data_2A36 # _entry.id 2A36 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2A36 pdb_00002a36 10.2210/pdb2a36/pdb RCSB RCSB033432 ? ? WWPDB D_1000033432 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2A37 _pdbx_database_related.details 'Solution structure of the T22G mutant of N-Terminal SH3 domain of Drk' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2A36 _pdbx_database_status.recvd_initial_deposition_date 2005-06-23 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Forman-Kay, J.D.' 1 'Bezsonova, I.' 2 'Singer, A.' 3 'Choy, W.-Y.' 4 'Tollinger, M.' 5 # _citation.id primary _citation.title 'Structural Comparison of the Unstable drkN SH3 Domain and a Stable Mutant' _citation.journal_abbrev Biochemistry _citation.journal_volume 44 _citation.page_first 15550 _citation.page_last 15560 _citation.year 2005 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16300404 _citation.pdbx_database_id_DOI 10.1021/bi0512795 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bezsonova, I.' 1 ? primary 'Singer, A.' 2 ? primary 'Choy, W.-Y.' 3 ? primary 'Tollinger, M.' 4 ? primary 'Forman-Kay, J.D.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Protein E(sev)2B' _entity.formula_weight 6868.628 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-TERMINAL SH3 DOMAIN, RESIDUES 1-59' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Protein enhancer of sevenless 2B, SH2-SH3 adapter protein drk, Downstream of receptor kinase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MEAIAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNHD _entity_poly.pdbx_seq_one_letter_code_can MEAIAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNHD _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ALA n 1 4 ILE n 1 5 ALA n 1 6 LYS n 1 7 HIS n 1 8 ASP n 1 9 PHE n 1 10 SER n 1 11 ALA n 1 12 THR n 1 13 ALA n 1 14 ASP n 1 15 ASP n 1 16 GLU n 1 17 LEU n 1 18 SER n 1 19 PHE n 1 20 ARG n 1 21 LYS n 1 22 THR n 1 23 GLN n 1 24 ILE n 1 25 LEU n 1 26 LYS n 1 27 ILE n 1 28 LEU n 1 29 ASN n 1 30 MET n 1 31 GLU n 1 32 ASP n 1 33 ASP n 1 34 SER n 1 35 ASN n 1 36 TRP n 1 37 TYR n 1 38 ARG n 1 39 ALA n 1 40 GLU n 1 41 LEU n 1 42 ASP n 1 43 GLY n 1 44 LYS n 1 45 GLU n 1 46 GLY n 1 47 LEU n 1 48 ILE n 1 49 PRO n 1 50 SER n 1 51 ASN n 1 52 TYR n 1 53 ILE n 1 54 GLU n 1 55 MET n 1 56 LYS n 1 57 ASN n 1 58 HIS n 1 59 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'fruit fly' _entity_src_gen.gene_src_genus Drosophila _entity_src_gen.pdbx_gene_src_gene 'drk, E(sev)2B' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Drosophila melanogaster' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7227 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain HMS174 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET-11A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DRK_DROME _struct_ref.pdbx_db_accession Q08012 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MEAIAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNHD _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2A36 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 59 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q08012 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 59 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 59 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D 200 ms NOESY' 1 2 1 '3D 150 ms 15N-edited NOESY' 1 3 1 '2D 150 ms NOESY' 1 4 1 '1H/D amide exchange experiment' 1 5 1 'HNCO-based 3D experiments' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 500mM _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1MM DRKN SH3 DOMAIN 15N,13C, 500 MM NA2SO4, 50 MM PHOSPHATE BUFFER, 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2A36 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2A36 _pdbx_nmr_details.text ;HNCO-based 3D experiments were used for measuring 15N-1HN, 15N-13C', 13C'-13CA RDCs and C'-CSA restraints.13CA-13CB and 13CA-1HA RDCs were also measured. ; # _pdbx_nmr_ensemble.entry_id 2A36 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2A36 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'structure solution' CNS 1.0 BRUNGER 1 refinement CNS 1.0 BRUNGER 2 # _exptl.entry_id 2A36 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.density_Matthews ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2A36 _struct.title 'Solution structure of the N-terminal SH3 domain of DRK' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2A36 _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'DROSOPHILA MELANOGASTER, SH3 FRAGMENT, DRK, SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 44 ? PRO A 49 ? LYS A 44 PRO A 49 A 2 TRP A 36 ? LEU A 41 ? TRP A 36 LEU A 41 A 3 GLN A 23 ? ASN A 29 ? GLN A 23 ASN A 29 A 4 ALA A 3 ? ALA A 5 ? ALA A 3 ALA A 5 A 5 GLU A 54 ? MET A 55 ? GLU A 54 MET A 55 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLY A 46 ? O GLY A 46 N ALA A 39 ? N ALA A 39 A 2 3 O ARG A 38 ? O ARG A 38 N ASN A 29 ? N ASN A 29 A 3 4 O LEU A 25 ? O LEU A 25 N ALA A 3 ? N ALA A 3 A 4 5 N ILE A 4 ? N ILE A 4 O GLU A 54 ? O GLU A 54 # _database_PDB_matrix.entry_id 2A36 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2A36 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 TRP 36 36 36 TRP TRP A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 MET 55 55 55 MET MET A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 HIS 58 58 58 HIS HIS A . n A 1 59 ASP 59 59 59 ASP ASP A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-12-13 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_remark.id 400 _pdbx_database_remark.text ;COMPOUND RESIDUE ANI PRESENT IN THE CONSTRAINT FILE DEFINES THE ALIGNMENT FRAME. INCLUDE THESE COORDINATES TO USE THE RESIDUAL DIPOLAR COUPLING AND/OR CARBONYL CHEMICAL SHIFT RESTRAINTS ; # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 5 O A ASP 15 ? ? H A LEU 47 ? ? 1.57 2 5 O A LEU 41 ? ? H A LYS 44 ? ? 1.59 3 6 H A ALA 11 ? ? HG A SER 18 ? ? 1.17 4 7 HB1 A ALA 5 ? ? HD23 A LEU 25 ? ? 1.18 5 7 HB1 A ALA 39 ? ? HD11 A ILE 48 ? ? 1.28 6 8 HD21 A ASN 29 ? ? HD2 A ARG 38 ? ? 1.27 7 8 O A ASP 15 ? ? H A LEU 47 ? ? 1.56 8 10 HD2 A LYS 56 ? ? H A ASN 57 ? ? 1.21 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 7 ? ? -170.89 125.42 2 1 ALA A 11 ? ? -17.20 145.13 3 1 LEU A 28 ? ? -145.80 -23.49 4 1 GLU A 31 ? ? 162.30 -52.27 5 1 SER A 34 ? ? -60.52 23.83 6 1 ASN A 35 ? ? -143.83 -29.44 7 1 ASP A 42 ? ? 62.73 -81.32 8 1 LYS A 56 ? ? 141.73 50.15 9 1 HIS A 58 ? ? 67.57 -124.16 10 2 ALA A 11 ? ? -16.96 146.09 11 2 LEU A 28 ? ? -148.57 -19.29 12 2 GLU A 31 ? ? 162.27 -50.28 13 2 SER A 34 ? ? -60.93 24.77 14 2 ASN A 35 ? ? -143.41 -29.85 15 2 ASP A 42 ? ? 62.80 -81.57 16 2 PRO A 49 ? ? -27.13 137.21 17 2 LYS A 56 ? ? -93.87 -154.82 18 2 HIS A 58 ? ? 68.04 -124.93 19 3 HIS A 7 ? ? -171.29 121.32 20 3 ALA A 11 ? ? -17.21 145.43 21 3 THR A 22 ? ? 80.55 6.47 22 3 LEU A 28 ? ? -141.88 -25.54 23 3 GLU A 31 ? ? 162.29 -48.58 24 3 SER A 34 ? ? -61.98 25.80 25 3 ASN A 35 ? ? -146.34 -28.32 26 3 ASP A 42 ? ? 62.12 -81.45 27 3 PRO A 49 ? ? -28.89 140.23 28 3 LYS A 56 ? ? 145.38 45.86 29 3 HIS A 58 ? ? -118.04 -133.17 30 4 HIS A 7 ? ? -171.20 124.97 31 4 ALA A 11 ? ? -17.03 146.18 32 4 ASP A 15 ? ? -86.99 31.46 33 4 THR A 22 ? ? 84.83 -6.66 34 4 LEU A 28 ? ? -147.94 -20.08 35 4 GLU A 31 ? ? 161.51 -49.82 36 4 SER A 34 ? ? -61.41 25.85 37 4 ASN A 35 ? ? -146.60 -29.16 38 4 ASP A 42 ? ? 50.01 7.88 39 4 ASN A 57 ? ? -103.28 56.86 40 5 HIS A 7 ? ? -171.07 124.34 41 5 ALA A 11 ? ? -16.99 148.10 42 5 LEU A 28 ? ? -146.52 -20.66 43 5 GLU A 31 ? ? 165.93 -33.07 44 5 SER A 34 ? ? -62.36 26.43 45 5 ASN A 35 ? ? -149.75 -24.54 46 5 ASP A 42 ? ? 48.60 13.39 47 5 ASN A 57 ? ? -106.25 51.48 48 5 HIS A 58 ? ? -158.84 7.83 49 6 ALA A 11 ? ? -16.43 146.48 50 6 LEU A 28 ? ? -147.75 -20.50 51 6 GLU A 31 ? ? 161.26 -49.50 52 6 SER A 34 ? ? -60.20 25.87 53 6 ASN A 35 ? ? -144.33 -28.93 54 6 ASP A 42 ? ? 49.10 13.80 55 6 PRO A 49 ? ? -29.45 140.35 56 6 ASN A 57 ? ? 75.10 -91.98 57 6 HIS A 58 ? ? 80.00 -71.28 58 7 HIS A 7 ? ? -171.00 126.14 59 7 ALA A 11 ? ? -15.95 142.76 60 7 THR A 22 ? ? 80.49 -3.70 61 7 LEU A 28 ? ? -142.40 -28.01 62 7 GLU A 31 ? ? -164.44 -55.56 63 7 SER A 34 ? ? -68.05 34.02 64 7 ASN A 35 ? ? -146.62 -28.90 65 7 ASP A 42 ? ? 71.05 -74.20 66 7 ASN A 57 ? ? -109.40 56.20 67 8 HIS A 7 ? ? -171.53 125.74 68 8 ALA A 11 ? ? -16.64 145.08 69 8 THR A 22 ? ? 82.70 1.87 70 8 LEU A 28 ? ? -148.03 -18.72 71 8 GLU A 31 ? ? -171.92 -50.08 72 8 SER A 34 ? ? -67.64 32.71 73 8 ASN A 35 ? ? -148.54 -26.90 74 8 ASP A 42 ? ? 43.94 20.58 75 8 ASN A 57 ? ? -107.90 51.41 76 8 HIS A 58 ? ? -161.55 9.73 77 9 ALA A 11 ? ? -17.23 143.00 78 9 ASP A 15 ? ? -88.73 35.76 79 9 THR A 22 ? ? 81.66 2.44 80 9 LEU A 28 ? ? -148.24 -18.60 81 9 GLU A 31 ? ? -173.91 -43.72 82 9 ASP A 32 ? ? -59.72 1.19 83 9 ASP A 33 ? ? 108.04 154.19 84 9 SER A 34 ? ? -63.17 30.96 85 9 ASN A 35 ? ? -145.80 -26.53 86 9 ASP A 42 ? ? 66.39 -81.48 87 9 LYS A 56 ? ? -89.19 -157.42 88 10 ALA A 11 ? ? -16.48 143.87 89 10 LEU A 28 ? ? -148.20 -19.75 90 10 GLU A 31 ? ? 162.31 -45.58 91 10 SER A 34 ? ? -61.59 23.63 92 10 ASN A 35 ? ? -144.56 -28.96 93 10 ASP A 42 ? ? 61.78 -81.77 94 10 LYS A 56 ? ? -90.62 -154.67 95 10 HIS A 58 ? ? -155.68 12.91 #