data_2ABY # _entry.id 2ABY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2ABY pdb_00002aby 10.2210/pdb2aby/pdb RCSB RCSB033724 ? ? WWPDB D_1000033724 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2ABY _pdbx_database_status.recvd_initial_deposition_date 2005-07-18 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kim, B.' 1 'Jung, J.' 2 'Hong, E.' 3 'Yee, A.' 4 'Arrowsmith, C.H.' 5 'Lee, W.' 6 # _citation.id primary _citation.title 'NMR structure of the conserved novel-fold protein TA0743 from Thermoplasma acidophilum.' _citation.journal_abbrev Proteins _citation.journal_volume 62 _citation.page_first 819 _citation.page_last 821 _citation.year 2006 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16374782 _citation.pdbx_database_id_DOI 10.1002/prot.20832 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kim, B.' 1 ? primary 'Jung, J.' 2 ? primary 'Hong, E.' 3 ? primary 'Yee, A.' 4 ? primary 'Arrowsmith, C.H.' 5 ? primary 'Lee, W.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'hypothetical protein TA0743' _entity.formula_weight 17398.623 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGTSHHHHHHSSGRENLYFQSHMQKGLEIAFQTINGLDESLVQALAGVTASDFPDLDIKYNIFLVDLYGQKYFRILFQSK KLSELHPEERKKVREKFDENSRMQYSELMTKYHDLKKQGKIKDRPVKEVHEEYDLWEDPIWQYIGS ; _entity_poly.pdbx_seq_one_letter_code_can ;MGTSHHHHHHSSGRENLYFQSHMQKGLEIAFQTINGLDESLVQALAGVTASDFPDLDIKYNIFLVDLYGQKYFRILFQSK KLSELHPEERKKVREKFDENSRMQYSELMTKYHDLKKQGKIKDRPVKEVHEEYDLWEDPIWQYIGS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 THR n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 ARG n 1 15 GLU n 1 16 ASN n 1 17 LEU n 1 18 TYR n 1 19 PHE n 1 20 GLN n 1 21 SER n 1 22 HIS n 1 23 MET n 1 24 GLN n 1 25 LYS n 1 26 GLY n 1 27 LEU n 1 28 GLU n 1 29 ILE n 1 30 ALA n 1 31 PHE n 1 32 GLN n 1 33 THR n 1 34 ILE n 1 35 ASN n 1 36 GLY n 1 37 LEU n 1 38 ASP n 1 39 GLU n 1 40 SER n 1 41 LEU n 1 42 VAL n 1 43 GLN n 1 44 ALA n 1 45 LEU n 1 46 ALA n 1 47 GLY n 1 48 VAL n 1 49 THR n 1 50 ALA n 1 51 SER n 1 52 ASP n 1 53 PHE n 1 54 PRO n 1 55 ASP n 1 56 LEU n 1 57 ASP n 1 58 ILE n 1 59 LYS n 1 60 TYR n 1 61 ASN n 1 62 ILE n 1 63 PHE n 1 64 LEU n 1 65 VAL n 1 66 ASP n 1 67 LEU n 1 68 TYR n 1 69 GLY n 1 70 GLN n 1 71 LYS n 1 72 TYR n 1 73 PHE n 1 74 ARG n 1 75 ILE n 1 76 LEU n 1 77 PHE n 1 78 GLN n 1 79 SER n 1 80 LYS n 1 81 LYS n 1 82 LEU n 1 83 SER n 1 84 GLU n 1 85 LEU n 1 86 HIS n 1 87 PRO n 1 88 GLU n 1 89 GLU n 1 90 ARG n 1 91 LYS n 1 92 LYS n 1 93 VAL n 1 94 ARG n 1 95 GLU n 1 96 LYS n 1 97 PHE n 1 98 ASP n 1 99 GLU n 1 100 ASN n 1 101 SER n 1 102 ARG n 1 103 MET n 1 104 GLN n 1 105 TYR n 1 106 SER n 1 107 GLU n 1 108 LEU n 1 109 MET n 1 110 THR n 1 111 LYS n 1 112 TYR n 1 113 HIS n 1 114 ASP n 1 115 LEU n 1 116 LYS n 1 117 LYS n 1 118 GLN n 1 119 GLY n 1 120 LYS n 1 121 ILE n 1 122 LYS n 1 123 ASP n 1 124 ARG n 1 125 PRO n 1 126 VAL n 1 127 LYS n 1 128 GLU n 1 129 VAL n 1 130 HIS n 1 131 GLU n 1 132 GLU n 1 133 TYR n 1 134 ASP n 1 135 LEU n 1 136 TRP n 1 137 GLU n 1 138 ASP n 1 139 PRO n 1 140 ILE n 1 141 TRP n 1 142 GLN n 1 143 TYR n 1 144 ILE n 1 145 GLY n 1 146 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Thermoplasma _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermoplasma acidophilum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2303 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9HK62_THEAC _struct_ref.pdbx_db_accession Q9HK62 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MQKGLEIAFQTINGLDESLVQALAGVTASDFPDLDIKYNIFLVDLYGQKYFRILFQSKKLSELHPEERKKVREKFDENSR MQYSELMTKYHDLKKQGKIKDRPVKEVHEEYDLWEDPIWQYI ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2ABY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 23 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 144 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9HK62 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 122 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 122 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2ABY MET A 1 ? UNP Q9HK62 ? ? 'cloning artifact' -21 1 1 2ABY GLY A 2 ? UNP Q9HK62 ? ? 'cloning artifact' -20 2 1 2ABY THR A 3 ? UNP Q9HK62 ? ? 'cloning artifact' -19 3 1 2ABY SER A 4 ? UNP Q9HK62 ? ? 'cloning artifact' -18 4 1 2ABY HIS A 5 ? UNP Q9HK62 ? ? 'cloning artifact' -17 5 1 2ABY HIS A 6 ? UNP Q9HK62 ? ? 'cloning artifact' -16 6 1 2ABY HIS A 7 ? UNP Q9HK62 ? ? 'cloning artifact' -15 7 1 2ABY HIS A 8 ? UNP Q9HK62 ? ? 'cloning artifact' -14 8 1 2ABY HIS A 9 ? UNP Q9HK62 ? ? 'cloning artifact' -13 9 1 2ABY HIS A 10 ? UNP Q9HK62 ? ? 'cloning artifact' -12 10 1 2ABY SER A 11 ? UNP Q9HK62 ? ? 'cloning artifact' -11 11 1 2ABY SER A 12 ? UNP Q9HK62 ? ? 'cloning artifact' -10 12 1 2ABY GLY A 13 ? UNP Q9HK62 ? ? 'cloning artifact' -9 13 1 2ABY ARG A 14 ? UNP Q9HK62 ? ? 'cloning artifact' -8 14 1 2ABY GLU A 15 ? UNP Q9HK62 ? ? 'cloning artifact' -7 15 1 2ABY ASN A 16 ? UNP Q9HK62 ? ? 'cloning artifact' -6 16 1 2ABY LEU A 17 ? UNP Q9HK62 ? ? 'cloning artifact' -5 17 1 2ABY TYR A 18 ? UNP Q9HK62 ? ? 'cloning artifact' -4 18 1 2ABY PHE A 19 ? UNP Q9HK62 ? ? 'cloning artifact' -3 19 1 2ABY GLN A 20 ? UNP Q9HK62 ? ? 'cloning artifact' -2 20 1 2ABY SER A 21 ? UNP Q9HK62 ? ? 'cloning artifact' -1 21 1 2ABY HIS A 22 ? UNP Q9HK62 ? ? 'cloning artifact' 0 22 1 2ABY GLY A 145 ? UNP Q9HK62 ? ? 'cloning artifact' 123 23 1 2ABY SER A 146 ? UNP Q9HK62 ? ? 'cloning artifact' 124 24 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 3 1 HNHA 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 'no salt' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1.6mM TA0743 U-15N,13C,15N/13C 50mM Potassium phosphate buffer ,NaN3,90% H20,10% D20 ; _pdbx_nmr_sample_details.solvent_system '90% H20,10% D20' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 DRX Bruker 500 ? 2 DMX Bruker 500 ? 3 UNITYPLUS Varian 600 ? # _pdbx_nmr_refine.entry_id 2ABY _pdbx_nmr_refine.method ;distance geometry simulated annealing ; _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2ABY _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2ABY _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal processing NMRPipe 2.3 Delaglio 1 'data analysis' Sparky 3.110 'Goddard and Kneller' 2 'data analysis' MARS 1.1 'Jung and Zweckstetter' 3 'structure solution' CYANA 2.0 Herrmann 4 refinement CYANA 2.0 Herrmann 5 # _exptl.entry_id 2ABY _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2ABY _struct.title 'Solution structure of TA0743 from Thermoplasma acidophilum' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2ABY _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' _struct_keywords.text 'helix-turn-helix, UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 37 ? PHE A 53 ? LEU A 15 PHE A 31 1 ? 17 HELX_P HELX_P2 2 HIS A 86 ? MET A 103 ? HIS A 64 MET A 81 1 ? 18 HELX_P HELX_P3 3 GLN A 104 ? ASP A 114 ? GLN A 82 ASP A 92 1 ? 11 HELX_P HELX_P4 4 LEU A 115 ? GLN A 118 ? LEU A 93 GLN A 96 5 ? 4 HELX_P HELX_P5 5 ASP A 138 ? TYR A 143 ? ASP A 116 TYR A 121 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 29 ? THR A 33 ? ILE A 7 THR A 11 A 2 GLN A 70 ? GLN A 78 ? GLN A 48 GLN A 56 A 3 LYS A 59 ? LEU A 67 ? LYS A 37 LEU A 45 A 4 LYS A 127 ? VAL A 129 ? LYS A 105 VAL A 107 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N PHE A 31 ? N PHE A 9 O ILE A 75 ? O ILE A 53 A 2 3 O TYR A 72 ? O TYR A 50 N VAL A 65 ? N VAL A 43 A 3 4 N LEU A 64 ? N LEU A 42 O LYS A 127 ? O LYS A 105 # _database_PDB_matrix.entry_id 2ABY _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2ABY _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -21 ? ? ? A . n A 1 2 GLY 2 -20 ? ? ? A . n A 1 3 THR 3 -19 ? ? ? A . n A 1 4 SER 4 -18 ? ? ? A . n A 1 5 HIS 5 -17 ? ? ? A . n A 1 6 HIS 6 -16 ? ? ? A . n A 1 7 HIS 7 -15 ? ? ? A . n A 1 8 HIS 8 -14 ? ? ? A . n A 1 9 HIS 9 -13 ? ? ? A . n A 1 10 HIS 10 -12 ? ? ? A . n A 1 11 SER 11 -11 ? ? ? A . n A 1 12 SER 12 -10 ? ? ? A . n A 1 13 GLY 13 -9 ? ? ? A . n A 1 14 ARG 14 -8 ? ? ? A . n A 1 15 GLU 15 -7 ? ? ? A . n A 1 16 ASN 16 -6 ? ? ? A . n A 1 17 LEU 17 -5 ? ? ? A . n A 1 18 TYR 18 -4 ? ? ? A . n A 1 19 PHE 19 -3 ? ? ? A . n A 1 20 GLN 20 -2 ? ? ? A . n A 1 21 SER 21 -1 ? ? ? A . n A 1 22 HIS 22 0 ? ? ? A . n A 1 23 MET 23 1 1 MET MET A . n A 1 24 GLN 24 2 2 GLN GLN A . n A 1 25 LYS 25 3 3 LYS LYS A . n A 1 26 GLY 26 4 4 GLY GLY A . n A 1 27 LEU 27 5 5 LEU LEU A . n A 1 28 GLU 28 6 6 GLU GLU A . n A 1 29 ILE 29 7 7 ILE ILE A . n A 1 30 ALA 30 8 8 ALA ALA A . n A 1 31 PHE 31 9 9 PHE PHE A . n A 1 32 GLN 32 10 10 GLN GLN A . n A 1 33 THR 33 11 11 THR THR A . n A 1 34 ILE 34 12 12 ILE ILE A . n A 1 35 ASN 35 13 13 ASN ASN A . n A 1 36 GLY 36 14 14 GLY GLY A . n A 1 37 LEU 37 15 15 LEU LEU A . n A 1 38 ASP 38 16 16 ASP ASP A . n A 1 39 GLU 39 17 17 GLU GLU A . n A 1 40 SER 40 18 18 SER SER A . n A 1 41 LEU 41 19 19 LEU LEU A . n A 1 42 VAL 42 20 20 VAL VAL A . n A 1 43 GLN 43 21 21 GLN GLN A . n A 1 44 ALA 44 22 22 ALA ALA A . n A 1 45 LEU 45 23 23 LEU LEU A . n A 1 46 ALA 46 24 24 ALA ALA A . n A 1 47 GLY 47 25 25 GLY GLY A . n A 1 48 VAL 48 26 26 VAL VAL A . n A 1 49 THR 49 27 27 THR THR A . n A 1 50 ALA 50 28 28 ALA ALA A . n A 1 51 SER 51 29 29 SER SER A . n A 1 52 ASP 52 30 30 ASP ASP A . n A 1 53 PHE 53 31 31 PHE PHE A . n A 1 54 PRO 54 32 32 PRO PRO A . n A 1 55 ASP 55 33 33 ASP ASP A . n A 1 56 LEU 56 34 34 LEU LEU A . n A 1 57 ASP 57 35 35 ASP ASP A . n A 1 58 ILE 58 36 36 ILE ILE A . n A 1 59 LYS 59 37 37 LYS LYS A . n A 1 60 TYR 60 38 38 TYR TYR A . n A 1 61 ASN 61 39 39 ASN ASN A . n A 1 62 ILE 62 40 40 ILE ILE A . n A 1 63 PHE 63 41 41 PHE PHE A . n A 1 64 LEU 64 42 42 LEU LEU A . n A 1 65 VAL 65 43 43 VAL VAL A . n A 1 66 ASP 66 44 44 ASP ASP A . n A 1 67 LEU 67 45 45 LEU LEU A . n A 1 68 TYR 68 46 46 TYR TYR A . n A 1 69 GLY 69 47 47 GLY GLY A . n A 1 70 GLN 70 48 48 GLN GLN A . n A 1 71 LYS 71 49 49 LYS LYS A . n A 1 72 TYR 72 50 50 TYR TYR A . n A 1 73 PHE 73 51 51 PHE PHE A . n A 1 74 ARG 74 52 52 ARG ARG A . n A 1 75 ILE 75 53 53 ILE ILE A . n A 1 76 LEU 76 54 54 LEU LEU A . n A 1 77 PHE 77 55 55 PHE PHE A . n A 1 78 GLN 78 56 56 GLN GLN A . n A 1 79 SER 79 57 57 SER SER A . n A 1 80 LYS 80 58 58 LYS LYS A . n A 1 81 LYS 81 59 59 LYS LYS A . n A 1 82 LEU 82 60 60 LEU LEU A . n A 1 83 SER 83 61 61 SER SER A . n A 1 84 GLU 84 62 62 GLU GLU A . n A 1 85 LEU 85 63 63 LEU LEU A . n A 1 86 HIS 86 64 64 HIS HIS A . n A 1 87 PRO 87 65 65 PRO PRO A . n A 1 88 GLU 88 66 66 GLU GLU A . n A 1 89 GLU 89 67 67 GLU GLU A . n A 1 90 ARG 90 68 68 ARG ARG A . n A 1 91 LYS 91 69 69 LYS LYS A . n A 1 92 LYS 92 70 70 LYS LYS A . n A 1 93 VAL 93 71 71 VAL VAL A . n A 1 94 ARG 94 72 72 ARG ARG A . n A 1 95 GLU 95 73 73 GLU GLU A . n A 1 96 LYS 96 74 74 LYS LYS A . n A 1 97 PHE 97 75 75 PHE PHE A . n A 1 98 ASP 98 76 76 ASP ASP A . n A 1 99 GLU 99 77 77 GLU GLU A . n A 1 100 ASN 100 78 78 ASN ASN A . n A 1 101 SER 101 79 79 SER SER A . n A 1 102 ARG 102 80 80 ARG ARG A . n A 1 103 MET 103 81 81 MET MET A . n A 1 104 GLN 104 82 82 GLN GLN A . n A 1 105 TYR 105 83 83 TYR TYR A . n A 1 106 SER 106 84 84 SER SER A . n A 1 107 GLU 107 85 85 GLU GLU A . n A 1 108 LEU 108 86 86 LEU LEU A . n A 1 109 MET 109 87 87 MET MET A . n A 1 110 THR 110 88 88 THR THR A . n A 1 111 LYS 111 89 89 LYS LYS A . n A 1 112 TYR 112 90 90 TYR TYR A . n A 1 113 HIS 113 91 91 HIS HIS A . n A 1 114 ASP 114 92 92 ASP ASP A . n A 1 115 LEU 115 93 93 LEU LEU A . n A 1 116 LYS 116 94 94 LYS LYS A . n A 1 117 LYS 117 95 95 LYS LYS A . n A 1 118 GLN 118 96 96 GLN GLN A . n A 1 119 GLY 119 97 97 GLY GLY A . n A 1 120 LYS 120 98 98 LYS LYS A . n A 1 121 ILE 121 99 99 ILE ILE A . n A 1 122 LYS 122 100 100 LYS LYS A . n A 1 123 ASP 123 101 101 ASP ASP A . n A 1 124 ARG 124 102 102 ARG ARG A . n A 1 125 PRO 125 103 103 PRO PRO A . n A 1 126 VAL 126 104 104 VAL VAL A . n A 1 127 LYS 127 105 105 LYS LYS A . n A 1 128 GLU 128 106 106 GLU GLU A . n A 1 129 VAL 129 107 107 VAL VAL A . n A 1 130 HIS 130 108 108 HIS HIS A . n A 1 131 GLU 131 109 109 GLU GLU A . n A 1 132 GLU 132 110 110 GLU GLU A . n A 1 133 TYR 133 111 111 TYR TYR A . n A 1 134 ASP 134 112 112 ASP ASP A . n A 1 135 LEU 135 113 113 LEU LEU A . n A 1 136 TRP 136 114 114 TRP TRP A . n A 1 137 GLU 137 115 115 GLU GLU A . n A 1 138 ASP 138 116 116 ASP ASP A . n A 1 139 PRO 139 117 117 PRO PRO A . n A 1 140 ILE 140 118 118 ILE ILE A . n A 1 141 TRP 141 119 119 TRP TRP A . n A 1 142 GLN 142 120 120 GLN GLN A . n A 1 143 TYR 143 121 121 TYR TYR A . n A 1 144 ILE 144 122 122 ILE ILE A . n A 1 145 GLY 145 123 ? ? ? A . n A 1 146 SER 146 124 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-08-08 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 3 ? ? -175.40 -176.49 2 1 ASN A 13 ? ? 178.96 -168.42 3 1 PHE A 31 ? ? -112.59 74.09 4 1 LYS A 37 ? ? -105.93 71.34 5 1 HIS A 64 ? ? 63.66 71.28 6 1 GLU A 110 ? ? 170.76 -168.65 7 1 ASP A 112 ? ? -131.80 -69.19 8 1 LEU A 113 ? ? -60.11 -168.76 9 1 GLU A 115 ? ? 37.43 71.10 10 1 ASP A 116 ? ? -179.31 -60.57 11 1 GLN A 120 ? ? -100.54 -74.58 12 2 ILE A 12 ? ? -140.05 -48.65 13 2 PHE A 31 ? ? -112.05 73.26 14 2 LEU A 34 ? ? 59.56 19.35 15 2 ASN A 39 ? ? 179.86 168.53 16 2 LEU A 60 ? ? -45.18 107.08 17 2 HIS A 64 ? ? 64.24 66.74 18 2 MET A 81 ? ? -44.97 157.90 19 2 GLU A 110 ? ? 174.44 -168.07 20 2 LEU A 113 ? ? -59.46 -171.04 21 2 ASP A 116 ? ? -179.02 -62.05 22 2 GLN A 120 ? ? -85.89 -74.82 23 3 ILE A 12 ? ? -140.75 -68.01 24 3 PHE A 31 ? ? -112.21 74.50 25 3 LYS A 37 ? ? -113.53 77.18 26 3 HIS A 64 ? ? 60.96 67.81 27 3 MET A 81 ? ? -41.38 150.48 28 3 GLU A 110 ? ? 171.90 -168.52 29 3 TYR A 111 ? ? -117.11 77.55 30 3 ASP A 112 ? ? -117.79 -74.28 31 3 LEU A 113 ? ? -57.59 -175.28 32 3 ASP A 116 ? ? 179.37 -60.37 33 3 GLN A 120 ? ? -88.12 -74.67 34 4 ILE A 12 ? ? -130.81 -39.39 35 4 PHE A 31 ? ? -113.61 71.64 36 4 LYS A 37 ? ? -111.30 76.94 37 4 HIS A 64 ? ? 51.33 71.27 38 4 MET A 81 ? ? -43.65 155.09 39 4 LYS A 98 ? ? -171.21 -170.89 40 4 ASP A 101 ? ? -117.52 74.33 41 4 TYR A 111 ? ? -175.11 67.46 42 4 LEU A 113 ? ? -74.95 -94.63 43 4 ASP A 116 ? ? -179.80 -62.78 44 4 GLN A 120 ? ? -106.20 -74.47 45 4 TYR A 121 ? ? -170.96 -179.66 46 5 ASN A 13 ? ? -52.98 102.04 47 5 PHE A 31 ? ? -111.79 75.74 48 5 LYS A 37 ? ? -110.27 69.02 49 5 ASN A 39 ? ? 178.91 176.96 50 5 LEU A 60 ? ? -45.56 105.50 51 5 HIS A 64 ? ? 63.51 74.27 52 5 MET A 81 ? ? -43.02 154.00 53 5 LYS A 98 ? ? 61.27 70.84 54 5 GLU A 110 ? ? 174.28 -168.02 55 5 ASP A 112 ? ? -137.19 -61.24 56 5 LEU A 113 ? ? -60.76 -168.01 57 5 GLU A 115 ? ? 34.67 72.54 58 5 ASP A 116 ? ? 178.07 -61.74 59 5 GLN A 120 ? ? -130.30 -67.80 60 6 ASN A 13 ? ? 60.20 106.08 61 6 PHE A 31 ? ? -113.42 71.82 62 6 LYS A 37 ? ? -110.76 74.66 63 6 HIS A 64 ? ? 64.74 75.46 64 6 MET A 81 ? ? -42.73 154.17 65 6 LYS A 98 ? ? -58.00 177.36 66 6 GLU A 110 ? ? 176.42 -167.04 67 6 ASP A 112 ? ? -135.09 -53.93 68 6 LEU A 113 ? ? -60.61 -168.74 69 6 GLU A 115 ? ? 38.14 72.11 70 6 ASP A 116 ? ? 179.96 -61.34 71 6 GLN A 120 ? ? -104.76 -64.63 72 7 ILE A 12 ? ? -137.45 -48.07 73 7 PHE A 31 ? ? -112.35 74.62 74 7 LYS A 37 ? ? -111.26 78.07 75 7 LEU A 60 ? ? -48.91 103.59 76 7 HIS A 64 ? ? 63.51 73.04 77 7 MET A 81 ? ? -41.03 150.66 78 7 GLU A 110 ? ? 175.41 -167.54 79 7 ASP A 112 ? ? -147.06 -66.89 80 7 LEU A 113 ? ? -57.12 -176.49 81 7 GLU A 115 ? ? 37.67 70.45 82 7 ASP A 116 ? ? -179.67 -61.41 83 7 GLN A 120 ? ? -108.73 -70.73 84 8 LYS A 3 ? ? -126.00 -68.43 85 8 ILE A 12 ? ? -133.48 -59.09 86 8 PHE A 31 ? ? -113.23 73.15 87 8 LEU A 60 ? ? 34.57 45.34 88 8 HIS A 64 ? ? 63.79 67.61 89 8 ASP A 101 ? ? -112.82 79.79 90 8 GLU A 110 ? ? 172.89 -167.74 91 8 TYR A 111 ? ? -115.41 76.59 92 8 ASP A 112 ? ? -116.53 -77.23 93 8 LEU A 113 ? ? -58.87 -175.50 94 8 ASP A 116 ? ? -178.59 -62.18 95 8 GLN A 120 ? ? -86.46 -74.45 96 9 ILE A 12 ? ? -132.51 -59.54 97 9 PHE A 31 ? ? -112.27 75.05 98 9 LYS A 37 ? ? -112.92 72.43 99 9 LEU A 60 ? ? -44.94 108.93 100 9 HIS A 64 ? ? 63.40 73.87 101 9 MET A 81 ? ? -41.70 152.03 102 9 GLN A 82 ? ? -59.60 171.83 103 9 GLU A 110 ? ? 170.96 -168.42 104 9 LEU A 113 ? ? -59.06 -172.51 105 9 GLU A 115 ? ? 49.00 73.28 106 9 ASP A 116 ? ? -179.13 -61.09 107 9 GLN A 120 ? ? -112.07 -75.19 108 10 ASN A 13 ? ? -57.50 101.16 109 10 LEU A 15 ? ? -156.73 24.48 110 10 LEU A 60 ? ? 32.25 49.05 111 10 LEU A 63 ? ? -51.63 170.59 112 10 HIS A 64 ? ? 64.52 80.70 113 10 LYS A 98 ? ? -107.57 -169.51 114 10 GLU A 110 ? ? 174.77 -167.51 115 10 ASP A 112 ? ? -151.62 -73.41 116 10 LEU A 113 ? ? -57.50 -174.39 117 10 GLU A 115 ? ? 30.11 73.10 118 10 ASP A 116 ? ? -179.79 -60.92 119 10 GLN A 120 ? ? -120.47 -69.99 120 11 LEU A 15 ? ? -147.77 16.83 121 11 LYS A 37 ? ? -113.71 77.21 122 11 HIS A 64 ? ? 63.68 73.16 123 11 MET A 81 ? ? -39.80 148.20 124 11 TYR A 111 ? ? -157.60 46.95 125 11 LEU A 113 ? ? -88.19 -88.43 126 11 GLU A 115 ? ? 65.85 61.71 127 11 ASP A 116 ? ? 175.33 -62.60 128 11 GLN A 120 ? ? -120.84 -73.16 129 12 ILE A 12 ? ? -157.33 -37.03 130 12 ASN A 13 ? ? -176.03 145.45 131 12 LYS A 37 ? ? -111.66 73.62 132 12 HIS A 64 ? ? 64.80 72.16 133 12 MET A 81 ? ? -40.85 150.22 134 12 GLU A 110 ? ? 172.61 -169.21 135 12 LEU A 113 ? ? -58.52 -174.16 136 12 ASP A 116 ? ? -177.65 -62.03 137 12 GLN A 120 ? ? -93.74 -74.41 138 13 LYS A 3 ? ? -89.40 -74.74 139 13 ILE A 12 ? ? -140.22 -67.88 140 13 PHE A 31 ? ? 33.85 61.04 141 13 ASP A 35 ? ? -157.15 60.43 142 13 LEU A 60 ? ? 30.67 52.18 143 13 LEU A 63 ? ? -55.56 178.96 144 13 HIS A 64 ? ? 62.57 75.83 145 13 GLU A 110 ? ? 173.04 -168.51 146 13 ASP A 112 ? ? -126.35 -54.57 147 13 LEU A 113 ? ? -58.19 -174.60 148 13 ASP A 116 ? ? -179.22 -61.90 149 13 TYR A 121 ? ? -177.87 -177.62 150 14 PHE A 31 ? ? -113.09 72.56 151 14 LEU A 60 ? ? -27.51 107.78 152 14 HIS A 64 ? ? 63.72 65.65 153 14 GLU A 110 ? ? 170.21 -169.17 154 14 ASP A 112 ? ? -122.01 -75.41 155 14 LEU A 113 ? ? -57.43 -176.14 156 14 GLU A 115 ? ? 38.79 79.06 157 14 ASP A 116 ? ? 179.16 -59.86 158 14 GLN A 120 ? ? -123.29 -75.00 159 15 ASN A 13 ? ? -49.69 104.13 160 15 PHE A 31 ? ? -112.99 73.11 161 15 HIS A 64 ? ? 63.45 73.63 162 15 MET A 81 ? ? -43.03 154.40 163 15 HIS A 91 ? ? -92.29 -60.80 164 15 TYR A 111 ? ? -157.20 29.46 165 15 LEU A 113 ? ? -74.66 -86.37 166 15 GLU A 115 ? ? 38.92 66.75 167 15 ASP A 116 ? ? 178.39 -61.77 168 15 GLN A 120 ? ? -90.19 -72.44 169 15 TYR A 121 ? ? -129.54 -76.98 170 16 ILE A 12 ? ? -132.58 -53.78 171 16 PHE A 31 ? ? 21.49 65.22 172 16 ASP A 35 ? ? -161.54 51.57 173 16 HIS A 64 ? ? 59.64 72.12 174 16 MET A 81 ? ? -40.75 150.66 175 16 GLU A 110 ? ? 176.01 -167.10 176 16 ASP A 112 ? ? -145.68 -60.53 177 16 LEU A 113 ? ? -56.74 -177.37 178 16 GLU A 115 ? ? 49.63 70.94 179 16 ASP A 116 ? ? -179.63 -61.37 180 16 GLN A 120 ? ? -126.44 -66.34 181 17 PHE A 31 ? ? 19.78 67.36 182 17 ASP A 35 ? ? -162.67 32.02 183 17 LEU A 60 ? ? 31.73 50.97 184 17 LEU A 63 ? ? -55.51 178.80 185 17 HIS A 64 ? ? 64.45 76.31 186 17 GLU A 110 ? ? 172.61 -169.22 187 17 ASP A 112 ? ? -124.97 -52.85 188 17 LEU A 113 ? ? -58.34 -174.06 189 17 GLU A 115 ? ? 37.68 69.04 190 17 ASP A 116 ? ? 179.03 -60.05 191 17 GLN A 120 ? ? -99.39 -68.36 192 18 LYS A 3 ? ? -91.82 -70.58 193 18 LEU A 15 ? ? -142.07 -40.41 194 18 ASP A 16 ? ? 48.97 29.02 195 18 PHE A 31 ? ? -112.79 74.13 196 18 LEU A 60 ? ? 31.70 51.21 197 18 LEU A 63 ? ? -53.48 174.48 198 18 HIS A 64 ? ? 59.86 81.69 199 18 LYS A 98 ? ? -80.46 -74.16 200 18 GLU A 110 ? ? 69.18 -170.50 201 18 TYR A 111 ? ? -65.59 89.18 202 18 ASP A 112 ? ? -102.51 -67.86 203 18 ASP A 116 ? ? -179.48 -60.94 204 18 TYR A 121 ? ? 63.47 147.65 205 19 ILE A 12 ? ? -133.82 -56.11 206 19 ASN A 13 ? ? -171.57 -171.97 207 19 LYS A 37 ? ? -108.02 63.86 208 19 LEU A 63 ? ? -103.39 -167.96 209 19 HIS A 64 ? ? 65.44 77.08 210 19 GLU A 110 ? ? 169.51 -168.87 211 19 ASP A 112 ? ? -124.20 -68.17 212 19 LEU A 113 ? ? -59.71 -169.00 213 19 GLU A 115 ? ? 42.39 72.52 214 19 ASP A 116 ? ? -179.89 -60.69 215 19 GLN A 120 ? ? -138.96 -61.94 216 20 LYS A 3 ? ? -93.90 -64.12 217 20 PHE A 31 ? ? -113.95 71.49 218 20 LEU A 60 ? ? -45.26 104.51 219 20 HIS A 64 ? ? 63.22 76.06 220 20 MET A 81 ? ? -43.01 154.98 221 20 GLN A 96 ? ? -86.63 34.49 222 20 GLU A 110 ? ? 171.50 -168.82 223 20 TYR A 111 ? ? -112.21 77.52 224 20 LEU A 113 ? ? -59.25 -171.25 225 20 ASP A 116 ? ? -178.71 -61.77 226 20 GLN A 120 ? ? -112.99 -75.16 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -21 ? A MET 1 2 1 Y 1 A GLY -20 ? A GLY 2 3 1 Y 1 A THR -19 ? A THR 3 4 1 Y 1 A SER -18 ? A SER 4 5 1 Y 1 A HIS -17 ? A HIS 5 6 1 Y 1 A HIS -16 ? A HIS 6 7 1 Y 1 A HIS -15 ? A HIS 7 8 1 Y 1 A HIS -14 ? A HIS 8 9 1 Y 1 A HIS -13 ? A HIS 9 10 1 Y 1 A HIS -12 ? A HIS 10 11 1 Y 1 A SER -11 ? A SER 11 12 1 Y 1 A SER -10 ? A SER 12 13 1 Y 1 A GLY -9 ? A GLY 13 14 1 Y 1 A ARG -8 ? A ARG 14 15 1 Y 1 A GLU -7 ? A GLU 15 16 1 Y 1 A ASN -6 ? A ASN 16 17 1 Y 1 A LEU -5 ? A LEU 17 18 1 Y 1 A TYR -4 ? A TYR 18 19 1 Y 1 A PHE -3 ? A PHE 19 20 1 Y 1 A GLN -2 ? A GLN 20 21 1 Y 1 A SER -1 ? A SER 21 22 1 Y 1 A HIS 0 ? A HIS 22 23 1 Y 1 A GLY 123 ? A GLY 145 24 1 Y 1 A SER 124 ? A SER 146 25 2 Y 1 A MET -21 ? A MET 1 26 2 Y 1 A GLY -20 ? A GLY 2 27 2 Y 1 A THR -19 ? A THR 3 28 2 Y 1 A SER -18 ? A SER 4 29 2 Y 1 A HIS -17 ? A HIS 5 30 2 Y 1 A HIS -16 ? A HIS 6 31 2 Y 1 A HIS -15 ? A HIS 7 32 2 Y 1 A HIS -14 ? A HIS 8 33 2 Y 1 A HIS -13 ? A HIS 9 34 2 Y 1 A HIS -12 ? A HIS 10 35 2 Y 1 A SER -11 ? A SER 11 36 2 Y 1 A SER -10 ? A SER 12 37 2 Y 1 A GLY -9 ? A GLY 13 38 2 Y 1 A ARG -8 ? A ARG 14 39 2 Y 1 A GLU -7 ? A GLU 15 40 2 Y 1 A ASN -6 ? A ASN 16 41 2 Y 1 A LEU -5 ? A LEU 17 42 2 Y 1 A TYR -4 ? A TYR 18 43 2 Y 1 A PHE -3 ? A PHE 19 44 2 Y 1 A GLN -2 ? A GLN 20 45 2 Y 1 A SER -1 ? A SER 21 46 2 Y 1 A HIS 0 ? A HIS 22 47 2 Y 1 A GLY 123 ? A GLY 145 48 2 Y 1 A SER 124 ? A SER 146 49 3 Y 1 A MET -21 ? A MET 1 50 3 Y 1 A GLY -20 ? A GLY 2 51 3 Y 1 A THR -19 ? A THR 3 52 3 Y 1 A SER -18 ? A SER 4 53 3 Y 1 A HIS -17 ? A HIS 5 54 3 Y 1 A HIS -16 ? A HIS 6 55 3 Y 1 A HIS -15 ? A HIS 7 56 3 Y 1 A HIS -14 ? A HIS 8 57 3 Y 1 A HIS -13 ? A HIS 9 58 3 Y 1 A HIS -12 ? A HIS 10 59 3 Y 1 A SER -11 ? A SER 11 60 3 Y 1 A SER -10 ? A SER 12 61 3 Y 1 A GLY -9 ? A GLY 13 62 3 Y 1 A ARG -8 ? A ARG 14 63 3 Y 1 A GLU -7 ? A GLU 15 64 3 Y 1 A ASN -6 ? A ASN 16 65 3 Y 1 A LEU -5 ? A LEU 17 66 3 Y 1 A TYR -4 ? A TYR 18 67 3 Y 1 A PHE -3 ? A PHE 19 68 3 Y 1 A GLN -2 ? A GLN 20 69 3 Y 1 A SER -1 ? A SER 21 70 3 Y 1 A HIS 0 ? A HIS 22 71 3 Y 1 A GLY 123 ? A GLY 145 72 3 Y 1 A SER 124 ? A SER 146 73 4 Y 1 A MET -21 ? A MET 1 74 4 Y 1 A GLY -20 ? A GLY 2 75 4 Y 1 A THR -19 ? A THR 3 76 4 Y 1 A SER -18 ? A SER 4 77 4 Y 1 A HIS -17 ? A HIS 5 78 4 Y 1 A HIS -16 ? A HIS 6 79 4 Y 1 A HIS -15 ? A HIS 7 80 4 Y 1 A HIS -14 ? A HIS 8 81 4 Y 1 A HIS -13 ? A HIS 9 82 4 Y 1 A HIS -12 ? A HIS 10 83 4 Y 1 A SER -11 ? A SER 11 84 4 Y 1 A SER -10 ? A SER 12 85 4 Y 1 A GLY -9 ? A GLY 13 86 4 Y 1 A ARG -8 ? A ARG 14 87 4 Y 1 A GLU -7 ? A GLU 15 88 4 Y 1 A ASN -6 ? A ASN 16 89 4 Y 1 A LEU -5 ? A LEU 17 90 4 Y 1 A TYR -4 ? A TYR 18 91 4 Y 1 A PHE -3 ? A PHE 19 92 4 Y 1 A GLN -2 ? A GLN 20 93 4 Y 1 A SER -1 ? A SER 21 94 4 Y 1 A HIS 0 ? A HIS 22 95 4 Y 1 A GLY 123 ? A GLY 145 96 4 Y 1 A SER 124 ? A SER 146 97 5 Y 1 A MET -21 ? A MET 1 98 5 Y 1 A GLY -20 ? A GLY 2 99 5 Y 1 A THR -19 ? A THR 3 100 5 Y 1 A SER -18 ? A SER 4 101 5 Y 1 A HIS -17 ? A HIS 5 102 5 Y 1 A HIS -16 ? A HIS 6 103 5 Y 1 A HIS -15 ? A HIS 7 104 5 Y 1 A HIS -14 ? A HIS 8 105 5 Y 1 A HIS -13 ? A HIS 9 106 5 Y 1 A HIS -12 ? A HIS 10 107 5 Y 1 A SER -11 ? A SER 11 108 5 Y 1 A SER -10 ? A SER 12 109 5 Y 1 A GLY -9 ? A GLY 13 110 5 Y 1 A ARG -8 ? A ARG 14 111 5 Y 1 A GLU -7 ? A GLU 15 112 5 Y 1 A ASN -6 ? A ASN 16 113 5 Y 1 A LEU -5 ? A LEU 17 114 5 Y 1 A TYR -4 ? A TYR 18 115 5 Y 1 A PHE -3 ? A PHE 19 116 5 Y 1 A GLN -2 ? A GLN 20 117 5 Y 1 A SER -1 ? A SER 21 118 5 Y 1 A HIS 0 ? A HIS 22 119 5 Y 1 A GLY 123 ? A GLY 145 120 5 Y 1 A SER 124 ? A SER 146 121 6 Y 1 A MET -21 ? A MET 1 122 6 Y 1 A GLY -20 ? A GLY 2 123 6 Y 1 A THR -19 ? A THR 3 124 6 Y 1 A SER -18 ? A SER 4 125 6 Y 1 A HIS -17 ? A HIS 5 126 6 Y 1 A HIS -16 ? A HIS 6 127 6 Y 1 A HIS -15 ? A HIS 7 128 6 Y 1 A HIS -14 ? A HIS 8 129 6 Y 1 A HIS -13 ? A HIS 9 130 6 Y 1 A HIS -12 ? A HIS 10 131 6 Y 1 A SER -11 ? A SER 11 132 6 Y 1 A SER -10 ? A SER 12 133 6 Y 1 A GLY -9 ? A GLY 13 134 6 Y 1 A ARG -8 ? A ARG 14 135 6 Y 1 A GLU -7 ? A GLU 15 136 6 Y 1 A ASN -6 ? A ASN 16 137 6 Y 1 A LEU -5 ? A LEU 17 138 6 Y 1 A TYR -4 ? A TYR 18 139 6 Y 1 A PHE -3 ? A PHE 19 140 6 Y 1 A GLN -2 ? A GLN 20 141 6 Y 1 A SER -1 ? A SER 21 142 6 Y 1 A HIS 0 ? A HIS 22 143 6 Y 1 A GLY 123 ? A GLY 145 144 6 Y 1 A SER 124 ? A SER 146 145 7 Y 1 A MET -21 ? A MET 1 146 7 Y 1 A GLY -20 ? A GLY 2 147 7 Y 1 A THR -19 ? A THR 3 148 7 Y 1 A SER -18 ? A SER 4 149 7 Y 1 A HIS -17 ? A HIS 5 150 7 Y 1 A HIS -16 ? A HIS 6 151 7 Y 1 A HIS -15 ? A HIS 7 152 7 Y 1 A HIS -14 ? A HIS 8 153 7 Y 1 A HIS -13 ? A HIS 9 154 7 Y 1 A HIS -12 ? A HIS 10 155 7 Y 1 A SER -11 ? A SER 11 156 7 Y 1 A SER -10 ? A SER 12 157 7 Y 1 A GLY -9 ? A GLY 13 158 7 Y 1 A ARG -8 ? A ARG 14 159 7 Y 1 A GLU -7 ? A GLU 15 160 7 Y 1 A ASN -6 ? A ASN 16 161 7 Y 1 A LEU -5 ? A LEU 17 162 7 Y 1 A TYR -4 ? A TYR 18 163 7 Y 1 A PHE -3 ? A PHE 19 164 7 Y 1 A GLN -2 ? A GLN 20 165 7 Y 1 A SER -1 ? A SER 21 166 7 Y 1 A HIS 0 ? A HIS 22 167 7 Y 1 A GLY 123 ? A GLY 145 168 7 Y 1 A SER 124 ? A SER 146 169 8 Y 1 A MET -21 ? A MET 1 170 8 Y 1 A GLY -20 ? A GLY 2 171 8 Y 1 A THR -19 ? A THR 3 172 8 Y 1 A SER -18 ? A SER 4 173 8 Y 1 A HIS -17 ? A HIS 5 174 8 Y 1 A HIS -16 ? A HIS 6 175 8 Y 1 A HIS -15 ? A HIS 7 176 8 Y 1 A HIS -14 ? A HIS 8 177 8 Y 1 A HIS -13 ? A HIS 9 178 8 Y 1 A HIS -12 ? A HIS 10 179 8 Y 1 A SER -11 ? A SER 11 180 8 Y 1 A SER -10 ? A SER 12 181 8 Y 1 A GLY -9 ? A GLY 13 182 8 Y 1 A ARG -8 ? A ARG 14 183 8 Y 1 A GLU -7 ? A GLU 15 184 8 Y 1 A ASN -6 ? A ASN 16 185 8 Y 1 A LEU -5 ? A LEU 17 186 8 Y 1 A TYR -4 ? A TYR 18 187 8 Y 1 A PHE -3 ? A PHE 19 188 8 Y 1 A GLN -2 ? A GLN 20 189 8 Y 1 A SER -1 ? A SER 21 190 8 Y 1 A HIS 0 ? A HIS 22 191 8 Y 1 A GLY 123 ? A GLY 145 192 8 Y 1 A SER 124 ? A SER 146 193 9 Y 1 A MET -21 ? A MET 1 194 9 Y 1 A GLY -20 ? A GLY 2 195 9 Y 1 A THR -19 ? A THR 3 196 9 Y 1 A SER -18 ? A SER 4 197 9 Y 1 A HIS -17 ? A HIS 5 198 9 Y 1 A HIS -16 ? A HIS 6 199 9 Y 1 A HIS -15 ? A HIS 7 200 9 Y 1 A HIS -14 ? A HIS 8 201 9 Y 1 A HIS -13 ? A HIS 9 202 9 Y 1 A HIS -12 ? A HIS 10 203 9 Y 1 A SER -11 ? A SER 11 204 9 Y 1 A SER -10 ? A SER 12 205 9 Y 1 A GLY -9 ? A GLY 13 206 9 Y 1 A ARG -8 ? A ARG 14 207 9 Y 1 A GLU -7 ? A GLU 15 208 9 Y 1 A ASN -6 ? A ASN 16 209 9 Y 1 A LEU -5 ? A LEU 17 210 9 Y 1 A TYR -4 ? A TYR 18 211 9 Y 1 A PHE -3 ? A PHE 19 212 9 Y 1 A GLN -2 ? A GLN 20 213 9 Y 1 A SER -1 ? A SER 21 214 9 Y 1 A HIS 0 ? A HIS 22 215 9 Y 1 A GLY 123 ? A GLY 145 216 9 Y 1 A SER 124 ? A SER 146 217 10 Y 1 A MET -21 ? A MET 1 218 10 Y 1 A GLY -20 ? A GLY 2 219 10 Y 1 A THR -19 ? A THR 3 220 10 Y 1 A SER -18 ? A SER 4 221 10 Y 1 A HIS -17 ? A HIS 5 222 10 Y 1 A HIS -16 ? A HIS 6 223 10 Y 1 A HIS -15 ? A HIS 7 224 10 Y 1 A HIS -14 ? A HIS 8 225 10 Y 1 A HIS -13 ? A HIS 9 226 10 Y 1 A HIS -12 ? A HIS 10 227 10 Y 1 A SER -11 ? A SER 11 228 10 Y 1 A SER -10 ? A SER 12 229 10 Y 1 A GLY -9 ? A GLY 13 230 10 Y 1 A ARG -8 ? A ARG 14 231 10 Y 1 A GLU -7 ? A GLU 15 232 10 Y 1 A ASN -6 ? A ASN 16 233 10 Y 1 A LEU -5 ? A LEU 17 234 10 Y 1 A TYR -4 ? A TYR 18 235 10 Y 1 A PHE -3 ? A PHE 19 236 10 Y 1 A GLN -2 ? A GLN 20 237 10 Y 1 A SER -1 ? A SER 21 238 10 Y 1 A HIS 0 ? A HIS 22 239 10 Y 1 A GLY 123 ? A GLY 145 240 10 Y 1 A SER 124 ? A SER 146 241 11 Y 1 A MET -21 ? A MET 1 242 11 Y 1 A GLY -20 ? A GLY 2 243 11 Y 1 A THR -19 ? A THR 3 244 11 Y 1 A SER -18 ? A SER 4 245 11 Y 1 A HIS -17 ? A HIS 5 246 11 Y 1 A HIS -16 ? A HIS 6 247 11 Y 1 A HIS -15 ? A HIS 7 248 11 Y 1 A HIS -14 ? A HIS 8 249 11 Y 1 A HIS -13 ? A HIS 9 250 11 Y 1 A HIS -12 ? A HIS 10 251 11 Y 1 A SER -11 ? A SER 11 252 11 Y 1 A SER -10 ? A SER 12 253 11 Y 1 A GLY -9 ? A GLY 13 254 11 Y 1 A ARG -8 ? A ARG 14 255 11 Y 1 A GLU -7 ? A GLU 15 256 11 Y 1 A ASN -6 ? A ASN 16 257 11 Y 1 A LEU -5 ? A LEU 17 258 11 Y 1 A TYR -4 ? A TYR 18 259 11 Y 1 A PHE -3 ? A PHE 19 260 11 Y 1 A GLN -2 ? A GLN 20 261 11 Y 1 A SER -1 ? A SER 21 262 11 Y 1 A HIS 0 ? A HIS 22 263 11 Y 1 A GLY 123 ? A GLY 145 264 11 Y 1 A SER 124 ? A SER 146 265 12 Y 1 A MET -21 ? A MET 1 266 12 Y 1 A GLY -20 ? A GLY 2 267 12 Y 1 A THR -19 ? A THR 3 268 12 Y 1 A SER -18 ? A SER 4 269 12 Y 1 A HIS -17 ? A HIS 5 270 12 Y 1 A HIS -16 ? A HIS 6 271 12 Y 1 A HIS -15 ? A HIS 7 272 12 Y 1 A HIS -14 ? A HIS 8 273 12 Y 1 A HIS -13 ? A HIS 9 274 12 Y 1 A HIS -12 ? A HIS 10 275 12 Y 1 A SER -11 ? A SER 11 276 12 Y 1 A SER -10 ? A SER 12 277 12 Y 1 A GLY -9 ? A GLY 13 278 12 Y 1 A ARG -8 ? A ARG 14 279 12 Y 1 A GLU -7 ? A GLU 15 280 12 Y 1 A ASN -6 ? A ASN 16 281 12 Y 1 A LEU -5 ? A LEU 17 282 12 Y 1 A TYR -4 ? A TYR 18 283 12 Y 1 A PHE -3 ? A PHE 19 284 12 Y 1 A GLN -2 ? A GLN 20 285 12 Y 1 A SER -1 ? A SER 21 286 12 Y 1 A HIS 0 ? A HIS 22 287 12 Y 1 A GLY 123 ? A GLY 145 288 12 Y 1 A SER 124 ? A SER 146 289 13 Y 1 A MET -21 ? A MET 1 290 13 Y 1 A GLY -20 ? A GLY 2 291 13 Y 1 A THR -19 ? A THR 3 292 13 Y 1 A SER -18 ? A SER 4 293 13 Y 1 A HIS -17 ? A HIS 5 294 13 Y 1 A HIS -16 ? A HIS 6 295 13 Y 1 A HIS -15 ? A HIS 7 296 13 Y 1 A HIS -14 ? A HIS 8 297 13 Y 1 A HIS -13 ? A HIS 9 298 13 Y 1 A HIS -12 ? A HIS 10 299 13 Y 1 A SER -11 ? A SER 11 300 13 Y 1 A SER -10 ? A SER 12 301 13 Y 1 A GLY -9 ? A GLY 13 302 13 Y 1 A ARG -8 ? A ARG 14 303 13 Y 1 A GLU -7 ? A GLU 15 304 13 Y 1 A ASN -6 ? A ASN 16 305 13 Y 1 A LEU -5 ? A LEU 17 306 13 Y 1 A TYR -4 ? A TYR 18 307 13 Y 1 A PHE -3 ? A PHE 19 308 13 Y 1 A GLN -2 ? A GLN 20 309 13 Y 1 A SER -1 ? A SER 21 310 13 Y 1 A HIS 0 ? A HIS 22 311 13 Y 1 A GLY 123 ? A GLY 145 312 13 Y 1 A SER 124 ? A SER 146 313 14 Y 1 A MET -21 ? A MET 1 314 14 Y 1 A GLY -20 ? A GLY 2 315 14 Y 1 A THR -19 ? A THR 3 316 14 Y 1 A SER -18 ? A SER 4 317 14 Y 1 A HIS -17 ? A HIS 5 318 14 Y 1 A HIS -16 ? A HIS 6 319 14 Y 1 A HIS -15 ? A HIS 7 320 14 Y 1 A HIS -14 ? A HIS 8 321 14 Y 1 A HIS -13 ? A HIS 9 322 14 Y 1 A HIS -12 ? A HIS 10 323 14 Y 1 A SER -11 ? A SER 11 324 14 Y 1 A SER -10 ? A SER 12 325 14 Y 1 A GLY -9 ? A GLY 13 326 14 Y 1 A ARG -8 ? A ARG 14 327 14 Y 1 A GLU -7 ? A GLU 15 328 14 Y 1 A ASN -6 ? A ASN 16 329 14 Y 1 A LEU -5 ? A LEU 17 330 14 Y 1 A TYR -4 ? A TYR 18 331 14 Y 1 A PHE -3 ? A PHE 19 332 14 Y 1 A GLN -2 ? A GLN 20 333 14 Y 1 A SER -1 ? A SER 21 334 14 Y 1 A HIS 0 ? A HIS 22 335 14 Y 1 A GLY 123 ? A GLY 145 336 14 Y 1 A SER 124 ? A SER 146 337 15 Y 1 A MET -21 ? A MET 1 338 15 Y 1 A GLY -20 ? A GLY 2 339 15 Y 1 A THR -19 ? A THR 3 340 15 Y 1 A SER -18 ? A SER 4 341 15 Y 1 A HIS -17 ? A HIS 5 342 15 Y 1 A HIS -16 ? A HIS 6 343 15 Y 1 A HIS -15 ? A HIS 7 344 15 Y 1 A HIS -14 ? A HIS 8 345 15 Y 1 A HIS -13 ? A HIS 9 346 15 Y 1 A HIS -12 ? A HIS 10 347 15 Y 1 A SER -11 ? A SER 11 348 15 Y 1 A SER -10 ? A SER 12 349 15 Y 1 A GLY -9 ? A GLY 13 350 15 Y 1 A ARG -8 ? A ARG 14 351 15 Y 1 A GLU -7 ? A GLU 15 352 15 Y 1 A ASN -6 ? A ASN 16 353 15 Y 1 A LEU -5 ? A LEU 17 354 15 Y 1 A TYR -4 ? A TYR 18 355 15 Y 1 A PHE -3 ? A PHE 19 356 15 Y 1 A GLN -2 ? A GLN 20 357 15 Y 1 A SER -1 ? A SER 21 358 15 Y 1 A HIS 0 ? A HIS 22 359 15 Y 1 A GLY 123 ? A GLY 145 360 15 Y 1 A SER 124 ? A SER 146 361 16 Y 1 A MET -21 ? A MET 1 362 16 Y 1 A GLY -20 ? A GLY 2 363 16 Y 1 A THR -19 ? A THR 3 364 16 Y 1 A SER -18 ? A SER 4 365 16 Y 1 A HIS -17 ? A HIS 5 366 16 Y 1 A HIS -16 ? A HIS 6 367 16 Y 1 A HIS -15 ? A HIS 7 368 16 Y 1 A HIS -14 ? A HIS 8 369 16 Y 1 A HIS -13 ? A HIS 9 370 16 Y 1 A HIS -12 ? A HIS 10 371 16 Y 1 A SER -11 ? A SER 11 372 16 Y 1 A SER -10 ? A SER 12 373 16 Y 1 A GLY -9 ? A GLY 13 374 16 Y 1 A ARG -8 ? A ARG 14 375 16 Y 1 A GLU -7 ? A GLU 15 376 16 Y 1 A ASN -6 ? A ASN 16 377 16 Y 1 A LEU -5 ? A LEU 17 378 16 Y 1 A TYR -4 ? A TYR 18 379 16 Y 1 A PHE -3 ? A PHE 19 380 16 Y 1 A GLN -2 ? A GLN 20 381 16 Y 1 A SER -1 ? A SER 21 382 16 Y 1 A HIS 0 ? A HIS 22 383 16 Y 1 A GLY 123 ? A GLY 145 384 16 Y 1 A SER 124 ? A SER 146 385 17 Y 1 A MET -21 ? A MET 1 386 17 Y 1 A GLY -20 ? A GLY 2 387 17 Y 1 A THR -19 ? A THR 3 388 17 Y 1 A SER -18 ? A SER 4 389 17 Y 1 A HIS -17 ? A HIS 5 390 17 Y 1 A HIS -16 ? A HIS 6 391 17 Y 1 A HIS -15 ? A HIS 7 392 17 Y 1 A HIS -14 ? A HIS 8 393 17 Y 1 A HIS -13 ? A HIS 9 394 17 Y 1 A HIS -12 ? A HIS 10 395 17 Y 1 A SER -11 ? A SER 11 396 17 Y 1 A SER -10 ? A SER 12 397 17 Y 1 A GLY -9 ? A GLY 13 398 17 Y 1 A ARG -8 ? A ARG 14 399 17 Y 1 A GLU -7 ? A GLU 15 400 17 Y 1 A ASN -6 ? A ASN 16 401 17 Y 1 A LEU -5 ? A LEU 17 402 17 Y 1 A TYR -4 ? A TYR 18 403 17 Y 1 A PHE -3 ? A PHE 19 404 17 Y 1 A GLN -2 ? A GLN 20 405 17 Y 1 A SER -1 ? A SER 21 406 17 Y 1 A HIS 0 ? A HIS 22 407 17 Y 1 A GLY 123 ? A GLY 145 408 17 Y 1 A SER 124 ? A SER 146 409 18 Y 1 A MET -21 ? A MET 1 410 18 Y 1 A GLY -20 ? A GLY 2 411 18 Y 1 A THR -19 ? A THR 3 412 18 Y 1 A SER -18 ? A SER 4 413 18 Y 1 A HIS -17 ? A HIS 5 414 18 Y 1 A HIS -16 ? A HIS 6 415 18 Y 1 A HIS -15 ? A HIS 7 416 18 Y 1 A HIS -14 ? A HIS 8 417 18 Y 1 A HIS -13 ? A HIS 9 418 18 Y 1 A HIS -12 ? A HIS 10 419 18 Y 1 A SER -11 ? A SER 11 420 18 Y 1 A SER -10 ? A SER 12 421 18 Y 1 A GLY -9 ? A GLY 13 422 18 Y 1 A ARG -8 ? A ARG 14 423 18 Y 1 A GLU -7 ? A GLU 15 424 18 Y 1 A ASN -6 ? A ASN 16 425 18 Y 1 A LEU -5 ? A LEU 17 426 18 Y 1 A TYR -4 ? A TYR 18 427 18 Y 1 A PHE -3 ? A PHE 19 428 18 Y 1 A GLN -2 ? A GLN 20 429 18 Y 1 A SER -1 ? A SER 21 430 18 Y 1 A HIS 0 ? A HIS 22 431 18 Y 1 A GLY 123 ? A GLY 145 432 18 Y 1 A SER 124 ? A SER 146 433 19 Y 1 A MET -21 ? A MET 1 434 19 Y 1 A GLY -20 ? A GLY 2 435 19 Y 1 A THR -19 ? A THR 3 436 19 Y 1 A SER -18 ? A SER 4 437 19 Y 1 A HIS -17 ? A HIS 5 438 19 Y 1 A HIS -16 ? A HIS 6 439 19 Y 1 A HIS -15 ? A HIS 7 440 19 Y 1 A HIS -14 ? A HIS 8 441 19 Y 1 A HIS -13 ? A HIS 9 442 19 Y 1 A HIS -12 ? A HIS 10 443 19 Y 1 A SER -11 ? A SER 11 444 19 Y 1 A SER -10 ? A SER 12 445 19 Y 1 A GLY -9 ? A GLY 13 446 19 Y 1 A ARG -8 ? A ARG 14 447 19 Y 1 A GLU -7 ? A GLU 15 448 19 Y 1 A ASN -6 ? A ASN 16 449 19 Y 1 A LEU -5 ? A LEU 17 450 19 Y 1 A TYR -4 ? A TYR 18 451 19 Y 1 A PHE -3 ? A PHE 19 452 19 Y 1 A GLN -2 ? A GLN 20 453 19 Y 1 A SER -1 ? A SER 21 454 19 Y 1 A HIS 0 ? A HIS 22 455 19 Y 1 A GLY 123 ? A GLY 145 456 19 Y 1 A SER 124 ? A SER 146 457 20 Y 1 A MET -21 ? A MET 1 458 20 Y 1 A GLY -20 ? A GLY 2 459 20 Y 1 A THR -19 ? A THR 3 460 20 Y 1 A SER -18 ? A SER 4 461 20 Y 1 A HIS -17 ? A HIS 5 462 20 Y 1 A HIS -16 ? A HIS 6 463 20 Y 1 A HIS -15 ? A HIS 7 464 20 Y 1 A HIS -14 ? A HIS 8 465 20 Y 1 A HIS -13 ? A HIS 9 466 20 Y 1 A HIS -12 ? A HIS 10 467 20 Y 1 A SER -11 ? A SER 11 468 20 Y 1 A SER -10 ? A SER 12 469 20 Y 1 A GLY -9 ? A GLY 13 470 20 Y 1 A ARG -8 ? A ARG 14 471 20 Y 1 A GLU -7 ? A GLU 15 472 20 Y 1 A ASN -6 ? A ASN 16 473 20 Y 1 A LEU -5 ? A LEU 17 474 20 Y 1 A TYR -4 ? A TYR 18 475 20 Y 1 A PHE -3 ? A PHE 19 476 20 Y 1 A GLN -2 ? A GLN 20 477 20 Y 1 A SER -1 ? A SER 21 478 20 Y 1 A HIS 0 ? A HIS 22 479 20 Y 1 A GLY 123 ? A GLY 145 480 20 Y 1 A SER 124 ? A SER 146 #