data_29OB # _entry.id 29OB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.415 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 29OB pdb_000029ob 10.2210/pdb29ob/pdb WWPDB D_1292155511 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-07-01 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 29OB _pdbx_database_status.recvd_initial_deposition_date 2026-03-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email daniel.merk@cup.lmu.de _pdbx_contact_author.name_first Daniel _pdbx_contact_author.name_last Merk _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-5359-8128 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Morozov, V.' 1 0000-0001-6143-1611 'Lopez-Garcia, U.' 2 ? 'Merk, D.' 3 0000-0002-5359-8128 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of RORg LBD in complex with DHEA' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Morozov, V.' 1 0000-0001-6143-1611 primary 'Lopez-Garcia, U.' 2 ? primary 'Merk, D.' 3 0000-0002-5359-8128 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Nuclear receptor ROR-gamma' 28342.828 1 ? ? ? ? 2 non-polymer syn 3-BETA-HYDROXY-5-ANDROSTEN-17-ONE 288.424 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Nuclear receptor RZR-gamma,Nuclear receptor subfamily 1 group F member 3,RAR-related orphan receptor C,Retinoid-related orphan receptor-gamma ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFME LCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTAL VLINAHRPGLQEKRKVEQLQYNLELAFHHHLHKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYK ELF ; _entity_poly.pdbx_seq_one_letter_code_can ;SASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFME LCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTAL VLINAHRPGLQEKRKVEQLQYNLELAFHHHLHKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYK ELF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 3-BETA-HYDROXY-5-ANDROSTEN-17-ONE _pdbx_entity_nonpoly.comp_id AND # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ALA n 1 3 SER n 1 4 LEU n 1 5 THR n 1 6 GLU n 1 7 ILE n 1 8 GLU n 1 9 HIS n 1 10 LEU n 1 11 VAL n 1 12 GLN n 1 13 SER n 1 14 VAL n 1 15 CYS n 1 16 LYS n 1 17 SER n 1 18 TYR n 1 19 ARG n 1 20 GLU n 1 21 THR n 1 22 CYS n 1 23 GLN n 1 24 LEU n 1 25 ARG n 1 26 LEU n 1 27 GLU n 1 28 ASP n 1 29 LEU n 1 30 LEU n 1 31 ARG n 1 32 GLN n 1 33 ARG n 1 34 SER n 1 35 ASN n 1 36 ILE n 1 37 PHE n 1 38 SER n 1 39 ARG n 1 40 GLU n 1 41 GLU n 1 42 VAL n 1 43 THR n 1 44 GLY n 1 45 TYR n 1 46 GLN n 1 47 ARG n 1 48 LYS n 1 49 SER n 1 50 MET n 1 51 TRP n 1 52 GLU n 1 53 MET n 1 54 TRP n 1 55 GLU n 1 56 ARG n 1 57 CYS n 1 58 ALA n 1 59 HIS n 1 60 HIS n 1 61 LEU n 1 62 THR n 1 63 GLU n 1 64 ALA n 1 65 ILE n 1 66 GLN n 1 67 TYR n 1 68 VAL n 1 69 VAL n 1 70 GLU n 1 71 PHE n 1 72 ALA n 1 73 LYS n 1 74 ARG n 1 75 LEU n 1 76 SER n 1 77 GLY n 1 78 PHE n 1 79 MET n 1 80 GLU n 1 81 LEU n 1 82 CYS n 1 83 GLN n 1 84 ASN n 1 85 ASP n 1 86 GLN n 1 87 ILE n 1 88 VAL n 1 89 LEU n 1 90 LEU n 1 91 LYS n 1 92 ALA n 1 93 GLY n 1 94 ALA n 1 95 MET n 1 96 GLU n 1 97 VAL n 1 98 VAL n 1 99 LEU n 1 100 VAL n 1 101 ARG n 1 102 MET n 1 103 CYS n 1 104 ARG n 1 105 ALA n 1 106 TYR n 1 107 ASN n 1 108 ALA n 1 109 ASP n 1 110 ASN n 1 111 ARG n 1 112 THR n 1 113 VAL n 1 114 PHE n 1 115 PHE n 1 116 GLU n 1 117 GLY n 1 118 LYS n 1 119 TYR n 1 120 GLY n 1 121 GLY n 1 122 MET n 1 123 GLU n 1 124 LEU n 1 125 PHE n 1 126 ARG n 1 127 ALA n 1 128 LEU n 1 129 GLY n 1 130 CYS n 1 131 SER n 1 132 GLU n 1 133 LEU n 1 134 ILE n 1 135 SER n 1 136 SER n 1 137 ILE n 1 138 PHE n 1 139 ASP n 1 140 PHE n 1 141 SER n 1 142 HIS n 1 143 SER n 1 144 LEU n 1 145 SER n 1 146 ALA n 1 147 LEU n 1 148 HIS n 1 149 PHE n 1 150 SER n 1 151 GLU n 1 152 ASP n 1 153 GLU n 1 154 ILE n 1 155 ALA n 1 156 LEU n 1 157 TYR n 1 158 THR n 1 159 ALA n 1 160 LEU n 1 161 VAL n 1 162 LEU n 1 163 ILE n 1 164 ASN n 1 165 ALA n 1 166 HIS n 1 167 ARG n 1 168 PRO n 1 169 GLY n 1 170 LEU n 1 171 GLN n 1 172 GLU n 1 173 LYS n 1 174 ARG n 1 175 LYS n 1 176 VAL n 1 177 GLU n 1 178 GLN n 1 179 LEU n 1 180 GLN n 1 181 TYR n 1 182 ASN n 1 183 LEU n 1 184 GLU n 1 185 LEU n 1 186 ALA n 1 187 PHE n 1 188 HIS n 1 189 HIS n 1 190 HIS n 1 191 LEU n 1 192 HIS n 1 193 LYS n 1 194 THR n 1 195 HIS n 1 196 ARG n 1 197 GLN n 1 198 SER n 1 199 ILE n 1 200 LEU n 1 201 ALA n 1 202 LYS n 1 203 LEU n 1 204 PRO n 1 205 PRO n 1 206 LYS n 1 207 GLY n 1 208 LYS n 1 209 LEU n 1 210 ARG n 1 211 SER n 1 212 LEU n 1 213 CYS n 1 214 SER n 1 215 GLN n 1 216 HIS n 1 217 VAL n 1 218 GLU n 1 219 ARG n 1 220 LEU n 1 221 GLN n 1 222 ILE n 1 223 PHE n 1 224 GLN n 1 225 HIS n 1 226 LEU n 1 227 HIS n 1 228 PRO n 1 229 ILE n 1 230 VAL n 1 231 VAL n 1 232 GLN n 1 233 ALA n 1 234 ALA n 1 235 PHE n 1 236 PRO n 1 237 PRO n 1 238 LEU n 1 239 TYR n 1 240 LYS n 1 241 GLU n 1 242 LEU n 1 243 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 243 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'RORC, NR1F3, RORG, RZRG' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 AND non-polymer . 3-BETA-HYDROXY-5-ANDROSTEN-17-ONE ? 'C19 H28 O2' 288.424 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 264 264 SER SER A . n A 1 2 ALA 2 265 265 ALA ALA A . n A 1 3 SER 3 266 266 SER SER A . n A 1 4 LEU 4 267 267 LEU LEU A . n A 1 5 THR 5 268 268 THR THR A . n A 1 6 GLU 6 269 269 GLU GLU A . n A 1 7 ILE 7 270 270 ILE ILE A . n A 1 8 GLU 8 271 271 GLU GLU A . n A 1 9 HIS 9 272 272 HIS HIS A . n A 1 10 LEU 10 273 273 LEU LEU A . n A 1 11 VAL 11 274 274 VAL VAL A . n A 1 12 GLN 12 275 275 GLN GLN A . n A 1 13 SER 13 276 276 SER SER A . n A 1 14 VAL 14 277 277 VAL VAL A . n A 1 15 CYS 15 278 278 CYS CYS A . n A 1 16 LYS 16 279 279 LYS LYS A . n A 1 17 SER 17 280 280 SER SER A . n A 1 18 TYR 18 281 281 TYR TYR A . n A 1 19 ARG 19 282 282 ARG ARG A . n A 1 20 GLU 20 283 283 GLU GLU A . n A 1 21 THR 21 284 284 THR THR A . n A 1 22 CYS 22 285 285 CYS CYS A . n A 1 23 GLN 23 286 286 GLN GLN A . n A 1 24 LEU 24 287 287 LEU LEU A . n A 1 25 ARG 25 288 288 ARG ARG A . n A 1 26 LEU 26 289 289 LEU LEU A . n A 1 27 GLU 27 290 290 GLU GLU A . n A 1 28 ASP 28 291 291 ASP ASP A . n A 1 29 LEU 29 292 292 LEU LEU A . n A 1 30 LEU 30 293 293 LEU LEU A . n A 1 31 ARG 31 294 294 ARG ARG A . n A 1 32 GLN 32 295 295 GLN GLN A . n A 1 33 ARG 33 296 296 ARG ARG A . n A 1 34 SER 34 297 297 SER SER A . n A 1 35 ASN 35 298 298 ASN ASN A . n A 1 36 ILE 36 299 299 ILE ILE A . n A 1 37 PHE 37 300 300 PHE PHE A . n A 1 38 SER 38 301 301 SER SER A . n A 1 39 ARG 39 302 302 ARG ARG A . n A 1 40 GLU 40 303 303 GLU GLU A . n A 1 41 GLU 41 304 304 GLU GLU A . n A 1 42 VAL 42 305 305 VAL VAL A . n A 1 43 THR 43 306 306 THR THR A . n A 1 44 GLY 44 307 307 GLY GLY A . n A 1 45 TYR 45 308 308 TYR TYR A . n A 1 46 GLN 46 309 309 GLN GLN A . n A 1 47 ARG 47 310 310 ARG ARG A . n A 1 48 LYS 48 311 311 LYS LYS A . n A 1 49 SER 49 312 312 SER SER A . n A 1 50 MET 50 313 313 MET MET A . n A 1 51 TRP 51 314 314 TRP TRP A . n A 1 52 GLU 52 315 315 GLU GLU A . n A 1 53 MET 53 316 316 MET MET A . n A 1 54 TRP 54 317 317 TRP TRP A . n A 1 55 GLU 55 318 318 GLU GLU A . n A 1 56 ARG 56 319 319 ARG ARG A . n A 1 57 CYS 57 320 320 CYS CYS A . n A 1 58 ALA 58 321 321 ALA ALA A . n A 1 59 HIS 59 322 322 HIS HIS A . n A 1 60 HIS 60 323 323 HIS HIS A . n A 1 61 LEU 61 324 324 LEU LEU A . n A 1 62 THR 62 325 325 THR THR A . n A 1 63 GLU 63 326 326 GLU GLU A . n A 1 64 ALA 64 327 327 ALA ALA A . n A 1 65 ILE 65 328 328 ILE ILE A . n A 1 66 GLN 66 329 329 GLN GLN A . n A 1 67 TYR 67 330 330 TYR TYR A . n A 1 68 VAL 68 331 331 VAL VAL A . n A 1 69 VAL 69 332 332 VAL VAL A . n A 1 70 GLU 70 333 333 GLU GLU A . n A 1 71 PHE 71 334 334 PHE PHE A . n A 1 72 ALA 72 335 335 ALA ALA A . n A 1 73 LYS 73 336 336 LYS LYS A . n A 1 74 ARG 74 337 337 ARG ARG A . n A 1 75 LEU 75 338 338 LEU LEU A . n A 1 76 SER 76 339 339 SER SER A . n A 1 77 GLY 77 340 340 GLY GLY A . n A 1 78 PHE 78 341 341 PHE PHE A . n A 1 79 MET 79 342 342 MET MET A . n A 1 80 GLU 80 343 343 GLU GLU A . n A 1 81 LEU 81 344 344 LEU LEU A . n A 1 82 CYS 82 345 345 CYS CYS A . n A 1 83 GLN 83 346 346 GLN GLN A . n A 1 84 ASN 84 347 347 ASN ASN A . n A 1 85 ASP 85 348 348 ASP ASP A . n A 1 86 GLN 86 349 349 GLN GLN A . n A 1 87 ILE 87 350 350 ILE ILE A . n A 1 88 VAL 88 351 351 VAL VAL A . n A 1 89 LEU 89 352 352 LEU LEU A . n A 1 90 LEU 90 353 353 LEU LEU A . n A 1 91 LYS 91 354 354 LYS LYS A . n A 1 92 ALA 92 355 355 ALA ALA A . n A 1 93 GLY 93 356 356 GLY GLY A . n A 1 94 ALA 94 357 357 ALA ALA A . n A 1 95 MET 95 358 358 MET MET A . n A 1 96 GLU 96 359 359 GLU GLU A . n A 1 97 VAL 97 360 360 VAL VAL A . n A 1 98 VAL 98 361 361 VAL VAL A . n A 1 99 LEU 99 362 362 LEU LEU A . n A 1 100 VAL 100 363 363 VAL VAL A . n A 1 101 ARG 101 364 364 ARG ARG A . n A 1 102 MET 102 365 365 MET MET A . n A 1 103 CYS 103 366 366 CYS CYS A . n A 1 104 ARG 104 367 367 ARG ARG A . n A 1 105 ALA 105 368 368 ALA ALA A . n A 1 106 TYR 106 369 369 TYR TYR A . n A 1 107 ASN 107 370 370 ASN ASN A . n A 1 108 ALA 108 371 371 ALA ALA A . n A 1 109 ASP 109 372 372 ASP ASP A . n A 1 110 ASN 110 373 373 ASN ASN A . n A 1 111 ARG 111 374 374 ARG ARG A . n A 1 112 THR 112 375 375 THR THR A . n A 1 113 VAL 113 376 376 VAL VAL A . n A 1 114 PHE 114 377 377 PHE PHE A . n A 1 115 PHE 115 378 378 PHE PHE A . n A 1 116 GLU 116 379 379 GLU GLU A . n A 1 117 GLY 117 380 380 GLY GLY A . n A 1 118 LYS 118 381 381 LYS LYS A . n A 1 119 TYR 119 382 382 TYR TYR A . n A 1 120 GLY 120 383 383 GLY GLY A . n A 1 121 GLY 121 384 384 GLY GLY A . n A 1 122 MET 122 385 385 MET MET A . n A 1 123 GLU 123 386 386 GLU GLU A . n A 1 124 LEU 124 387 387 LEU LEU A . n A 1 125 PHE 125 388 388 PHE PHE A . n A 1 126 ARG 126 389 389 ARG ARG A . n A 1 127 ALA 127 390 390 ALA ALA A . n A 1 128 LEU 128 391 391 LEU LEU A . n A 1 129 GLY 129 392 392 GLY GLY A . n A 1 130 CYS 130 393 393 CYS CYS A . n A 1 131 SER 131 394 394 SER SER A . n A 1 132 GLU 132 395 395 GLU GLU A . n A 1 133 LEU 133 396 396 LEU LEU A . n A 1 134 ILE 134 397 397 ILE ILE A . n A 1 135 SER 135 398 398 SER SER A . n A 1 136 SER 136 399 399 SER SER A . n A 1 137 ILE 137 400 400 ILE ILE A . n A 1 138 PHE 138 401 401 PHE PHE A . n A 1 139 ASP 139 402 402 ASP ASP A . n A 1 140 PHE 140 403 403 PHE PHE A . n A 1 141 SER 141 404 404 SER SER A . n A 1 142 HIS 142 405 405 HIS HIS A . n A 1 143 SER 143 406 406 SER SER A . n A 1 144 LEU 144 407 407 LEU LEU A . n A 1 145 SER 145 408 408 SER SER A . n A 1 146 ALA 146 409 409 ALA ALA A . n A 1 147 LEU 147 410 410 LEU LEU A . n A 1 148 HIS 148 411 411 HIS HIS A . n A 1 149 PHE 149 412 412 PHE PHE A . n A 1 150 SER 150 413 413 SER SER A . n A 1 151 GLU 151 414 414 GLU GLU A . n A 1 152 ASP 152 415 415 ASP ASP A . n A 1 153 GLU 153 416 416 GLU GLU A . n A 1 154 ILE 154 417 417 ILE ILE A . n A 1 155 ALA 155 418 418 ALA ALA A . n A 1 156 LEU 156 419 419 LEU LEU A . n A 1 157 TYR 157 420 420 TYR TYR A . n A 1 158 THR 158 421 421 THR THR A . n A 1 159 ALA 159 422 422 ALA ALA A . n A 1 160 LEU 160 423 423 LEU LEU A . n A 1 161 VAL 161 424 424 VAL VAL A . n A 1 162 LEU 162 425 425 LEU LEU A . n A 1 163 ILE 163 426 426 ILE ILE A . n A 1 164 ASN 164 427 427 ASN ASN A . n A 1 165 ALA 165 428 428 ALA ALA A . n A 1 166 HIS 166 429 429 HIS HIS A . n A 1 167 ARG 167 430 430 ARG ARG A . n A 1 168 PRO 168 431 431 PRO PRO A . n A 1 169 GLY 169 432 432 GLY GLY A . n A 1 170 LEU 170 433 433 LEU LEU A . n A 1 171 GLN 171 434 434 GLN GLN A . n A 1 172 GLU 172 435 435 GLU GLU A . n A 1 173 LYS 173 436 436 LYS LYS A . n A 1 174 ARG 174 437 437 ARG ARG A . n A 1 175 LYS 175 438 438 LYS LYS A . n A 1 176 VAL 176 439 439 VAL VAL A . n A 1 177 GLU 177 440 440 GLU GLU A . n A 1 178 GLN 178 441 441 GLN GLN A . n A 1 179 LEU 179 442 442 LEU LEU A . n A 1 180 GLN 180 443 443 GLN GLN A . n A 1 181 TYR 181 444 444 TYR TYR A . n A 1 182 ASN 182 445 445 ASN ASN A . n A 1 183 LEU 183 446 446 LEU LEU A . n A 1 184 GLU 184 447 447 GLU GLU A . n A 1 185 LEU 185 448 448 LEU LEU A . n A 1 186 ALA 186 449 449 ALA ALA A . n A 1 187 PHE 187 450 450 PHE PHE A . n A 1 188 HIS 188 451 451 HIS HIS A . n A 1 189 HIS 189 452 452 HIS HIS A . n A 1 190 HIS 190 453 453 HIS HIS A . n A 1 191 LEU 191 454 454 LEU LEU A . n A 1 192 HIS 192 455 455 HIS HIS A . n A 1 193 LYS 193 456 456 LYS LYS A . n A 1 194 THR 194 457 457 THR THR A . n A 1 195 HIS 195 458 458 HIS HIS A . n A 1 196 ARG 196 459 459 ARG ARG A . n A 1 197 GLN 197 460 460 GLN GLN A . n A 1 198 SER 198 461 461 SER SER A . n A 1 199 ILE 199 462 462 ILE ILE A . n A 1 200 LEU 200 463 463 LEU LEU A . n A 1 201 ALA 201 464 464 ALA ALA A . n A 1 202 LYS 202 465 465 LYS LYS A . n A 1 203 LEU 203 466 466 LEU LEU A . n A 1 204 PRO 204 467 467 PRO PRO A . n A 1 205 PRO 205 468 468 PRO PRO A . n A 1 206 LYS 206 469 469 LYS LYS A . n A 1 207 GLY 207 470 470 GLY GLY A . n A 1 208 LYS 208 471 471 LYS LYS A . n A 1 209 LEU 209 472 472 LEU LEU A . n A 1 210 ARG 210 473 473 ARG ARG A . n A 1 211 SER 211 474 474 SER SER A . n A 1 212 LEU 212 475 475 LEU LEU A . n A 1 213 CYS 213 476 476 CYS CYS A . n A 1 214 SER 214 477 477 SER SER A . n A 1 215 GLN 215 478 478 GLN GLN A . n A 1 216 HIS 216 479 479 HIS HIS A . n A 1 217 VAL 217 480 480 VAL VAL A . n A 1 218 GLU 218 481 481 GLU GLU A . n A 1 219 ARG 219 482 482 ARG ARG A . n A 1 220 LEU 220 483 483 LEU LEU A . n A 1 221 GLN 221 484 484 GLN GLN A . n A 1 222 ILE 222 485 485 ILE ILE A . n A 1 223 PHE 223 486 486 PHE PHE A . n A 1 224 GLN 224 487 487 GLN GLN A . n A 1 225 HIS 225 488 488 HIS HIS A . n A 1 226 LEU 226 489 489 LEU LEU A . n A 1 227 HIS 227 490 490 HIS HIS A . n A 1 228 PRO 228 491 491 PRO PRO A . n A 1 229 ILE 229 492 ? ? ? A . n A 1 230 VAL 230 493 ? ? ? A . n A 1 231 VAL 231 494 ? ? ? A . n A 1 232 GLN 232 495 ? ? ? A . n A 1 233 ALA 233 496 ? ? ? A . n A 1 234 ALA 234 497 ? ? ? A . n A 1 235 PHE 235 498 ? ? ? A . n A 1 236 PRO 236 499 ? ? ? A . n A 1 237 PRO 237 500 ? ? ? A . n A 1 238 LEU 238 501 ? ? ? A . n A 1 239 TYR 239 502 ? ? ? A . n A 1 240 LYS 240 503 ? ? ? A . n A 1 241 GLU 241 504 ? ? ? A . n A 1 242 LEU 242 505 ? ? ? A . n A 1 243 PHE 243 506 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id AND _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id AND _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id AND _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 601 _pdbx_nonpoly_scheme.auth_seq_num 501 _pdbx_nonpoly_scheme.pdb_mon_id AND _pdbx_nonpoly_scheme.auth_mon_id AND _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 282 ? CG ? A ARG 19 CG 2 1 Y 1 A ARG 282 ? CD ? A ARG 19 CD 3 1 Y 1 A ARG 282 ? NE ? A ARG 19 NE 4 1 Y 1 A ARG 282 ? CZ ? A ARG 19 CZ 5 1 Y 1 A ARG 282 ? NH1 ? A ARG 19 NH1 6 1 Y 1 A ARG 282 ? NH2 ? A ARG 19 NH2 7 1 Y 1 A TYR 330 ? CG ? A TYR 67 CG 8 1 Y 1 A TYR 330 ? CD1 ? A TYR 67 CD1 9 1 Y 1 A TYR 330 ? CD2 ? A TYR 67 CD2 10 1 Y 1 A TYR 330 ? CE1 ? A TYR 67 CE1 11 1 Y 1 A TYR 330 ? CE2 ? A TYR 67 CE2 12 1 Y 1 A TYR 330 ? CZ ? A TYR 67 CZ 13 1 Y 1 A TYR 330 ? OH ? A TYR 67 OH 14 1 Y 1 A GLU 333 ? CG ? A GLU 70 CG 15 1 Y 1 A GLU 333 ? CD ? A GLU 70 CD 16 1 Y 1 A GLU 333 ? OE1 ? A GLU 70 OE1 17 1 Y 1 A GLU 333 ? OE2 ? A GLU 70 OE2 18 1 Y 1 A SER 339 ? OG ? A SER 76 OG 19 1 Y 1 A GLU 481 ? CG ? A GLU 218 CG 20 1 Y 1 A GLU 481 ? CD ? A GLU 218 CD 21 1 Y 1 A GLU 481 ? OE1 ? A GLU 218 OE1 22 1 Y 1 A GLU 481 ? OE2 ? A GLU 218 OE2 23 1 Y 1 A HIS 490 ? CG ? A HIS 227 CG 24 1 Y 1 A HIS 490 ? ND1 ? A HIS 227 ND1 25 1 Y 1 A HIS 490 ? CD2 ? A HIS 227 CD2 26 1 Y 1 A HIS 490 ? CE1 ? A HIS 227 CE1 27 1 Y 1 A HIS 490 ? NE2 ? A HIS 227 NE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 2.0_5936 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 29OB _cell.details ? _cell.formula_units_Z ? _cell.length_a 101.141 _cell.length_a_esd ? _cell.length_b 101.141 _cell.length_b_esd ? _cell.length_c 139.666 _cell.length_c_esd ? _cell.volume 1237302.281 _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 29OB _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall 'P 61 2 (x,y,z+5/12)' _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 29OB _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.64 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 66.19 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% PEG 8000 0.1M CAPS pH 10.5 0.2M NaCl' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 277 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 4M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2025-12-10 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9677 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE MASSIF-3' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9677 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MASSIF-3 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 90.40 _reflns.entry_id 29OB _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.6 _reflns.d_resolution_low 74.21 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 4891 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 92.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 3.55 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.988 _reflns.pdbx_CC_star 0.997 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 3.6 _reflns_shell.d_res_low 4.54 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2253 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.776 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 87.14 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 29OB _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.60 _refine.ls_d_res_low 74.21 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4887 _refine.ls_number_reflns_R_free 244 _refine.ls_number_reflns_R_work 4643 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 92.35 _refine.ls_percent_reflns_R_free 4.99 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2504 _refine.ls_R_factor_R_free 0.2828 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2487 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 20.8936 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.6122 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.60 _refine_hist.d_res_low 74.21 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1861 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1840 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 21 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0028 ? 1901 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.5402 ? 2566 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0367 ? 286 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0033 ? 324 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 12.9056 ? 753 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 3.60 4.54 . . 113 2139 87.80 . . . . 0.2692 . . . . . . . . . . . . . . . 0.3503 'X-RAY DIFFRACTION' 4.54 74.21 . . 131 2504 96.63 . . . . 0.2376 . . . . . . . . . . . . . . . 0.2512 # _struct.entry_id 29OB _struct.title 'Crystal structure of RORg LBD in complex with DHEA' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 29OB _struct_keywords.text 'Nuclear receptors, Inhibitor, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RORG_HUMAN _struct_ref.pdbx_db_accession P51449 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMEL CQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALV LINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKE LF ; _struct_ref.pdbx_align_begin 265 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 29OB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 243 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P51449 _struct_ref_seq.db_align_beg 265 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 506 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 265 _struct_ref_seq.pdbx_auth_seq_align_end 506 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 29OB SER A 1 ? UNP P51449 ? ? 'expression tag' 264 1 1 29OB HIS A 192 ? UNP P51449 CYS 455 'engineered mutation' 455 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 680 ? 1 MORE -2 ? 1 'SSA (A^2)' 12940 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 4 ? CYS A 22 ? LEU A 267 CYS A 285 1 ? 19 HELX_P HELX_P2 AA2 ARG A 25 ? ARG A 33 ? ARG A 288 ARG A 296 1 ? 9 HELX_P HELX_P3 AA3 SER A 38 ? ARG A 47 ? SER A 301 ARG A 310 1 ? 10 HELX_P HELX_P4 AA4 SER A 49 ? LEU A 75 ? SER A 312 LEU A 338 1 ? 27 HELX_P HELX_P5 AA5 GLY A 77 ? LEU A 81 ? GLY A 340 LEU A 344 5 ? 5 HELX_P HELX_P6 AA6 CYS A 82 ? MET A 102 ? CYS A 345 MET A 365 1 ? 21 HELX_P HELX_P7 AA7 GLY A 121 ? GLY A 129 ? GLY A 384 GLY A 392 5 ? 9 HELX_P HELX_P8 AA8 CYS A 130 ? HIS A 148 ? CYS A 393 HIS A 411 1 ? 19 HELX_P HELX_P9 AA9 SER A 150 ? ILE A 163 ? SER A 413 ILE A 426 1 ? 14 HELX_P HELX_P10 AB1 GLU A 172 ? THR A 194 ? GLU A 435 THR A 457 1 ? 23 HELX_P HELX_P11 AB2 GLY A 207 ? CYS A 213 ? GLY A 470 CYS A 476 1 ? 7 HELX_P HELX_P12 AB3 SER A 214 ? ARG A 219 ? SER A 477 ARG A 482 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 106 ? ASN A 107 ? TYR A 369 ASN A 370 AA1 2 THR A 112 ? PHE A 114 ? THR A 375 PHE A 377 AA1 3 TYR A 119 ? GLY A 120 ? TYR A 382 GLY A 383 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASN A 107 ? N ASN A 370 O THR A 112 ? O THR A 375 AA1 2 3 N VAL A 113 ? N VAL A 376 O GLY A 120 ? O GLY A 383 # _pdbx_entry_details.entry_id 29OB _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 265 ? ? -171.10 146.71 2 1 SER A 266 ? ? -161.93 -168.69 3 1 LEU A 267 ? ? 67.67 -154.53 4 1 HIS A 272 ? ? -55.69 -9.18 5 1 GLN A 286 ? ? 75.13 -70.69 6 1 SER A 339 ? ? -59.61 109.80 7 1 MET A 342 ? ? -72.37 20.69 8 1 ALA A 368 ? ? -94.25 47.62 9 1 CYS A 393 ? ? -157.96 80.97 10 1 HIS A 411 ? ? 56.54 72.62 11 1 GLU A 435 ? ? -105.26 58.23 12 1 HIS A 458 ? ? 49.06 26.89 13 1 ARG A 459 ? ? -108.44 58.15 14 1 GLU A 481 ? ? -88.27 41.22 15 1 GLN A 487 ? ? -111.66 -148.78 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+1/6 3 y,-x+y,z+5/6 4 -y,x-y,z+1/3 5 -x+y,-x,z+2/3 6 x-y,-y,-z 7 -x,-x+y,-z+2/3 8 -x,-y,z+1/2 9 y,x,-z+1/3 10 -y,-x,-z+5/6 11 -x+y,y,-z+1/2 12 x,x-y,-z+1/6 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ILE 492 ? A ILE 229 2 1 Y 1 A VAL 493 ? A VAL 230 3 1 Y 1 A VAL 494 ? A VAL 231 4 1 Y 1 A GLN 495 ? A GLN 232 5 1 Y 1 A ALA 496 ? A ALA 233 6 1 Y 1 A ALA 497 ? A ALA 234 7 1 Y 1 A PHE 498 ? A PHE 235 8 1 Y 1 A PRO 499 ? A PRO 236 9 1 Y 1 A PRO 500 ? A PRO 237 10 1 Y 1 A LEU 501 ? A LEU 238 11 1 Y 1 A TYR 502 ? A TYR 239 12 1 Y 1 A LYS 503 ? A LYS 240 13 1 Y 1 A GLU 504 ? A GLU 241 14 1 Y 1 A LEU 505 ? A LEU 242 15 1 Y 1 A PHE 506 ? A PHE 243 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 AND C1 C N N 14 AND C2 C N N 15 AND C3 C N S 16 AND O3 O N N 17 AND C4 C N N 18 AND C5 C N N 19 AND C6 C N N 20 AND C7 C N N 21 AND C8 C N R 22 AND C9 C N S 23 AND C10 C N R 24 AND C11 C N N 25 AND C12 C N N 26 AND C13 C N S 27 AND C14 C N S 28 AND C15 C N N 29 AND C16 C N N 30 AND C17 C N N 31 AND O17 O N N 32 AND C18 C N N 33 AND C19 C N N 34 AND H11 H N N 35 AND H12 H N N 36 AND H21 H N N 37 AND H22 H N N 38 AND H3 H N N 39 AND HO3 H N N 40 AND H41 H N N 41 AND H42 H N N 42 AND H6 H N N 43 AND H71 H N N 44 AND H72 H N N 45 AND H8 H N N 46 AND H9 H N N 47 AND H111 H N N 48 AND H112 H N N 49 AND H121 H N N 50 AND H122 H N N 51 AND H14 H N N 52 AND H151 H N N 53 AND H152 H N N 54 AND H161 H N N 55 AND H162 H N N 56 AND H181 H N N 57 AND H182 H N N 58 AND H183 H N N 59 AND H191 H N N 60 AND H192 H N N 61 AND H193 H N N 62 ARG N N N N 63 ARG CA C N S 64 ARG C C N N 65 ARG O O N N 66 ARG CB C N N 67 ARG CG C N N 68 ARG CD C N N 69 ARG NE N N N 70 ARG CZ C N N 71 ARG NH1 N N N 72 ARG NH2 N N N 73 ARG OXT O N N 74 ARG H H N N 75 ARG H2 H N N 76 ARG HA H N N 77 ARG HB2 H N N 78 ARG HB3 H N N 79 ARG HG2 H N N 80 ARG HG3 H N N 81 ARG HD2 H N N 82 ARG HD3 H N N 83 ARG HE H N N 84 ARG HH11 H N N 85 ARG HH12 H N N 86 ARG HH21 H N N 87 ARG HH22 H N N 88 ARG HXT H N N 89 ASN N N N N 90 ASN CA C N S 91 ASN C C N N 92 ASN O O N N 93 ASN CB C N N 94 ASN CG C N N 95 ASN OD1 O N N 96 ASN ND2 N N N 97 ASN OXT O N N 98 ASN H H N N 99 ASN H2 H N N 100 ASN HA H N N 101 ASN HB2 H N N 102 ASN HB3 H N N 103 ASN HD21 H N N 104 ASN HD22 H N N 105 ASN HXT H N N 106 ASP N N N N 107 ASP CA C N S 108 ASP C C N N 109 ASP O O N N 110 ASP CB C N N 111 ASP CG C N N 112 ASP OD1 O N N 113 ASP OD2 O N N 114 ASP OXT O N N 115 ASP H H N N 116 ASP H2 H N N 117 ASP HA H N N 118 ASP HB2 H N N 119 ASP HB3 H N N 120 ASP HD2 H N N 121 ASP HXT H N N 122 CYS N N N N 123 CYS CA C N R 124 CYS C C N N 125 CYS O O N N 126 CYS CB C N N 127 CYS SG S N N 128 CYS OXT O N N 129 CYS H H N N 130 CYS H2 H N N 131 CYS HA H N N 132 CYS HB2 H N N 133 CYS HB3 H N N 134 CYS HG H N N 135 CYS HXT H N N 136 GLN N N N N 137 GLN CA C N S 138 GLN C C N N 139 GLN O O N N 140 GLN CB C N N 141 GLN CG C N N 142 GLN CD C N N 143 GLN OE1 O N N 144 GLN NE2 N N N 145 GLN OXT O N N 146 GLN H H N N 147 GLN H2 H N N 148 GLN HA H N N 149 GLN HB2 H N N 150 GLN HB3 H N N 151 GLN HG2 H N N 152 GLN HG3 H N N 153 GLN HE21 H N N 154 GLN HE22 H N N 155 GLN HXT H N N 156 GLU N N N N 157 GLU CA C N S 158 GLU C C N N 159 GLU O O N N 160 GLU CB C N N 161 GLU CG C N N 162 GLU CD C N N 163 GLU OE1 O N N 164 GLU OE2 O N N 165 GLU OXT O N N 166 GLU H H N N 167 GLU H2 H N N 168 GLU HA H N N 169 GLU HB2 H N N 170 GLU HB3 H N N 171 GLU HG2 H N N 172 GLU HG3 H N N 173 GLU HE2 H N N 174 GLU HXT H N N 175 GLY N N N N 176 GLY CA C N N 177 GLY C C N N 178 GLY O O N N 179 GLY OXT O N N 180 GLY H H N N 181 GLY H2 H N N 182 GLY HA2 H N N 183 GLY HA3 H N N 184 GLY HXT H N N 185 HIS N N N N 186 HIS CA C N S 187 HIS C C N N 188 HIS O O N N 189 HIS CB C N N 190 HIS CG C Y N 191 HIS ND1 N Y N 192 HIS CD2 C Y N 193 HIS CE1 C Y N 194 HIS NE2 N Y N 195 HIS OXT O N N 196 HIS H H N N 197 HIS H2 H N N 198 HIS HA H N N 199 HIS HB2 H N N 200 HIS HB3 H N N 201 HIS HD1 H N N 202 HIS HD2 H N N 203 HIS HE1 H N N 204 HIS HE2 H N N 205 HIS HXT H N N 206 ILE N N N N 207 ILE CA C N S 208 ILE C C N N 209 ILE O O N N 210 ILE CB C N S 211 ILE CG1 C N N 212 ILE CG2 C N N 213 ILE CD1 C N N 214 ILE OXT O N N 215 ILE H H N N 216 ILE H2 H N N 217 ILE HA H N N 218 ILE HB H N N 219 ILE HG12 H N N 220 ILE HG13 H N N 221 ILE HG21 H N N 222 ILE HG22 H N N 223 ILE HG23 H N N 224 ILE HD11 H N N 225 ILE HD12 H N N 226 ILE HD13 H N N 227 ILE HXT H N N 228 LEU N N N N 229 LEU CA C N S 230 LEU C C N N 231 LEU O O N N 232 LEU CB C N N 233 LEU CG C N N 234 LEU CD1 C N N 235 LEU CD2 C N N 236 LEU OXT O N N 237 LEU H H N N 238 LEU H2 H N N 239 LEU HA H N N 240 LEU HB2 H N N 241 LEU HB3 H N N 242 LEU HG H N N 243 LEU HD11 H N N 244 LEU HD12 H N N 245 LEU HD13 H N N 246 LEU HD21 H N N 247 LEU HD22 H N N 248 LEU HD23 H N N 249 LEU HXT H N N 250 LYS N N N N 251 LYS CA C N S 252 LYS C C N N 253 LYS O O N N 254 LYS CB C N N 255 LYS CG C N N 256 LYS CD C N N 257 LYS CE C N N 258 LYS NZ N N N 259 LYS OXT O N N 260 LYS H H N N 261 LYS H2 H N N 262 LYS HA H N N 263 LYS HB2 H N N 264 LYS HB3 H N N 265 LYS HG2 H N N 266 LYS HG3 H N N 267 LYS HD2 H N N 268 LYS HD3 H N N 269 LYS HE2 H N N 270 LYS HE3 H N N 271 LYS HZ1 H N N 272 LYS HZ2 H N N 273 LYS HZ3 H N N 274 LYS HXT H N N 275 MET N N N N 276 MET CA C N S 277 MET C C N N 278 MET O O N N 279 MET CB C N N 280 MET CG C N N 281 MET SD S N N 282 MET CE C N N 283 MET OXT O N N 284 MET H H N N 285 MET H2 H N N 286 MET HA H N N 287 MET HB2 H N N 288 MET HB3 H N N 289 MET HG2 H N N 290 MET HG3 H N N 291 MET HE1 H N N 292 MET HE2 H N N 293 MET HE3 H N N 294 MET HXT H N N 295 PHE N N N N 296 PHE CA C N S 297 PHE C C N N 298 PHE O O N N 299 PHE CB C N N 300 PHE CG C Y N 301 PHE CD1 C Y N 302 PHE CD2 C Y N 303 PHE CE1 C Y N 304 PHE CE2 C Y N 305 PHE CZ C Y N 306 PHE OXT O N N 307 PHE H H N N 308 PHE H2 H N N 309 PHE HA H N N 310 PHE HB2 H N N 311 PHE HB3 H N N 312 PHE HD1 H N N 313 PHE HD2 H N N 314 PHE HE1 H N N 315 PHE HE2 H N N 316 PHE HZ H N N 317 PHE HXT H N N 318 PRO N N N N 319 PRO CA C N S 320 PRO C C N N 321 PRO O O N N 322 PRO CB C N N 323 PRO CG C N N 324 PRO CD C N N 325 PRO OXT O N N 326 PRO H H N N 327 PRO HA H N N 328 PRO HB2 H N N 329 PRO HB3 H N N 330 PRO HG2 H N N 331 PRO HG3 H N N 332 PRO HD2 H N N 333 PRO HD3 H N N 334 PRO HXT H N N 335 SER N N N N 336 SER CA C N S 337 SER C C N N 338 SER O O N N 339 SER CB C N N 340 SER OG O N N 341 SER OXT O N N 342 SER H H N N 343 SER H2 H N N 344 SER HA H N N 345 SER HB2 H N N 346 SER HB3 H N N 347 SER HG H N N 348 SER HXT H N N 349 THR N N N N 350 THR CA C N S 351 THR C C N N 352 THR O O N N 353 THR CB C N R 354 THR OG1 O N N 355 THR CG2 C N N 356 THR OXT O N N 357 THR H H N N 358 THR H2 H N N 359 THR HA H N N 360 THR HB H N N 361 THR HG1 H N N 362 THR HG21 H N N 363 THR HG22 H N N 364 THR HG23 H N N 365 THR HXT H N N 366 TRP N N N N 367 TRP CA C N S 368 TRP C C N N 369 TRP O O N N 370 TRP CB C N N 371 TRP CG C Y N 372 TRP CD1 C Y N 373 TRP CD2 C Y N 374 TRP NE1 N Y N 375 TRP CE2 C Y N 376 TRP CE3 C Y N 377 TRP CZ2 C Y N 378 TRP CZ3 C Y N 379 TRP CH2 C Y N 380 TRP OXT O N N 381 TRP H H N N 382 TRP H2 H N N 383 TRP HA H N N 384 TRP HB2 H N N 385 TRP HB3 H N N 386 TRP HD1 H N N 387 TRP HE1 H N N 388 TRP HE3 H N N 389 TRP HZ2 H N N 390 TRP HZ3 H N N 391 TRP HH2 H N N 392 TRP HXT H N N 393 TYR N N N N 394 TYR CA C N S 395 TYR C C N N 396 TYR O O N N 397 TYR CB C N N 398 TYR CG C Y N 399 TYR CD1 C Y N 400 TYR CD2 C Y N 401 TYR CE1 C Y N 402 TYR CE2 C Y N 403 TYR CZ C Y N 404 TYR OH O N N 405 TYR OXT O N N 406 TYR H H N N 407 TYR H2 H N N 408 TYR HA H N N 409 TYR HB2 H N N 410 TYR HB3 H N N 411 TYR HD1 H N N 412 TYR HD2 H N N 413 TYR HE1 H N N 414 TYR HE2 H N N 415 TYR HH H N N 416 TYR HXT H N N 417 VAL N N N N 418 VAL CA C N S 419 VAL C C N N 420 VAL O O N N 421 VAL CB C N N 422 VAL CG1 C N N 423 VAL CG2 C N N 424 VAL OXT O N N 425 VAL H H N N 426 VAL H2 H N N 427 VAL HA H N N 428 VAL HB H N N 429 VAL HG11 H N N 430 VAL HG12 H N N 431 VAL HG13 H N N 432 VAL HG21 H N N 433 VAL HG22 H N N 434 VAL HG23 H N N 435 VAL HXT H N N 436 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 AND C1 C2 sing N N 13 AND C1 C10 sing N N 14 AND C1 H11 sing N N 15 AND C1 H12 sing N N 16 AND C2 C3 sing N N 17 AND C2 H21 sing N N 18 AND C2 H22 sing N N 19 AND C3 O3 sing N N 20 AND C3 C4 sing N N 21 AND C3 H3 sing N N 22 AND O3 HO3 sing N N 23 AND C4 C5 sing N N 24 AND C4 H41 sing N N 25 AND C4 H42 sing N N 26 AND C5 C6 doub N N 27 AND C5 C10 sing N N 28 AND C6 C7 sing N N 29 AND C6 H6 sing N N 30 AND C7 C8 sing N N 31 AND C7 H71 sing N N 32 AND C7 H72 sing N N 33 AND C8 C9 sing N N 34 AND C8 C14 sing N N 35 AND C8 H8 sing N N 36 AND C9 C10 sing N N 37 AND C9 C11 sing N N 38 AND C9 H9 sing N N 39 AND C10 C19 sing N N 40 AND C11 C12 sing N N 41 AND C11 H111 sing N N 42 AND C11 H112 sing N N 43 AND C12 C13 sing N N 44 AND C12 H121 sing N N 45 AND C12 H122 sing N N 46 AND C13 C14 sing N N 47 AND C13 C17 sing N N 48 AND C13 C18 sing N N 49 AND C14 C15 sing N N 50 AND C14 H14 sing N N 51 AND C15 C16 sing N N 52 AND C15 H151 sing N N 53 AND C15 H152 sing N N 54 AND C16 C17 sing N N 55 AND C16 H161 sing N N 56 AND C16 H162 sing N N 57 AND C17 O17 doub N N 58 AND C18 H181 sing N N 59 AND C18 H182 sing N N 60 AND C18 H183 sing N N 61 AND C19 H191 sing N N 62 AND C19 H192 sing N N 63 AND C19 H193 sing N N 64 ARG N CA sing N N 65 ARG N H sing N N 66 ARG N H2 sing N N 67 ARG CA C sing N N 68 ARG CA CB sing N N 69 ARG CA HA sing N N 70 ARG C O doub N N 71 ARG C OXT sing N N 72 ARG CB CG sing N N 73 ARG CB HB2 sing N N 74 ARG CB HB3 sing N N 75 ARG CG CD sing N N 76 ARG CG HG2 sing N N 77 ARG CG HG3 sing N N 78 ARG CD NE sing N N 79 ARG CD HD2 sing N N 80 ARG CD HD3 sing N N 81 ARG NE CZ sing N N 82 ARG NE HE sing N N 83 ARG CZ NH1 sing N N 84 ARG CZ NH2 doub N N 85 ARG NH1 HH11 sing N N 86 ARG NH1 HH12 sing N N 87 ARG NH2 HH21 sing N N 88 ARG NH2 HH22 sing N N 89 ARG OXT HXT sing N N 90 ASN N CA sing N N 91 ASN N H sing N N 92 ASN N H2 sing N N 93 ASN CA C sing N N 94 ASN CA CB sing N N 95 ASN CA HA sing N N 96 ASN C O doub N N 97 ASN C OXT sing N N 98 ASN CB CG sing N N 99 ASN CB HB2 sing N N 100 ASN CB HB3 sing N N 101 ASN CG OD1 doub N N 102 ASN CG ND2 sing N N 103 ASN ND2 HD21 sing N N 104 ASN ND2 HD22 sing N N 105 ASN OXT HXT sing N N 106 ASP N CA sing N N 107 ASP N H sing N N 108 ASP N H2 sing N N 109 ASP CA C sing N N 110 ASP CA CB sing N N 111 ASP CA HA sing N N 112 ASP C O doub N N 113 ASP C OXT sing N N 114 ASP CB CG sing N N 115 ASP CB HB2 sing N N 116 ASP CB HB3 sing N N 117 ASP CG OD1 doub N N 118 ASP CG OD2 sing N N 119 ASP OD2 HD2 sing N N 120 ASP OXT HXT sing N N 121 CYS N CA sing N N 122 CYS N H sing N N 123 CYS N H2 sing N N 124 CYS CA C sing N N 125 CYS CA CB sing N N 126 CYS CA HA sing N N 127 CYS C O doub N N 128 CYS C OXT sing N N 129 CYS CB SG sing N N 130 CYS CB HB2 sing N N 131 CYS CB HB3 sing N N 132 CYS SG HG sing N N 133 CYS OXT HXT sing N N 134 GLN N CA sing N N 135 GLN N H sing N N 136 GLN N H2 sing N N 137 GLN CA C sing N N 138 GLN CA CB sing N N 139 GLN CA HA sing N N 140 GLN C O doub N N 141 GLN C OXT sing N N 142 GLN CB CG sing N N 143 GLN CB HB2 sing N N 144 GLN CB HB3 sing N N 145 GLN CG CD sing N N 146 GLN CG HG2 sing N N 147 GLN CG HG3 sing N N 148 GLN CD OE1 doub N N 149 GLN CD NE2 sing N N 150 GLN NE2 HE21 sing N N 151 GLN NE2 HE22 sing N N 152 GLN OXT HXT sing N N 153 GLU N CA sing N N 154 GLU N H sing N N 155 GLU N H2 sing N N 156 GLU CA C sing N N 157 GLU CA CB sing N N 158 GLU CA HA sing N N 159 GLU C O doub N N 160 GLU C OXT sing N N 161 GLU CB CG sing N N 162 GLU CB HB2 sing N N 163 GLU CB HB3 sing N N 164 GLU CG CD sing N N 165 GLU CG HG2 sing N N 166 GLU CG HG3 sing N N 167 GLU CD OE1 doub N N 168 GLU CD OE2 sing N N 169 GLU OE2 HE2 sing N N 170 GLU OXT HXT sing N N 171 GLY N CA sing N N 172 GLY N H sing N N 173 GLY N H2 sing N N 174 GLY CA C sing N N 175 GLY CA HA2 sing N N 176 GLY CA HA3 sing N N 177 GLY C O doub N N 178 GLY C OXT sing N N 179 GLY OXT HXT sing N N 180 HIS N CA sing N N 181 HIS N H sing N N 182 HIS N H2 sing N N 183 HIS CA C sing N N 184 HIS CA CB sing N N 185 HIS CA HA sing N N 186 HIS C O doub N N 187 HIS C OXT sing N N 188 HIS CB CG sing N N 189 HIS CB HB2 sing N N 190 HIS CB HB3 sing N N 191 HIS CG ND1 sing Y N 192 HIS CG CD2 doub Y N 193 HIS ND1 CE1 doub Y N 194 HIS ND1 HD1 sing N N 195 HIS CD2 NE2 sing Y N 196 HIS CD2 HD2 sing N N 197 HIS CE1 NE2 sing Y N 198 HIS CE1 HE1 sing N N 199 HIS NE2 HE2 sing N N 200 HIS OXT HXT sing N N 201 ILE N CA sing N N 202 ILE N H sing N N 203 ILE N H2 sing N N 204 ILE CA C sing N N 205 ILE CA CB sing N N 206 ILE CA HA sing N N 207 ILE C O doub N N 208 ILE C OXT sing N N 209 ILE CB CG1 sing N N 210 ILE CB CG2 sing N N 211 ILE CB HB sing N N 212 ILE CG1 CD1 sing N N 213 ILE CG1 HG12 sing N N 214 ILE CG1 HG13 sing N N 215 ILE CG2 HG21 sing N N 216 ILE CG2 HG22 sing N N 217 ILE CG2 HG23 sing N N 218 ILE CD1 HD11 sing N N 219 ILE CD1 HD12 sing N N 220 ILE CD1 HD13 sing N N 221 ILE OXT HXT sing N N 222 LEU N CA sing N N 223 LEU N H sing N N 224 LEU N H2 sing N N 225 LEU CA C sing N N 226 LEU CA CB sing N N 227 LEU CA HA sing N N 228 LEU C O doub N N 229 LEU C OXT sing N N 230 LEU CB CG sing N N 231 LEU CB HB2 sing N N 232 LEU CB HB3 sing N N 233 LEU CG CD1 sing N N 234 LEU CG CD2 sing N N 235 LEU CG HG sing N N 236 LEU CD1 HD11 sing N N 237 LEU CD1 HD12 sing N N 238 LEU CD1 HD13 sing N N 239 LEU CD2 HD21 sing N N 240 LEU CD2 HD22 sing N N 241 LEU CD2 HD23 sing N N 242 LEU OXT HXT sing N N 243 LYS N CA sing N N 244 LYS N H sing N N 245 LYS N H2 sing N N 246 LYS CA C sing N N 247 LYS CA CB sing N N 248 LYS CA HA sing N N 249 LYS C O doub N N 250 LYS C OXT sing N N 251 LYS CB CG sing N N 252 LYS CB HB2 sing N N 253 LYS CB HB3 sing N N 254 LYS CG CD sing N N 255 LYS CG HG2 sing N N 256 LYS CG HG3 sing N N 257 LYS CD CE sing N N 258 LYS CD HD2 sing N N 259 LYS CD HD3 sing N N 260 LYS CE NZ sing N N 261 LYS CE HE2 sing N N 262 LYS CE HE3 sing N N 263 LYS NZ HZ1 sing N N 264 LYS NZ HZ2 sing N N 265 LYS NZ HZ3 sing N N 266 LYS OXT HXT sing N N 267 MET N CA sing N N 268 MET N H sing N N 269 MET N H2 sing N N 270 MET CA C sing N N 271 MET CA CB sing N N 272 MET CA HA sing N N 273 MET C O doub N N 274 MET C OXT sing N N 275 MET CB CG sing N N 276 MET CB HB2 sing N N 277 MET CB HB3 sing N N 278 MET CG SD sing N N 279 MET CG HG2 sing N N 280 MET CG HG3 sing N N 281 MET SD CE sing N N 282 MET CE HE1 sing N N 283 MET CE HE2 sing N N 284 MET CE HE3 sing N N 285 MET OXT HXT sing N N 286 PHE N CA sing N N 287 PHE N H sing N N 288 PHE N H2 sing N N 289 PHE CA C sing N N 290 PHE CA CB sing N N 291 PHE CA HA sing N N 292 PHE C O doub N N 293 PHE C OXT sing N N 294 PHE CB CG sing N N 295 PHE CB HB2 sing N N 296 PHE CB HB3 sing N N 297 PHE CG CD1 doub Y N 298 PHE CG CD2 sing Y N 299 PHE CD1 CE1 sing Y N 300 PHE CD1 HD1 sing N N 301 PHE CD2 CE2 doub Y N 302 PHE CD2 HD2 sing N N 303 PHE CE1 CZ doub Y N 304 PHE CE1 HE1 sing N N 305 PHE CE2 CZ sing Y N 306 PHE CE2 HE2 sing N N 307 PHE CZ HZ sing N N 308 PHE OXT HXT sing N N 309 PRO N CA sing N N 310 PRO N CD sing N N 311 PRO N H sing N N 312 PRO CA C sing N N 313 PRO CA CB sing N N 314 PRO CA HA sing N N 315 PRO C O doub N N 316 PRO C OXT sing N N 317 PRO CB CG sing N N 318 PRO CB HB2 sing N N 319 PRO CB HB3 sing N N 320 PRO CG CD sing N N 321 PRO CG HG2 sing N N 322 PRO CG HG3 sing N N 323 PRO CD HD2 sing N N 324 PRO CD HD3 sing N N 325 PRO OXT HXT sing N N 326 SER N CA sing N N 327 SER N H sing N N 328 SER N H2 sing N N 329 SER CA C sing N N 330 SER CA CB sing N N 331 SER CA HA sing N N 332 SER C O doub N N 333 SER C OXT sing N N 334 SER CB OG sing N N 335 SER CB HB2 sing N N 336 SER CB HB3 sing N N 337 SER OG HG sing N N 338 SER OXT HXT sing N N 339 THR N CA sing N N 340 THR N H sing N N 341 THR N H2 sing N N 342 THR CA C sing N N 343 THR CA CB sing N N 344 THR CA HA sing N N 345 THR C O doub N N 346 THR C OXT sing N N 347 THR CB OG1 sing N N 348 THR CB CG2 sing N N 349 THR CB HB sing N N 350 THR OG1 HG1 sing N N 351 THR CG2 HG21 sing N N 352 THR CG2 HG22 sing N N 353 THR CG2 HG23 sing N N 354 THR OXT HXT sing N N 355 TRP N CA sing N N 356 TRP N H sing N N 357 TRP N H2 sing N N 358 TRP CA C sing N N 359 TRP CA CB sing N N 360 TRP CA HA sing N N 361 TRP C O doub N N 362 TRP C OXT sing N N 363 TRP CB CG sing N N 364 TRP CB HB2 sing N N 365 TRP CB HB3 sing N N 366 TRP CG CD1 doub Y N 367 TRP CG CD2 sing Y N 368 TRP CD1 NE1 sing Y N 369 TRP CD1 HD1 sing N N 370 TRP CD2 CE2 doub Y N 371 TRP CD2 CE3 sing Y N 372 TRP NE1 CE2 sing Y N 373 TRP NE1 HE1 sing N N 374 TRP CE2 CZ2 sing Y N 375 TRP CE3 CZ3 doub Y N 376 TRP CE3 HE3 sing N N 377 TRP CZ2 CH2 doub Y N 378 TRP CZ2 HZ2 sing N N 379 TRP CZ3 CH2 sing Y N 380 TRP CZ3 HZ3 sing N N 381 TRP CH2 HH2 sing N N 382 TRP OXT HXT sing N N 383 TYR N CA sing N N 384 TYR N H sing N N 385 TYR N H2 sing N N 386 TYR CA C sing N N 387 TYR CA CB sing N N 388 TYR CA HA sing N N 389 TYR C O doub N N 390 TYR C OXT sing N N 391 TYR CB CG sing N N 392 TYR CB HB2 sing N N 393 TYR CB HB3 sing N N 394 TYR CG CD1 doub Y N 395 TYR CG CD2 sing Y N 396 TYR CD1 CE1 sing Y N 397 TYR CD1 HD1 sing N N 398 TYR CD2 CE2 doub Y N 399 TYR CD2 HD2 sing N N 400 TYR CE1 CZ doub Y N 401 TYR CE1 HE1 sing N N 402 TYR CE2 CZ sing Y N 403 TYR CE2 HE2 sing N N 404 TYR CZ OH sing N N 405 TYR OH HH sing N N 406 TYR OXT HXT sing N N 407 VAL N CA sing N N 408 VAL N H sing N N 409 VAL N H2 sing N N 410 VAL CA C sing N N 411 VAL CA CB sing N N 412 VAL CA HA sing N N 413 VAL C O doub N N 414 VAL C OXT sing N N 415 VAL CB CG1 sing N N 416 VAL CB CG2 sing N N 417 VAL CB HB sing N N 418 VAL CG1 HG11 sing N N 419 VAL CG1 HG12 sing N N 420 VAL CG1 HG13 sing N N 421 VAL CG2 HG21 sing N N 422 VAL CG2 HG22 sing N N 423 VAL CG2 HG23 sing N N 424 VAL OXT HXT sing N N 425 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5X8U _pdbx_initial_refinement_model.details ? # _space_group.crystal_system hexagonal _space_group.IT_number 178 _space_group.name_H-M_alt 'P 61 2 2' _space_group.name_Hall 'P 61 2 (x,y,z+5/12)' _space_group.id 1 # _atom_sites.entry_id 29OB _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.009887 _atom_sites.fract_transf_matrix[1][2] 0.005708 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011417 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007160 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 5.96793 ? ? ? 14.89577 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.99627 ? ? ? 14.84254 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 6.96715 ? ? ? 11.43723 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 15.91112 ? ? ? 10.84690 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #