing N N 238 ILE CG1 CD1 sing N N 239 ILE CG1 HG12 sing N N 240 ILE CG1 HG13 sing N N 241 ILE CG2 HG21 sing N N 242 ILE CG2 HG22 sing N N 243 ILE CG2 HG23 sing N N 244 ILE CD1 HD11 sing N N 245 ILE CD1 HD12 sing N N 246 ILE CD1 HD13 sing N N 247 ILE OXT HXT sing N N 248 LEU N CA sing N N 249 LEU N H sing N N 250 LEU N H2 sing N N 251 LEU CA C sing N N 252 LEU CA CB sing N N 253 LEU CA HA sing N N 254 LEU C O doub N N 255 LEU C OXT sing N N 256 LEU CB CG sing N N 257 LEU CB HB2 sing N N 258 LEU CB HB3 sing N N 259 LEU CG CD1 sing N N 260 LEU CG CD2 sing N N 261 LEU CG HG sing N N 262 LEU CD1 HD11 sing N N 263 LEU CD1 HD12 sing N N 264 LEU CD1 HD13 sing N N 265 LEU CD2 HD21 sing N N 266 LEU CD2 HD22 sing N N 267 LEU CD2 HD23 sing N N 268 LEU OXT HXT sing N N 269 LYS N CA sing N N 270 LYS N H sing N N 271 LYS N H2 sing N N 272 LYS CA C sing N N 273 LYS CA CB sing N N 274 LYS CA HA sing N N 275 LYS C O doub N N 276 LYS C OXT sing N N 277 LYS CB CG sing N N 278 LYS CB HB2 sing N N 279 LYS CB HB3 sing N N 280 LYS CG CD sing N N 281 LYS CG HG2 sing N N 282 LYS CG HG3 sing N N 283 LYS CD CE sing N N 284 LYS CD HD2 sing N N 285 LYS CD HD3 sing N N 286 LYS CE NZ sing N N 287 LYS CE HE2 sing N N 288 LYS CE HE3 sing N N 289 LYS NZ HZ1 sing N N 290 LYS NZ HZ2 sing N N 291 LYS NZ HZ3 sing N N 292 LYS OXT HXT sing N N 293 MET N CA sing N N 294 MET N H sing N N 295 MET N H2 sing N N 296 MET CA C sing N N 297 MET CA CB sing N N 298 MET CA HA sing N N 299 MET C O doub N N 300 MET C OXT sing N N 301 MET CB CG sing N N 302 MET CB HB2 sing N N 303 MET CB HB3 sing N N 304 MET CG SD sing N N 305 MET CG HG2 sing N N 306 MET CG HG3 sing N N 307 MET SD CE sing N N 308 MET CE HE1 sing N N 309 MET CE HE2 sing N N 310 MET CE HE3 sing N N 311 MET OXT HXT sing N N 312 PEG C1 O1 sing N N 313 PEG C1 C2 sing N N 314 PEG C1 H11 sing N N 315 PEG C1 H12 sing N N 316 PEG O1 HO1 sing N N 317 PEG C2 O2 sing N N 318 PEG C2 H21 sing N N 319 PEG C2 H22 sing N N 320 PEG O2 C3 sing N N 321 PEG C3 C4 sing N N 322 PEG C3 H31 sing N N 323 PEG C3 H32 sing N N 324 PEG C4 O4 sing N N 325 PEG C4 H41 sing N N 326 PEG C4 H42 sing N N 327 PEG O4 HO4 sing N N 328 PHE N CA sing N N 329 PHE N H sing N N 330 PHE N H2 sing N N 331 PHE CA C sing N N 332 PHE CA CB sing N N 333 PHE CA HA sing N N 334 PHE C O doub N N 335 PHE C OXT sing N N 336 PHE CB CG sing N N 337 PHE CB HB2 sing N N 338 PHE CB HB3 sing N N 339 PHE CG CD1 doub Y N 340 PHE CG CD2 sing Y N 341 PHE CD1 CE1 sing Y N 342 PHE CD1 HD1 sing N N 343 PHE CD2 CE2 doub Y N 344 PHE CD2 HD2 sing N N 345 PHE CE1 CZ doub Y N 346 PHE CE1 HE1 sing N N 347 PHE CE2 CZ sing Y N 348 PHE CE2 HE2 sing N N 349 PHE CZ HZ sing N N 350 PHE OXT HXT sing N N 351 PRO N CA sing N N 352 PRO N CD sing N N 353 PRO N H sing N N 354 PRO CA C sing N N 355 PRO CA CB sing N N 356 PRO CA HA sing N N 357 PRO C O doub N N 358 PRO C OXT sing N N 359 PRO CB CG sing N N 360 PRO CB HB2 sing N N 361 PRO CB HB3 sing N N 362 PRO CG CD sing N N 363 PRO CG HG2 sing N N 364 PRO CG HG3 sing N N 365 PRO CD HD2 sing N N 366 PRO CD HD3 sing N N 367 PRO OXT HXT sing N N 368 SER N CA sing N N 369 SER N H sing N N 370 SER N H2 sing N N 371 SER CA C sing N N 372 SER CA CB sing N N 373 SER CA HA sing N N 374 SER C O doub N N 375 SER C OXT sing N N 376 SER CB OG sing N N 377 SER CB HB2 sing N N 378 SER CB HB3 sing N N 379 SER OG HG sing N N 380 SER OXT HXT sing N N 381 SO4 S O1 doub N N 382 SO4 S O2 doub N N 383 SO4 S O3 sing N N 384 SO4 S O4 sing N N 385 THR N CA sing N N 386 THR N H sing N N 387 THR N H2 sing N N 388 THR CA C sing N N 389 THR CA CB sing N N 390 THR CA HA sing N N 391 THR C O doub N N 392 THR C OXT sing N N 393 THR CB OG1 sing N N 394 THR CB CG2 sing N N 395 THR CB HB sing N N 396 THR OG1 HG1 sing N N 397 THR CG2 HG21 sing N N 398 THR CG2 HG22 sing N N 399 THR CG2 HG23 sing N N 400 THR OXT HXT sing N N 401 TRP N CA sing N N 402 TRP N H sing N N 403 TRP N H2 sing N N 404 TRP CA C sing N N 405 TRP CA CB sing N N 406 TRP CA HA sing N N 407 TRP C O doub N N 408 TRP C OXT sing N N 409 TRP CB CG sing N N 410 TRP CB HB2 sing N N 411 TRP CB HB3 sing N N 412 TRP CG CD1 doub Y N 413 TRP CG CD2 sing Y N 414 TRP CD1 NE1 sing Y N 415 TRP CD1 HD1 sing N N 416 TRP CD2 CE2 doub Y N 417 TRP CD2 CE3 sing Y N 418 TRP NE1 CE2 sing Y N 419 TRP NE1 HE1 sing N N 420 TRP CE2 CZ2 sing Y N 421 TRP CE3 CZ3 doub Y N 422 TRP CE3 HE3 sing N N 423 TRP CZ2 CH2 doub Y N 424 TRP CZ2 HZ2 sing N N 425 TRP CZ3 CH2 sing Y N 426 TRP CZ3 HZ3 sing N N 427 TRP CH2 HH2 sing N N 428 TRP OXT HXT sing N N 429 TYR N CA sing N N 430 TYR N H sing N N 431 TYR N H2 sing N N 432 TYR CA C sing N N 433 TYR CA CB sing N N 434 TYR CA HA sing N N 435 TYR C O doub N N 436 TYR C OXT sing N N 437 TYR CB CG sing N N 438 TYR CB HB2 sing N N 439 TYR CB HB3 sing N N 440 TYR CG CD1 doub Y N 441 TYR CG CD2 sing Y N 442 TYR CD1 CE1 sing Y N 443 TYR CD1 HD1 sing N N 444 TYR CD2 CE2 doub Y N 445 TYR CD2 HD2 sing N N 446 TYR CE1 CZ doub Y N 447 TYR CE1 HE1 sing N N 448 TYR CE2 CZ sing Y N 449 TYR CE2 HE2 sing N N 450 TYR CZ OH sing N N 451 TYR OH HH sing N N 452 TYR OXT HXT sing N N 453 VAL N CA sing N N 454 VAL N H sing N N 455 VAL N H2 sing N N 456 VAL CA C sing N N 457 VAL CA CB sing N N 458 VAL CA HA sing N N 459 VAL C O doub N N 460 VAL C OXT sing N N 461 VAL CB CG1 sing N N 462 VAL CB CG2 sing N N 463 VAL CB HB sing N N 464 VAL CG1 HG11 sing N N 465 VAL CG1 HG12 sing N N 466 VAL CG1 HG13 sing N N 467 VAL CG2 HG21 sing N N 468 VAL CG2 HG22 sing N N 469 VAL CG2 HG23 sing N N 470 VAL OXT HXT sing N N 471 # _pdbx_audit_support.funding_organization 'Swiss National Science Foundation' _pdbx_audit_support.country Switzerland _pdbx_audit_support.grant_number 310030-212195 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3CKK _pdbx_initial_refinement_model.details ? # _space_group.crystal_system orthorhombic _space_group.IT_number 18 _space_group.name_H-M_alt 'P 21 21 2' _space_group.name_Hall 'P 2 2ab' _space_group.id 1 # _atom_sites.entry_id 29GE _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.023176 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006481 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.023810 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #