data_2A5E # _entry.id 2A5E # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2A5E pdb_00002a5e 10.2210/pdb2a5e/pdb WWPDB D_1000177716 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2A5E _pdbx_database_status.recvd_initial_deposition_date 1998-02-13 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Byeon, I.-J.L.' 1 'Li, J.' 2 'Ericson, K.' 3 'Selby, T.L.' 4 'Tevelev, A.' 5 'Kim, H.-J.' 6 ;O'Maille, P. ; 7 'Tsai, M.-D.' 8 # _citation.id primary _citation.title 'Tumor suppressor p16INK4A: determination of solution structure and analyses of its interaction with cyclin-dependent kinase 4.' _citation.journal_abbrev Mol.Cell _citation.journal_volume 1 _citation.page_first 421 _citation.page_last 431 _citation.year 1998 _citation.journal_id_ASTM MOCEFL _citation.country US _citation.journal_id_ISSN 1097-2765 _citation.journal_id_CSD 2168 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9660926 _citation.pdbx_database_id_DOI '10.1016/S1097-2765(00)80042-8' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Byeon, I.J.' 1 ? primary 'Li, J.' 2 ? primary 'Ericson, K.' 3 ? primary 'Selby, T.L.' 4 ? primary 'Tevelev, A.' 5 ? primary 'Kim, H.J.' 6 ? primary ;O'Maille, P. ; 7 ? primary 'Tsai, M.D.' 8 ? # _cell.entry_id 2A5E _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2A5E _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'TUMOR SUPPRESSOR P16INK4A' _entity.formula_weight 16554.641 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTR PVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD ; _entity_poly.pdbx_seq_one_letter_code_can ;MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTR PVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 PRO n 1 4 ALA n 1 5 ALA n 1 6 GLY n 1 7 SER n 1 8 SER n 1 9 MET n 1 10 GLU n 1 11 PRO n 1 12 SER n 1 13 ALA n 1 14 ASP n 1 15 TRP n 1 16 LEU n 1 17 ALA n 1 18 THR n 1 19 ALA n 1 20 ALA n 1 21 ALA n 1 22 ARG n 1 23 GLY n 1 24 ARG n 1 25 VAL n 1 26 GLU n 1 27 GLU n 1 28 VAL n 1 29 ARG n 1 30 ALA n 1 31 LEU n 1 32 LEU n 1 33 GLU n 1 34 ALA n 1 35 GLY n 1 36 ALA n 1 37 LEU n 1 38 PRO n 1 39 ASN n 1 40 ALA n 1 41 PRO n 1 42 ASN n 1 43 SER n 1 44 TYR n 1 45 GLY n 1 46 ARG n 1 47 ARG n 1 48 PRO n 1 49 ILE n 1 50 GLN n 1 51 VAL n 1 52 MET n 1 53 MET n 1 54 MET n 1 55 GLY n 1 56 SER n 1 57 ALA n 1 58 ARG n 1 59 VAL n 1 60 ALA n 1 61 GLU n 1 62 LEU n 1 63 LEU n 1 64 LEU n 1 65 LEU n 1 66 HIS n 1 67 GLY n 1 68 ALA n 1 69 GLU n 1 70 PRO n 1 71 ASN n 1 72 CYS n 1 73 ALA n 1 74 ASP n 1 75 PRO n 1 76 ALA n 1 77 THR n 1 78 LEU n 1 79 THR n 1 80 ARG n 1 81 PRO n 1 82 VAL n 1 83 HIS n 1 84 ASP n 1 85 ALA n 1 86 ALA n 1 87 ARG n 1 88 GLU n 1 89 GLY n 1 90 PHE n 1 91 LEU n 1 92 ASP n 1 93 THR n 1 94 LEU n 1 95 VAL n 1 96 VAL n 1 97 LEU n 1 98 HIS n 1 99 ARG n 1 100 ALA n 1 101 GLY n 1 102 ALA n 1 103 ARG n 1 104 LEU n 1 105 ASP n 1 106 VAL n 1 107 ARG n 1 108 ASP n 1 109 ALA n 1 110 TRP n 1 111 GLY n 1 112 ARG n 1 113 LEU n 1 114 PRO n 1 115 VAL n 1 116 ASP n 1 117 LEU n 1 118 ALA n 1 119 GLU n 1 120 GLU n 1 121 LEU n 1 122 GLY n 1 123 HIS n 1 124 ARG n 1 125 ASP n 1 126 VAL n 1 127 ALA n 1 128 ARG n 1 129 TYR n 1 130 LEU n 1 131 ARG n 1 132 ALA n 1 133 ALA n 1 134 ALA n 1 135 GLY n 1 136 GLY n 1 137 THR n 1 138 ARG n 1 139 GLY n 1 140 SER n 1 141 ASN n 1 142 HIS n 1 143 ALA n 1 144 ARG n 1 145 ILE n 1 146 ASP n 1 147 ALA n 1 148 ALA n 1 149 GLU n 1 150 GLY n 1 151 PRO n 1 152 SER n 1 153 ASP n 1 154 ILE n 1 155 PRO n 1 156 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CDN2A_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P42771 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTR PVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2A5E _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 156 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P42771 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 156 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 156 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 'NMR EXPERIMENTS FOR THE ASSIGNMENTS AND STRUCTURE CALCULATIONS : HNCACB' 1 2 1 HNCA 1 3 1 'CBCA(CO)HN' 1 4 1 'HN(CO)CA' 1 5 1 HCCH-TOCSY 1 6 1 HNHA 1 7 1 '3D 15N-EDITED NOESY AND TOCSY' 1 8 1 '2D NOESY AND TOCSY' 1 9 1 '3D 13C-EDITED NOESY' 1 10 1 '3D 15N/13C SIMULTANEOUSLY EDITED NOESY' 1 11 1 '4D 15N/13C-EDITED NOESY' 1 12 1 '4D 13C/13C-EDITED NOESY.' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure NO _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 'CA. 0' _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents 'H2O AND D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength 1 DMX600 Bruker 600 2 DRX800 Bruker 800 # _pdbx_nmr_refine.entry_id 2A5E _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2A5E _pdbx_nmr_details.text ;THE SOLUTION STRUCTURE OF THE TUMOR SUPPRESSOR P16INK4A HAS BEEN DETERMINED BY MULTI-DIMENSIONAL HERERONUCLEAR NMR. THE STRUCTURES WERE CALCULATED USING THE SIMULATED ANNEALING PROTOCOL OF NILGES ET AL. (1988) FEBS LETT. 229, 129-136 USING THE PROGRAM X-PLOR 3.1 (BRUNGER). THE CALCULATION IS BASED ON 1437 EXPERIMENTAL NMR RESTRAINTS (1370 DISTANCE AND 67 TORSION ANGLE RESTRAINTS). ; # _pdbx_nmr_ensemble.entry_id 2A5E _pdbx_nmr_ensemble.conformers_calculated_total_number 90 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ;CLOSEST TO MEAN STRUCTURE WHICH SHOWS GOOD AGREEMENT WITH THE CONSTRAINTS. NONE OF THE CONSTRAINTS SHOW NOE VIOLATION BIGGER THAN 0.5 A AND DIHEDRAL ANGLE VIOLATION BIGGER THAN 5 DEGREE. ; # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'structure solution' X-PLOR ? ? 1 refinement X-PLOR ? ? 2 # _exptl.entry_id 2A5E _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2A5E _struct.title 'SOLUTION NMR STRUCTURE OF TUMOR SUPPRESSOR P16INK4A, RESTRAINED MINIMIZED MEAN STRUCTURE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2A5E _struct_keywords.pdbx_keywords ANTI-ONCOGENE _struct_keywords.text 'ANTI-ONCOGENE, TUMOR-SUPPRESSOR-P16INK4A' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 IA ASP A 14 ? ARG A 22 ? ASP A 14 ARG A 22 1 ? 9 HELX_P HELX_P2 IB VAL A 25 ? GLY A 35 ? VAL A 25 GLY A 35 1 ? 11 HELX_P HELX_P3 IIA ARG A 47 ? VAL A 51 ? ARG A 47 VAL A 51 1 ? 5 HELX_P HELX_P4 IIB ALA A 57 ? HIS A 66 ? ALA A 57 HIS A 66 1 ? 10 HELX_P HELX_P5 3A PRO A 81 ? GLU A 88 ? PRO A 81 GLU A 88 1 ? 8 HELX_P HELX_P6 3B LEU A 91 ? ALA A 100 ? LEU A 91 ALA A 100 1 ? 10 HELX_P HELX_P7 IVA PRO A 114 ? LEU A 121 ? PRO A 114 LEU A 121 1 ? 8 HELX_P HELX_P8 IVB ARG A 124 ? ALA A 134 ? ARG A 124 ALA A 134 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2A5E _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2A5E _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 MET 9 9 9 MET MET A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 TRP 15 15 15 TRP TRP A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 MET 52 52 52 MET MET A . n A 1 53 MET 53 53 53 MET MET A . n A 1 54 MET 54 54 54 MET MET A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 HIS 66 66 66 HIS HIS A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 CYS 72 72 72 CYS CYS A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 HIS 83 83 83 HIS HIS A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 HIS 98 98 98 HIS HIS A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 ASP 105 105 105 ASP ASP A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 TRP 110 110 110 TRP TRP A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 PRO 114 114 114 PRO PRO A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 HIS 123 123 123 HIS HIS A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 ARG 128 128 128 ARG ARG A . n A 1 129 TYR 129 129 129 TYR TYR A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 ARG 131 131 131 ARG ARG A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 THR 137 137 137 THR THR A . n A 1 138 ARG 138 138 138 ARG ARG A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 SER 140 140 140 SER SER A . n A 1 141 ASN 141 141 141 ASN ASN A . n A 1 142 HIS 142 142 142 HIS HIS A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 ARG 144 144 144 ARG ARG A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 ASP 146 146 146 ASP ASP A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 PRO 151 151 151 PRO PRO A . n A 1 152 SER 152 152 152 SER SER A . n A 1 153 ASP 153 153 153 ASP ASP A . n A 1 154 ILE 154 154 154 ILE ILE A . n A 1 155 PRO 155 155 155 PRO PRO A . n A 1 156 ASP 156 156 156 ASP ASP A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-08-13 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 X-PLOR phasing 3.1 ? 3 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A PRO 11 ? ? H A ALA 13 ? ? 1.19 2 1 O A ASP 108 ? ? H A TRP 110 ? ? 1.48 3 1 O A ASP 14 ? ? H A THR 18 ? ? 1.57 4 1 O A PRO 11 ? ? N A ALA 13 ? ? 1.99 5 1 OD2 A ASP 146 ? ? O A PRO 151 ? ? 2.11 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 2 ? ? -47.33 104.51 2 1 ALA A 4 ? ? 71.41 44.05 3 1 ALA A 5 ? ? 169.89 -54.90 4 1 SER A 7 ? ? -72.37 -129.65 5 1 SER A 8 ? ? 61.61 -90.72 6 1 MET A 9 ? ? 45.37 29.57 7 1 SER A 12 ? ? -34.64 11.48 8 1 ASN A 39 ? ? -117.86 70.78 9 1 MET A 53 ? ? 69.07 -17.71 10 1 ALA A 68 ? ? -63.62 -161.21 11 1 ASN A 71 ? ? -104.81 -63.15 12 1 CYS A 72 ? ? -49.49 152.17 13 1 LEU A 78 ? ? 49.32 28.64 14 1 ALA A 102 ? ? -163.86 115.46 15 1 ASP A 105 ? ? -111.97 50.71 16 1 VAL A 106 ? ? -108.39 -169.12 17 1 ALA A 109 ? ? 62.07 -60.84 18 1 HIS A 123 ? ? -96.06 56.66 19 1 ARG A 138 ? ? -135.80 -103.17 20 1 SER A 140 ? ? 41.93 -140.37 21 1 HIS A 142 ? ? 58.46 153.32 22 1 ALA A 143 ? ? 124.87 -121.18 23 1 ILE A 145 ? ? 123.52 -13.07 24 1 ASP A 146 ? ? 78.92 -35.82 25 1 ALA A 148 ? ? -8.85 76.73 26 1 GLU A 149 ? ? 1.97 76.36 27 1 SER A 152 ? ? 171.71 -158.80 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 22 ? ? 0.136 'SIDE CHAIN' 2 1 ARG A 24 ? ? 0.317 'SIDE CHAIN' 3 1 ARG A 29 ? ? 0.222 'SIDE CHAIN' 4 1 ARG A 46 ? ? 0.273 'SIDE CHAIN' 5 1 ARG A 47 ? ? 0.165 'SIDE CHAIN' 6 1 ARG A 58 ? ? 0.242 'SIDE CHAIN' 7 1 ARG A 80 ? ? 0.315 'SIDE CHAIN' 8 1 ARG A 87 ? ? 0.180 'SIDE CHAIN' 9 1 ARG A 99 ? ? 0.292 'SIDE CHAIN' 10 1 ARG A 103 ? ? 0.305 'SIDE CHAIN' 11 1 ARG A 107 ? ? 0.196 'SIDE CHAIN' 12 1 ARG A 112 ? ? 0.298 'SIDE CHAIN' 13 1 ARG A 124 ? ? 0.310 'SIDE CHAIN' 14 1 ARG A 131 ? ? 0.244 'SIDE CHAIN' 15 1 ARG A 138 ? ? 0.313 'SIDE CHAIN' 16 1 ARG A 144 ? ? 0.242 'SIDE CHAIN' #