data_2AL3 # _entry.id 2AL3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2AL3 pdb_00002al3 10.2210/pdb2al3/pdb RCSB RCSB034021 ? ? WWPDB D_1000034021 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2AL3 _pdbx_database_status.recvd_initial_deposition_date 2005-08-04 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry N _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tettamanzi, M.C.' 1 'Yu, C.' 2 'Bogan, J.S.' 3 'Hodsdon, M.E.' 4 # _citation.id primary _citation.title 'Solution structure and backbone dynamics of an N-terminal ubiquitin-like domain in the GLUT4-regulating protein, TUG.' _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 15 _citation.page_first 498 _citation.page_last 508 _citation.year 2006 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 0961-8368 _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16501224 _citation.pdbx_database_id_DOI 10.1110/ps.051901806 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tettamanzi, M.C.' 1 ? primary 'Yu, C.' 2 ? primary 'Bogan, J.S.' 3 ? primary 'Hodsdon, M.E.' 4 ? # _cell.entry_id 2AL3 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2AL3 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'TUG long isoform' _entity.formula_weight 9919.222 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-Terminal Ubiquitin-Like Domain (residues 1-90)' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAAPAGGGGSAVSVLAPNGRRHTVKVTPSTVLLQVLEDTCRRQDFNPSEYDLKFQRTVLDLSLQWRFANLPNNAKLEMVP VSRSREGPEN ; _entity_poly.pdbx_seq_one_letter_code_can ;MAAPAGGGGSAVSVLAPNGRRHTVKVTPSTVLLQVLEDTCRRQDFNPSEYDLKFQRTVLDLSLQWRFANLPNNAKLEMVP VSRSREGPEN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ALA n 1 4 PRO n 1 5 ALA n 1 6 GLY n 1 7 GLY n 1 8 GLY n 1 9 GLY n 1 10 SER n 1 11 ALA n 1 12 VAL n 1 13 SER n 1 14 VAL n 1 15 LEU n 1 16 ALA n 1 17 PRO n 1 18 ASN n 1 19 GLY n 1 20 ARG n 1 21 ARG n 1 22 HIS n 1 23 THR n 1 24 VAL n 1 25 LYS n 1 26 VAL n 1 27 THR n 1 28 PRO n 1 29 SER n 1 30 THR n 1 31 VAL n 1 32 LEU n 1 33 LEU n 1 34 GLN n 1 35 VAL n 1 36 LEU n 1 37 GLU n 1 38 ASP n 1 39 THR n 1 40 CYS n 1 41 ARG n 1 42 ARG n 1 43 GLN n 1 44 ASP n 1 45 PHE n 1 46 ASN n 1 47 PRO n 1 48 SER n 1 49 GLU n 1 50 TYR n 1 51 ASP n 1 52 LEU n 1 53 LYS n 1 54 PHE n 1 55 GLN n 1 56 ARG n 1 57 THR n 1 58 VAL n 1 59 LEU n 1 60 ASP n 1 61 LEU n 1 62 SER n 1 63 LEU n 1 64 GLN n 1 65 TRP n 1 66 ARG n 1 67 PHE n 1 68 ALA n 1 69 ASN n 1 70 LEU n 1 71 PRO n 1 72 ASN n 1 73 ASN n 1 74 ALA n 1 75 LYS n 1 76 LEU n 1 77 GLU n 1 78 MET n 1 79 VAL n 1 80 PRO n 1 81 VAL n 1 82 SER n 1 83 ARG n 1 84 SER n 1 85 ARG n 1 86 GLU n 1 87 GLY n 1 88 PRO n 1 89 GLU n 1 90 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene tug _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 DE3' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX-2K _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name GB _struct_ref.db_code AAR01614 _struct_ref.pdbx_db_accession 37704773 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAAPAGGGGSAVSVLAPNGRRHTVKVTPSTVLLQVLEDTCRRQDFNPSEYDLKFQRTVLDLSLQWRFANLPNNAKLEMVP VSRSREGPEN ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2AL3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 90 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 37704773 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 90 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 90 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 4D_13C/15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 3 1 '3D_15N -SEPARATED_NOESY' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength '20 mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;0.75 mM TUG-UBL1, 20 MM POTASSIUM PHOSPHATE, 20 MM NACL, 0.05% NAN3, 1 UM LUPEPTIN, 1 UM PEPSTATIN, 1 UM PMSF, 1.5 MM PROTEIN, UNIFORM (RANDOM) LABELING WITH 13C, 15N AT KNOWN LABELING ; _pdbx_nmr_sample_details.solvent_system ;20 MM POTASSIUM PHOSPHATE, 20 MM NACL, 0.05% NAN3, 1 UM LUPEPTIN, 1 UM PEPSTATIN, 1 UM PMSF, 1.5 MM PROTEIN, UNIFORM (RANDOM) LABELING WITH 13C, 15N AT KNOWN LABELING ; # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2AL3 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2AL3 _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2AL3 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CYANA 1.0.5 'P.GUNTERT ET AL.' 1 collection VNMR 6.1 Varian 2 'data analysis' NMRDraw 2.1 'F. Delaglio et Al' 3 processing NMRPipe ? 'F. Delaglio et Al' 4 'data analysis' Sparky 3.98 'T. D. Goddard et Al' 5 'data analysis' NMRView 5.0.4 'One Moon Scientific, Inc.' 6 'structure solution' CYANA 1.0.5 'P.GUNTERT ET AL.' 7 'structure solution' TALOS ? 'A. Bax et Al' 8 # _exptl.entry_id 2AL3 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.density_Matthews ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2AL3 _struct.title 'Solution structure and backbone dynamics of an N-terminal ubiquitin-like domain in the GLUT4-tethering protein, TUG' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2AL3 _struct_keywords.pdbx_keywords ENDOCYTOSIS/EXOCYTOSIS _struct_keywords.text 'TUG UBL1 Insulin, ENDOCYTOSIS-EXOCYTOSIS COMPLEX' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 VAL A 31 ? GLN A 43 ? VAL A 31 GLN A 43 1 ? 13 HELX_P HELX_P2 2 ASN A 46 ? TYR A 50 ? ASN A 46 TYR A 50 5 ? 5 HELX_P HELX_P3 3 GLN A 64 ? ASN A 69 ? GLN A 64 ASN A 69 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 21 ? VAL A 24 ? ARG A 21 VAL A 24 A 2 VAL A 12 ? LEU A 15 ? VAL A 12 LEU A 15 A 3 LYS A 75 ? VAL A 79 ? LYS A 75 VAL A 79 A 4 ASP A 51 ? PHE A 54 ? ASP A 51 PHE A 54 A 5 THR A 57 ? LEU A 59 ? THR A 57 LEU A 59 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O HIS A 22 ? O HIS A 22 N VAL A 14 ? N VAL A 14 A 2 3 N SER A 13 ? N SER A 13 O LEU A 76 ? O LEU A 76 A 3 4 O VAL A 79 ? O VAL A 79 N ASP A 51 ? N ASP A 51 A 4 5 N LEU A 52 ? N LEU A 52 O LEU A 59 ? O LEU A 59 # _database_PDB_matrix.entry_id 2AL3 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2AL3 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 ALA 3 3 ? ? ? A . n A 1 4 PRO 4 4 ? ? ? A . n A 1 5 ALA 5 5 ? ? ? A . n A 1 6 GLY 6 6 ? ? ? A . n A 1 7 GLY 7 7 ? ? ? A . n A 1 8 GLY 8 8 ? ? ? A . n A 1 9 GLY 9 9 ? ? ? A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 TRP 65 65 65 TRP TRP A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 MET 78 78 78 MET MET A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 GLU 86 86 ? ? ? A . n A 1 87 GLY 87 87 ? ? ? A . n A 1 88 PRO 88 88 ? ? ? A . n A 1 89 GLU 89 89 ? ? ? A . n A 1 90 ASN 90 90 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-03-21 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_remark.id 999 _pdbx_database_remark.text ;SEQUENCE The missing residues are the results of structural disorder and degradation during the experiments. ; # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A ASP 51 ? ? O A VAL 79 ? ? 1.26 2 1 O A LEU 52 ? ? H A LEU 59 ? ? 1.32 3 1 O A SER 13 ? ? H A LEU 76 ? ? 1.36 4 1 O A LEU 32 ? ? H A LEU 36 ? ? 1.46 5 1 O A GLN 64 ? ? H A ALA 68 ? ? 1.49 6 1 HG1 A THR 39 ? ? OE1 A GLN 43 ? ? 1.51 7 1 H A SER 13 ? ? O A ALA 74 ? ? 1.52 8 1 H A PHE 54 ? ? O A THR 57 ? ? 1.53 9 1 O A PHE 67 ? ? HD21 A ASN 69 ? ? 1.58 10 1 O A LEU 52 ? ? N A LEU 59 ? ? 2.19 11 1 O A VAL 12 ? ? O A VAL 24 ? ? 2.19 12 2 O A LEU 52 ? ? H A LEU 59 ? ? 1.29 13 2 H A ASP 51 ? ? O A VAL 79 ? ? 1.34 14 2 O A SER 13 ? ? H A LEU 76 ? ? 1.38 15 2 H A PHE 54 ? ? O A THR 57 ? ? 1.44 16 2 O A LEU 32 ? ? H A LEU 36 ? ? 1.47 17 2 H A ALA 11 ? ? O A ASN 72 ? ? 1.48 18 2 O A LYS 53 ? ? H A GLU 77 ? ? 1.51 19 2 O A GLN 64 ? ? H A ALA 68 ? ? 1.51 20 2 O A THR 39 ? ? H A GLN 43 ? ? 1.54 21 2 H A SER 13 ? ? O A ALA 74 ? ? 1.55 22 2 O A PHE 67 ? ? HD21 A ASN 69 ? ? 1.57 23 2 O A PHE 54 ? ? H A THR 57 ? ? 1.60 24 2 O A ALA 11 ? ? O A ASN 72 ? ? 2.14 25 2 O A LEU 52 ? ? N A LEU 59 ? ? 2.16 26 2 O A VAL 12 ? ? O A VAL 24 ? ? 2.16 27 3 H A ASP 51 ? ? O A VAL 79 ? ? 1.28 28 3 O A LEU 52 ? ? H A LEU 59 ? ? 1.31 29 3 O A SER 13 ? ? H A LEU 76 ? ? 1.37 30 3 H A PHE 54 ? ? O A THR 57 ? ? 1.48 31 3 O A LEU 32 ? ? H A LEU 36 ? ? 1.49 32 3 H A SER 13 ? ? O A ALA 74 ? ? 1.50 33 3 O A GLN 64 ? ? H A ALA 68 ? ? 1.53 34 3 O A THR 39 ? ? H A GLN 43 ? ? 1.53 35 3 H A ALA 11 ? ? O A ASN 72 ? ? 1.55 36 3 O A ALA 11 ? ? O A ASN 72 ? ? 2.13 37 3 O A LEU 52 ? ? O A LEU 59 ? ? 2.16 38 3 O A VAL 12 ? ? O A VAL 24 ? ? 2.17 39 3 O A LEU 52 ? ? N A LEU 59 ? ? 2.18 40 4 H A ASP 51 ? ? O A VAL 79 ? ? 1.27 41 4 O A LEU 52 ? ? H A LEU 59 ? ? 1.34 42 4 O A SER 13 ? ? H A LEU 76 ? ? 1.40 43 4 H A PHE 54 ? ? O A THR 57 ? ? 1.48 44 4 O A LEU 32 ? ? H A LEU 36 ? ? 1.48 45 4 O A GLN 64 ? ? H A ALA 68 ? ? 1.51 46 4 O A THR 39 ? ? H A GLN 43 ? ? 1.53 47 4 H A SER 13 ? ? O A ALA 74 ? ? 1.55 48 4 H A ALA 11 ? ? O A ASN 72 ? ? 1.55 49 4 O A ALA 11 ? ? O A ASN 72 ? ? 2.19 50 5 O A LEU 52 ? ? H A LEU 59 ? ? 1.31 51 5 H A ASP 51 ? ? O A VAL 79 ? ? 1.32 52 5 O A SER 13 ? ? H A LEU 76 ? ? 1.37 53 5 H A PHE 54 ? ? O A THR 57 ? ? 1.42 54 5 H A SER 13 ? ? O A ALA 74 ? ? 1.46 55 5 O A LEU 32 ? ? H A LEU 36 ? ? 1.53 56 5 O A THR 39 ? ? H A GLN 43 ? ? 1.53 57 5 O A GLN 64 ? ? H A ALA 68 ? ? 1.53 58 5 H A ALA 11 ? ? O A ASN 72 ? ? 1.56 59 5 O A PHE 67 ? ? HD21 A ASN 69 ? ? 1.57 60 5 O A LYS 53 ? ? H A GLU 77 ? ? 1.58 61 5 O A VAL 12 ? ? O A VAL 24 ? ? 2.14 62 5 O A LEU 52 ? ? N A LEU 59 ? ? 2.16 63 6 O A LEU 52 ? ? H A LEU 59 ? ? 1.29 64 6 H A ASP 51 ? ? O A VAL 79 ? ? 1.30 65 6 O A LEU 32 ? ? H A LEU 36 ? ? 1.42 66 6 O A SER 13 ? ? H A LEU 76 ? ? 1.46 67 6 H A PHE 54 ? ? O A THR 57 ? ? 1.47 68 6 H A SER 13 ? ? O A ALA 74 ? ? 1.47 69 6 O A THR 39 ? ? H A GLN 43 ? ? 1.53 70 6 O A LYS 53 ? ? H A GLU 77 ? ? 1.56 71 6 O A LEU 52 ? ? N A LEU 59 ? ? 2.14 72 6 O A ALA 11 ? ? O A ASN 72 ? ? 2.18 73 6 O A VAL 12 ? ? O A VAL 24 ? ? 2.18 74 7 H A ASP 51 ? ? O A VAL 79 ? ? 1.27 75 7 O A SER 13 ? ? H A LEU 76 ? ? 1.32 76 7 O A LEU 52 ? ? H A LEU 59 ? ? 1.33 77 7 H A SER 13 ? ? O A ALA 74 ? ? 1.38 78 7 H A PHE 54 ? ? O A THR 57 ? ? 1.45 79 7 O A LEU 32 ? ? H A LEU 36 ? ? 1.47 80 7 O A GLN 64 ? ? H A ALA 68 ? ? 1.47 81 7 H A ALA 16 ? ? O A ARG 20 ? ? 1.55 82 7 O A THR 39 ? ? H A GLN 43 ? ? 1.55 83 7 O A VAL 12 ? ? O A VAL 24 ? ? 2.03 84 7 O A ALA 11 ? ? O A ASN 72 ? ? 2.14 85 8 O A LEU 52 ? ? H A LEU 59 ? ? 1.29 86 8 H A ASP 51 ? ? O A VAL 79 ? ? 1.30 87 8 O A SER 13 ? ? H A LEU 76 ? ? 1.39 88 8 O A LEU 32 ? ? H A LEU 36 ? ? 1.42 89 8 H A PHE 54 ? ? O A THR 57 ? ? 1.49 90 8 H A SER 13 ? ? O A ALA 74 ? ? 1.49 91 8 O A THR 39 ? ? H A GLN 43 ? ? 1.53 92 8 O A GLN 64 ? ? H A ALA 68 ? ? 1.54 93 8 O A LEU 52 ? ? N A LEU 59 ? ? 2.16 94 8 O A VAL 12 ? ? O A VAL 24 ? ? 2.17 95 8 O A ALA 11 ? ? O A ASN 72 ? ? 2.17 96 9 O A SER 13 ? ? H A LEU 76 ? ? 1.24 97 9 O A LEU 52 ? ? H A LEU 59 ? ? 1.30 98 9 H A ASP 51 ? ? O A VAL 79 ? ? 1.34 99 9 O A LEU 32 ? ? H A LEU 36 ? ? 1.43 100 9 O A GLN 64 ? ? H A ALA 68 ? ? 1.44 101 9 H A ALA 16 ? ? O A ARG 20 ? ? 1.49 102 9 H A SER 13 ? ? O A ALA 74 ? ? 1.50 103 9 H A PHE 54 ? ? O A THR 57 ? ? 1.50 104 9 O A LYS 53 ? ? H A GLU 77 ? ? 1.51 105 9 O A THR 39 ? ? H A GLN 43 ? ? 1.54 106 9 O A VAL 12 ? ? O A VAL 24 ? ? 2.12 107 9 O A ALA 11 ? ? O A ASN 72 ? ? 2.15 108 9 O A LEU 52 ? ? N A LEU 59 ? ? 2.17 109 10 H A ASP 51 ? ? O A VAL 79 ? ? 1.31 110 10 O A LEU 52 ? ? H A LEU 59 ? ? 1.31 111 10 O A SER 13 ? ? H A LEU 76 ? ? 1.33 112 10 H A PHE 54 ? ? O A THR 57 ? ? 1.48 113 10 O A LEU 32 ? ? H A LEU 36 ? ? 1.48 114 10 H A SER 13 ? ? O A ALA 74 ? ? 1.48 115 10 O A THR 39 ? ? H A GLN 43 ? ? 1.54 116 10 O A LEU 52 ? ? N A LEU 59 ? ? 2.17 117 10 O A VAL 12 ? ? O A VAL 24 ? ? 2.18 118 10 O A ALA 11 ? ? O A ASN 72 ? ? 2.19 119 11 O A LEU 52 ? ? H A LEU 59 ? ? 1.29 120 11 H A ASP 51 ? ? O A VAL 79 ? ? 1.31 121 11 O A SER 13 ? ? H A LEU 76 ? ? 1.43 122 11 O A LEU 32 ? ? H A LEU 36 ? ? 1.49 123 11 O A GLN 64 ? ? H A ALA 68 ? ? 1.50 124 11 H A SER 13 ? ? O A ALA 74 ? ? 1.51 125 11 O A THR 39 ? ? H A GLN 43 ? ? 1.55 126 11 H A PHE 54 ? ? O A THR 57 ? ? 1.59 127 11 O A LEU 52 ? ? N A LEU 59 ? ? 2.13 128 11 O A VAL 12 ? ? O A VAL 24 ? ? 2.16 129 11 O A ALA 11 ? ? O A ASN 72 ? ? 2.17 130 12 O A SER 13 ? ? H A LEU 76 ? ? 1.32 131 12 H A ASP 51 ? ? O A VAL 79 ? ? 1.32 132 12 O A LEU 52 ? ? H A LEU 59 ? ? 1.33 133 12 H A SER 13 ? ? O A ALA 74 ? ? 1.45 134 12 O A LEU 32 ? ? H A LEU 36 ? ? 1.48 135 12 O A GLN 64 ? ? H A ALA 68 ? ? 1.51 136 12 H A PHE 54 ? ? O A THR 57 ? ? 1.51 137 12 H A ALA 16 ? ? O A ARG 20 ? ? 1.53 138 12 O A THR 39 ? ? H A GLN 43 ? ? 1.54 139 12 O A VAL 12 ? ? O A VAL 24 ? ? 2.06 140 12 O A ALA 11 ? ? O A ASN 72 ? ? 2.12 141 12 O A LEU 52 ? ? N A LEU 59 ? ? 2.18 142 13 O A SER 13 ? ? H A LEU 76 ? ? 1.24 143 13 O A LEU 52 ? ? H A LEU 59 ? ? 1.27 144 13 H A ASP 51 ? ? O A VAL 79 ? ? 1.31 145 13 O A LEU 32 ? ? H A LEU 36 ? ? 1.46 146 13 H A SER 13 ? ? O A ALA 74 ? ? 1.48 147 13 H A ALA 16 ? ? O A ARG 20 ? ? 1.52 148 13 H A ALA 11 ? ? O A ASN 72 ? ? 1.53 149 13 H A PHE 54 ? ? O A THR 57 ? ? 1.53 150 13 O A THR 39 ? ? H A GLN 43 ? ? 1.54 151 13 O A PHE 67 ? ? HD21 A ASN 69 ? ? 1.56 152 13 O A VAL 12 ? ? O A VAL 24 ? ? 2.11 153 13 O A LEU 52 ? ? N A LEU 59 ? ? 2.13 154 13 O A ALA 11 ? ? O A ASN 72 ? ? 2.13 155 14 O A LEU 52 ? ? H A LEU 59 ? ? 1.31 156 14 H A ASP 51 ? ? O A VAL 79 ? ? 1.32 157 14 O A SER 13 ? ? H A LEU 76 ? ? 1.34 158 14 H A PHE 54 ? ? O A THR 57 ? ? 1.47 159 14 O A LEU 32 ? ? H A LEU 36 ? ? 1.51 160 14 O A GLN 64 ? ? H A ALA 68 ? ? 1.52 161 14 O A LYS 53 ? ? H A GLU 77 ? ? 1.54 162 14 O A THR 39 ? ? H A GLN 43 ? ? 1.55 163 14 H A SER 13 ? ? O A ALA 74 ? ? 1.58 164 14 O A VAL 12 ? ? O A VAL 24 ? ? 2.09 165 14 O A ALA 11 ? ? O A ASN 72 ? ? 2.12 166 14 O A LEU 52 ? ? N A LEU 59 ? ? 2.16 167 15 H A ASP 51 ? ? O A VAL 79 ? ? 1.29 168 15 O A LEU 52 ? ? H A LEU 59 ? ? 1.30 169 15 O A SER 13 ? ? H A LEU 76 ? ? 1.35 170 15 O A GLN 64 ? ? H A ALA 68 ? ? 1.43 171 15 H A SER 13 ? ? O A ALA 74 ? ? 1.47 172 15 O A LEU 32 ? ? H A LEU 36 ? ? 1.47 173 15 H A PHE 54 ? ? O A THR 57 ? ? 1.48 174 15 O A THR 39 ? ? H A GLN 43 ? ? 1.52 175 15 O A LEU 52 ? ? N A LEU 59 ? ? 2.16 176 15 O A VAL 12 ? ? O A VAL 24 ? ? 2.18 177 15 O A ALA 11 ? ? O A ASN 72 ? ? 2.18 178 16 H A ASP 51 ? ? O A VAL 79 ? ? 1.28 179 16 O A LEU 52 ? ? H A LEU 59 ? ? 1.29 180 16 O A SER 13 ? ? H A LEU 76 ? ? 1.38 181 16 H A PHE 54 ? ? O A THR 57 ? ? 1.46 182 16 O A LEU 32 ? ? H A LEU 36 ? ? 1.46 183 16 H A SER 13 ? ? O A ALA 74 ? ? 1.51 184 16 O A GLN 64 ? ? H A ALA 68 ? ? 1.52 185 16 O A THR 39 ? ? H A GLN 43 ? ? 1.54 186 16 O A PHE 67 ? ? HD21 A ASN 69 ? ? 1.60 187 16 O A LEU 52 ? ? N A LEU 59 ? ? 2.15 188 17 O A LEU 52 ? ? H A LEU 59 ? ? 1.29 189 17 H A ASP 51 ? ? O A VAL 79 ? ? 1.29 190 17 H A SER 13 ? ? O A ALA 74 ? ? 1.37 191 17 O A SER 13 ? ? H A LEU 76 ? ? 1.44 192 17 H A PHE 54 ? ? O A THR 57 ? ? 1.44 193 17 O A GLN 64 ? ? H A ALA 68 ? ? 1.44 194 17 O A LEU 32 ? ? H A LEU 36 ? ? 1.48 195 17 H A ALA 16 ? ? O A ARG 20 ? ? 1.54 196 17 O A VAL 12 ? ? O A VAL 24 ? ? 2.02 197 17 O A LEU 52 ? ? N A LEU 59 ? ? 2.14 198 18 O A LEU 52 ? ? H A LEU 59 ? ? 1.29 199 18 O A SER 13 ? ? H A LEU 76 ? ? 1.31 200 18 H A ASP 51 ? ? O A VAL 79 ? ? 1.32 201 18 H A SER 13 ? ? O A ALA 74 ? ? 1.38 202 18 H A PHE 54 ? ? O A THR 57 ? ? 1.45 203 18 O A LEU 32 ? ? H A LEU 36 ? ? 1.48 204 18 O A GLN 64 ? ? H A ALA 68 ? ? 1.53 205 18 O A THR 39 ? ? H A GLN 43 ? ? 1.54 206 18 H A ALA 16 ? ? O A ARG 20 ? ? 1.54 207 18 O A PHE 67 ? ? HD21 A ASN 69 ? ? 1.57 208 18 O A VAL 12 ? ? O A VAL 24 ? ? 2.00 209 18 O A ALA 11 ? ? O A ASN 72 ? ? 2.12 210 18 O A LEU 52 ? ? N A LEU 59 ? ? 2.14 211 19 H A ASP 51 ? ? O A VAL 79 ? ? 1.30 212 19 O A LEU 52 ? ? H A LEU 59 ? ? 1.31 213 19 H A PHE 54 ? ? O A THR 57 ? ? 1.39 214 19 O A SER 13 ? ? H A LEU 76 ? ? 1.39 215 19 H A SER 13 ? ? O A ALA 74 ? ? 1.40 216 19 O A LEU 32 ? ? H A LEU 36 ? ? 1.47 217 19 H A ALA 16 ? ? O A ARG 20 ? ? 1.55 218 19 O A LYS 53 ? ? H A GLU 77 ? ? 1.55 219 19 O A PHE 54 ? ? H A THR 57 ? ? 1.58 220 19 O A THR 39 ? ? H A GLN 43 ? ? 1.58 221 19 O A VAL 12 ? ? O A VAL 24 ? ? 2.07 222 19 O A ALA 11 ? ? O A ASN 72 ? ? 2.16 223 19 O A LEU 52 ? ? N A LEU 59 ? ? 2.17 224 20 O A LEU 52 ? ? H A LEU 59 ? ? 1.27 225 20 O A SER 13 ? ? H A LEU 76 ? ? 1.27 226 20 H A ASP 51 ? ? O A VAL 79 ? ? 1.30 227 20 H A SER 13 ? ? O A ALA 74 ? ? 1.47 228 20 H A PHE 54 ? ? O A THR 57 ? ? 1.48 229 20 O A LEU 32 ? ? H A LEU 36 ? ? 1.48 230 20 O A GLN 64 ? ? H A ALA 68 ? ? 1.55 231 20 H A ALA 16 ? ? O A ARG 20 ? ? 1.57 232 20 O A LYS 53 ? ? H A GLU 77 ? ? 1.58 233 20 H A ALA 11 ? ? O A ASN 72 ? ? 1.60 234 20 O A VAL 12 ? ? O A VAL 24 ? ? 2.07 235 20 O A LEU 52 ? ? N A LEU 59 ? ? 2.13 236 20 O A ALA 11 ? ? O A ASN 72 ? ? 2.15 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 44 ? ? 33.75 69.54 2 1 GLN A 55 ? ? 60.65 -109.08 3 1 ASP A 60 ? ? -145.76 -147.46 4 1 SER A 62 ? ? -88.19 41.44 5 1 ASN A 69 ? ? 42.82 94.00 6 1 ASN A 72 ? ? -40.59 -85.30 7 1 ALA A 74 ? ? 27.01 83.78 8 1 VAL A 81 ? ? 165.15 -166.19 9 1 ARG A 83 ? ? 51.46 173.08 10 2 ASP A 44 ? ? 39.83 67.16 11 2 GLN A 55 ? ? 56.56 -104.02 12 2 ASP A 60 ? ? -138.18 -153.61 13 2 SER A 62 ? ? -85.91 40.06 14 2 ASN A 69 ? ? 40.79 93.71 15 2 ASN A 72 ? ? -35.84 -90.10 16 2 ALA A 74 ? ? 24.35 88.83 17 2 VAL A 81 ? ? 162.04 -154.79 18 3 GLN A 55 ? ? 59.63 -107.30 19 3 ASP A 60 ? ? -142.07 -149.45 20 3 SER A 62 ? ? -85.63 38.27 21 3 ASN A 69 ? ? 42.50 95.42 22 3 ASN A 72 ? ? -37.76 -87.95 23 3 ALA A 74 ? ? 22.33 90.83 24 3 VAL A 81 ? ? 160.79 -154.46 25 3 ARG A 83 ? ? -39.37 129.18 26 3 SER A 84 ? ? 61.97 159.59 27 4 GLN A 55 ? ? 58.95 -108.04 28 4 ASP A 60 ? ? -144.36 -148.82 29 4 SER A 62 ? ? -88.70 39.88 30 4 ASN A 69 ? ? 40.70 90.98 31 4 ASN A 72 ? ? -45.34 -76.01 32 4 ALA A 74 ? ? 24.05 84.60 33 4 VAL A 81 ? ? 159.87 -153.68 34 4 SER A 84 ? ? 65.48 82.10 35 5 GLN A 55 ? ? 56.78 -105.81 36 5 ASP A 60 ? ? -139.17 -154.14 37 5 SER A 62 ? ? -85.02 39.57 38 5 ASN A 69 ? ? 42.05 92.70 39 5 ASN A 72 ? ? -43.42 -82.45 40 5 ALA A 74 ? ? 23.23 89.09 41 5 VAL A 81 ? ? 160.30 -150.92 42 6 GLN A 55 ? ? 60.09 -106.72 43 6 ASP A 60 ? ? -139.66 -152.64 44 6 SER A 62 ? ? -85.90 40.74 45 6 PHE A 67 ? ? -103.67 -62.98 46 6 ASN A 69 ? ? 41.48 93.32 47 6 ASN A 72 ? ? -40.71 -82.93 48 6 ALA A 74 ? ? 27.19 88.16 49 6 VAL A 81 ? ? 161.17 -149.82 50 7 ASP A 44 ? ? 34.87 66.81 51 7 GLN A 55 ? ? 58.23 -107.08 52 7 ASP A 60 ? ? -150.39 -149.43 53 7 SER A 62 ? ? -87.20 40.96 54 7 ASN A 69 ? ? 39.52 91.71 55 7 ASN A 72 ? ? -35.05 -90.56 56 7 ALA A 74 ? ? 28.63 92.40 57 7 VAL A 81 ? ? 160.61 -152.93 58 8 ASP A 44 ? ? 38.24 67.34 59 8 GLN A 55 ? ? 58.89 -106.27 60 8 ASP A 60 ? ? -146.44 -146.81 61 8 SER A 62 ? ? -87.42 40.13 62 8 ASN A 69 ? ? 40.91 87.34 63 8 ASN A 72 ? ? -36.97 -89.57 64 8 ALA A 74 ? ? 27.98 85.67 65 8 VAL A 81 ? ? 161.39 -154.59 66 9 ASP A 44 ? ? 38.87 67.58 67 9 GLN A 55 ? ? 59.60 -107.96 68 9 ASP A 60 ? ? -147.62 -159.97 69 9 ASN A 69 ? ? 40.65 88.15 70 9 ASN A 72 ? ? -32.76 -93.02 71 9 ALA A 74 ? ? 30.23 86.36 72 9 VAL A 81 ? ? 165.72 -161.95 73 9 ARG A 83 ? ? -37.02 109.85 74 9 SER A 84 ? ? -53.35 99.18 75 10 ASP A 44 ? ? 34.22 68.23 76 10 GLN A 55 ? ? 59.14 -107.80 77 10 ASP A 60 ? ? -141.83 -145.66 78 10 SER A 62 ? ? -89.68 40.79 79 10 ASN A 69 ? ? 42.32 92.91 80 10 ASN A 72 ? ? -46.20 -78.37 81 10 ALA A 74 ? ? 22.33 87.45 82 10 VAL A 81 ? ? 161.97 -162.93 83 10 ARG A 83 ? ? 58.83 147.80 84 11 ASP A 44 ? ? 31.81 69.80 85 11 GLN A 55 ? ? 65.69 -110.08 86 11 ASP A 60 ? ? -138.93 -147.86 87 11 SER A 62 ? ? -87.73 39.90 88 11 ASN A 69 ? ? 41.08 89.78 89 11 ASN A 72 ? ? -42.30 -85.74 90 11 ALA A 74 ? ? 29.24 76.36 91 11 VAL A 81 ? ? 160.30 -159.79 92 12 GLN A 55 ? ? 60.18 -109.10 93 12 ASP A 60 ? ? -145.05 -148.83 94 12 SER A 62 ? ? -86.66 38.97 95 12 ASN A 69 ? ? 37.45 82.41 96 12 ASN A 72 ? ? -37.59 -88.85 97 12 ALA A 74 ? ? 26.58 86.54 98 12 VAL A 81 ? ? 160.02 -155.10 99 13 ASP A 44 ? ? 31.77 69.16 100 13 GLN A 55 ? ? 56.78 -103.06 101 13 ASP A 60 ? ? -141.83 -153.49 102 13 SER A 62 ? ? -86.16 39.15 103 13 PHE A 67 ? ? -105.39 -64.87 104 13 ASN A 69 ? ? 42.30 93.23 105 13 ASN A 72 ? ? -35.00 -90.57 106 13 ALA A 74 ? ? 27.88 85.89 107 13 VAL A 81 ? ? 162.77 -156.37 108 13 ARG A 83 ? ? -58.18 100.27 109 14 ASP A 44 ? ? 34.31 68.72 110 14 GLN A 55 ? ? 59.10 -106.89 111 14 ASP A 60 ? ? -141.38 -154.50 112 14 SER A 62 ? ? -84.20 39.51 113 14 ASN A 69 ? ? 41.70 92.66 114 14 ASN A 72 ? ? -40.37 -86.37 115 14 ALA A 74 ? ? 25.24 84.33 116 14 VAL A 81 ? ? 159.90 -153.73 117 15 ASP A 44 ? ? 37.16 67.98 118 15 GLN A 55 ? ? 58.84 -107.18 119 15 ASP A 60 ? ? -144.12 -149.41 120 15 SER A 62 ? ? -88.58 39.43 121 15 ASN A 69 ? ? 41.14 86.59 122 15 ASN A 72 ? ? -42.57 -82.89 123 15 ALA A 74 ? ? 25.76 86.44 124 15 VAL A 81 ? ? 159.78 -154.95 125 15 SER A 84 ? ? -156.98 78.85 126 16 GLN A 55 ? ? 58.42 -105.80 127 16 ASP A 60 ? ? -142.20 -155.95 128 16 SER A 62 ? ? -84.60 38.60 129 16 PHE A 67 ? ? -102.10 -60.62 130 16 ASN A 69 ? ? 42.84 94.98 131 16 ASN A 72 ? ? -42.10 -82.40 132 16 ALA A 74 ? ? 27.56 86.30 133 16 VAL A 81 ? ? 161.76 -155.81 134 17 ASP A 44 ? ? 33.15 70.02 135 17 GLN A 55 ? ? 57.96 -106.40 136 17 ASP A 60 ? ? -145.28 -152.71 137 17 ASN A 69 ? ? 42.33 92.16 138 17 ASN A 72 ? ? -47.27 -78.52 139 17 ALA A 74 ? ? 31.86 83.65 140 17 VAL A 81 ? ? 163.02 -161.66 141 17 ARG A 83 ? ? -37.72 109.02 142 17 SER A 84 ? ? 80.19 -63.15 143 18 ASP A 44 ? ? 37.08 67.11 144 18 GLN A 55 ? ? 58.45 -105.45 145 18 ASP A 60 ? ? -142.71 -153.18 146 18 SER A 62 ? ? -83.73 38.32 147 18 ASN A 69 ? ? 41.73 92.89 148 18 ASN A 72 ? ? -35.42 -90.04 149 18 ALA A 74 ? ? 28.61 89.11 150 18 VAL A 81 ? ? 162.81 -163.88 151 18 ARG A 83 ? ? -34.89 -38.62 152 19 ASP A 44 ? ? 38.95 68.99 153 19 GLN A 55 ? ? 55.45 -104.70 154 19 ASP A 60 ? ? -140.44 -154.32 155 19 SER A 62 ? ? -85.09 40.68 156 19 ASN A 69 ? ? 42.21 93.49 157 19 ASN A 72 ? ? -35.93 -91.45 158 19 ALA A 74 ? ? 30.72 86.73 159 19 VAL A 81 ? ? 164.28 -163.10 160 19 ARG A 83 ? ? -47.34 106.10 161 19 SER A 84 ? ? 41.85 90.88 162 20 ASP A 44 ? ? 32.66 69.57 163 20 GLN A 55 ? ? 56.97 -103.44 164 20 ASP A 60 ? ? -140.68 -152.60 165 20 SER A 62 ? ? -84.91 40.28 166 20 ASN A 69 ? ? 41.65 92.06 167 20 ASN A 72 ? ? -38.99 -85.61 168 20 ALA A 74 ? ? 28.36 82.99 169 20 VAL A 81 ? ? 163.26 -155.94 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A ALA 3 ? A ALA 3 4 1 Y 1 A PRO 4 ? A PRO 4 5 1 Y 1 A ALA 5 ? A ALA 5 6 1 Y 1 A GLY 6 ? A GLY 6 7 1 Y 1 A GLY 7 ? A GLY 7 8 1 Y 1 A GLY 8 ? A GLY 8 9 1 Y 1 A GLY 9 ? A GLY 9 10 1 Y 1 A GLU 86 ? A GLU 86 11 1 Y 1 A GLY 87 ? A GLY 87 12 1 Y 1 A PRO 88 ? A PRO 88 13 1 Y 1 A GLU 89 ? A GLU 89 14 1 Y 1 A ASN 90 ? A ASN 90 15 2 Y 1 A MET 1 ? A MET 1 16 2 Y 1 A ALA 2 ? A ALA 2 17 2 Y 1 A ALA 3 ? A ALA 3 18 2 Y 1 A PRO 4 ? A PRO 4 19 2 Y 1 A ALA 5 ? A ALA 5 20 2 Y 1 A GLY 6 ? A GLY 6 21 2 Y 1 A GLY 7 ? A GLY 7 22 2 Y 1 A GLY 8 ? A GLY 8 23 2 Y 1 A GLY 9 ? A GLY 9 24 2 Y 1 A GLU 86 ? A GLU 86 25 2 Y 1 A GLY 87 ? A GLY 87 26 2 Y 1 A PRO 88 ? A PRO 88 27 2 Y 1 A GLU 89 ? A GLU 89 28 2 Y 1 A ASN 90 ? A ASN 90 29 3 Y 1 A MET 1 ? A MET 1 30 3 Y 1 A ALA 2 ? A ALA 2 31 3 Y 1 A ALA 3 ? A ALA 3 32 3 Y 1 A PRO 4 ? A PRO 4 33 3 Y 1 A ALA 5 ? A ALA 5 34 3 Y 1 A GLY 6 ? A GLY 6 35 3 Y 1 A GLY 7 ? A GLY 7 36 3 Y 1 A GLY 8 ? A GLY 8 37 3 Y 1 A GLY 9 ? A GLY 9 38 3 Y 1 A GLU 86 ? A GLU 86 39 3 Y 1 A GLY 87 ? A GLY 87 40 3 Y 1 A PRO 88 ? A PRO 88 41 3 Y 1 A GLU 89 ? A GLU 89 42 3 Y 1 A ASN 90 ? A ASN 90 43 4 Y 1 A MET 1 ? A MET 1 44 4 Y 1 A ALA 2 ? A ALA 2 45 4 Y 1 A ALA 3 ? A ALA 3 46 4 Y 1 A PRO 4 ? A PRO 4 47 4 Y 1 A ALA 5 ? A ALA 5 48 4 Y 1 A GLY 6 ? A GLY 6 49 4 Y 1 A GLY 7 ? A GLY 7 50 4 Y 1 A GLY 8 ? A GLY 8 51 4 Y 1 A GLY 9 ? A GLY 9 52 4 Y 1 A GLU 86 ? A GLU 86 53 4 Y 1 A GLY 87 ? A GLY 87 54 4 Y 1 A PRO 88 ? A PRO 88 55 4 Y 1 A GLU 89 ? A GLU 89 56 4 Y 1 A ASN 90 ? A ASN 90 57 5 Y 1 A MET 1 ? A MET 1 58 5 Y 1 A ALA 2 ? A ALA 2 59 5 Y 1 A ALA 3 ? A ALA 3 60 5 Y 1 A PRO 4 ? A PRO 4 61 5 Y 1 A ALA 5 ? A ALA 5 62 5 Y 1 A GLY 6 ? A GLY 6 63 5 Y 1 A GLY 7 ? A GLY 7 64 5 Y 1 A GLY 8 ? A GLY 8 65 5 Y 1 A GLY 9 ? A GLY 9 66 5 Y 1 A GLU 86 ? A GLU 86 67 5 Y 1 A GLY 87 ? A GLY 87 68 5 Y 1 A PRO 88 ? A PRO 88 69 5 Y 1 A GLU 89 ? A GLU 89 70 5 Y 1 A ASN 90 ? A ASN 90 71 6 Y 1 A MET 1 ? A MET 1 72 6 Y 1 A ALA 2 ? A ALA 2 73 6 Y 1 A ALA 3 ? A ALA 3 74 6 Y 1 A PRO 4 ? A PRO 4 75 6 Y 1 A ALA 5 ? A ALA 5 76 6 Y 1 A GLY 6 ? A GLY 6 77 6 Y 1 A GLY 7 ? A GLY 7 78 6 Y 1 A GLY 8 ? A GLY 8 79 6 Y 1 A GLY 9 ? A GLY 9 80 6 Y 1 A GLU 86 ? A GLU 86 81 6 Y 1 A GLY 87 ? A GLY 87 82 6 Y 1 A PRO 88 ? A PRO 88 83 6 Y 1 A GLU 89 ? A GLU 89 84 6 Y 1 A ASN 90 ? A ASN 90 85 7 Y 1 A MET 1 ? A MET 1 86 7 Y 1 A ALA 2 ? A ALA 2 87 7 Y 1 A ALA 3 ? A ALA 3 88 7 Y 1 A PRO 4 ? A PRO 4 89 7 Y 1 A ALA 5 ? A ALA 5 90 7 Y 1 A GLY 6 ? A GLY 6 91 7 Y 1 A GLY 7 ? A GLY 7 92 7 Y 1 A GLY 8 ? A GLY 8 93 7 Y 1 A GLY 9 ? A GLY 9 94 7 Y 1 A GLU 86 ? A GLU 86 95 7 Y 1 A GLY 87 ? A GLY 87 96 7 Y 1 A PRO 88 ? A PRO 88 97 7 Y 1 A GLU 89 ? A GLU 89 98 7 Y 1 A ASN 90 ? A ASN 90 99 8 Y 1 A MET 1 ? A MET 1 100 8 Y 1 A ALA 2 ? A ALA 2 101 8 Y 1 A ALA 3 ? A ALA 3 102 8 Y 1 A PRO 4 ? A PRO 4 103 8 Y 1 A ALA 5 ? A ALA 5 104 8 Y 1 A GLY 6 ? A GLY 6 105 8 Y 1 A GLY 7 ? A GLY 7 106 8 Y 1 A GLY 8 ? A GLY 8 107 8 Y 1 A GLY 9 ? A GLY 9 108 8 Y 1 A GLU 86 ? A GLU 86 109 8 Y 1 A GLY 87 ? A GLY 87 110 8 Y 1 A PRO 88 ? A PRO 88 111 8 Y 1 A GLU 89 ? A GLU 89 112 8 Y 1 A ASN 90 ? A ASN 90 113 9 Y 1 A MET 1 ? A MET 1 114 9 Y 1 A ALA 2 ? A ALA 2 115 9 Y 1 A ALA 3 ? A ALA 3 116 9 Y 1 A PRO 4 ? A PRO 4 117 9 Y 1 A ALA 5 ? A ALA 5 118 9 Y 1 A GLY 6 ? A GLY 6 119 9 Y 1 A GLY 7 ? A GLY 7 120 9 Y 1 A GLY 8 ? A GLY 8 121 9 Y 1 A GLY 9 ? A GLY 9 122 9 Y 1 A GLU 86 ? A GLU 86 123 9 Y 1 A GLY 87 ? A GLY 87 124 9 Y 1 A PRO 88 ? A PRO 88 125 9 Y 1 A GLU 89 ? A GLU 89 126 9 Y 1 A ASN 90 ? A ASN 90 127 10 Y 1 A MET 1 ? A MET 1 128 10 Y 1 A ALA 2 ? A ALA 2 129 10 Y 1 A ALA 3 ? A ALA 3 130 10 Y 1 A PRO 4 ? A PRO 4 131 10 Y 1 A ALA 5 ? A ALA 5 132 10 Y 1 A GLY 6 ? A GLY 6 133 10 Y 1 A GLY 7 ? A GLY 7 134 10 Y 1 A GLY 8 ? A GLY 8 135 10 Y 1 A GLY 9 ? A GLY 9 136 10 Y 1 A GLU 86 ? A GLU 86 137 10 Y 1 A GLY 87 ? A GLY 87 138 10 Y 1 A PRO 88 ? A PRO 88 139 10 Y 1 A GLU 89 ? A GLU 89 140 10 Y 1 A ASN 90 ? A ASN 90 141 11 Y 1 A MET 1 ? A MET 1 142 11 Y 1 A ALA 2 ? A ALA 2 143 11 Y 1 A ALA 3 ? A ALA 3 144 11 Y 1 A PRO 4 ? A PRO 4 145 11 Y 1 A ALA 5 ? A ALA 5 146 11 Y 1 A GLY 6 ? A GLY 6 147 11 Y 1 A GLY 7 ? A GLY 7 148 11 Y 1 A GLY 8 ? A GLY 8 149 11 Y 1 A GLY 9 ? A GLY 9 150 11 Y 1 A GLU 86 ? A GLU 86 151 11 Y 1 A GLY 87 ? A GLY 87 152 11 Y 1 A PRO 88 ? A PRO 88 153 11 Y 1 A GLU 89 ? A GLU 89 154 11 Y 1 A ASN 90 ? A ASN 90 155 12 Y 1 A MET 1 ? A MET 1 156 12 Y 1 A ALA 2 ? A ALA 2 157 12 Y 1 A ALA 3 ? A ALA 3 158 12 Y 1 A PRO 4 ? A PRO 4 159 12 Y 1 A ALA 5 ? A ALA 5 160 12 Y 1 A GLY 6 ? A GLY 6 161 12 Y 1 A GLY 7 ? A GLY 7 162 12 Y 1 A GLY 8 ? A GLY 8 163 12 Y 1 A GLY 9 ? A GLY 9 164 12 Y 1 A GLU 86 ? A GLU 86 165 12 Y 1 A GLY 87 ? A GLY 87 166 12 Y 1 A PRO 88 ? A PRO 88 167 12 Y 1 A GLU 89 ? A GLU 89 168 12 Y 1 A ASN 90 ? A ASN 90 169 13 Y 1 A MET 1 ? A MET 1 170 13 Y 1 A ALA 2 ? A ALA 2 171 13 Y 1 A ALA 3 ? A ALA 3 172 13 Y 1 A PRO 4 ? A PRO 4 173 13 Y 1 A ALA 5 ? A ALA 5 174 13 Y 1 A GLY 6 ? A GLY 6 175 13 Y 1 A GLY 7 ? A GLY 7 176 13 Y 1 A GLY 8 ? A GLY 8 177 13 Y 1 A GLY 9 ? A GLY 9 178 13 Y 1 A GLU 86 ? A GLU 86 179 13 Y 1 A GLY 87 ? A GLY 87 180 13 Y 1 A PRO 88 ? A PRO 88 181 13 Y 1 A GLU 89 ? A GLU 89 182 13 Y 1 A ASN 90 ? A ASN 90 183 14 Y 1 A MET 1 ? A MET 1 184 14 Y 1 A ALA 2 ? A ALA 2 185 14 Y 1 A ALA 3 ? A ALA 3 186 14 Y 1 A PRO 4 ? A PRO 4 187 14 Y 1 A ALA 5 ? A ALA 5 188 14 Y 1 A GLY 6 ? A GLY 6 189 14 Y 1 A GLY 7 ? A GLY 7 190 14 Y 1 A GLY 8 ? A GLY 8 191 14 Y 1 A GLY 9 ? A GLY 9 192 14 Y 1 A GLU 86 ? A GLU 86 193 14 Y 1 A GLY 87 ? A GLY 87 194 14 Y 1 A PRO 88 ? A PRO 88 195 14 Y 1 A GLU 89 ? A GLU 89 196 14 Y 1 A ASN 90 ? A ASN 90 197 15 Y 1 A MET 1 ? A MET 1 198 15 Y 1 A ALA 2 ? A ALA 2 199 15 Y 1 A ALA 3 ? A ALA 3 200 15 Y 1 A PRO 4 ? A PRO 4 201 15 Y 1 A ALA 5 ? A ALA 5 202 15 Y 1 A GLY 6 ? A GLY 6 203 15 Y 1 A GLY 7 ? A GLY 7 204 15 Y 1 A GLY 8 ? A GLY 8 205 15 Y 1 A GLY 9 ? A GLY 9 206 15 Y 1 A GLU 86 ? A GLU 86 207 15 Y 1 A GLY 87 ? A GLY 87 208 15 Y 1 A PRO 88 ? A PRO 88 209 15 Y 1 A GLU 89 ? A GLU 89 210 15 Y 1 A ASN 90 ? A ASN 90 211 16 Y 1 A MET 1 ? A MET 1 212 16 Y 1 A ALA 2 ? A ALA 2 213 16 Y 1 A ALA 3 ? A ALA 3 214 16 Y 1 A PRO 4 ? A PRO 4 215 16 Y 1 A ALA 5 ? A ALA 5 216 16 Y 1 A GLY 6 ? A GLY 6 217 16 Y 1 A GLY 7 ? A GLY 7 218 16 Y 1 A GLY 8 ? A GLY 8 219 16 Y 1 A GLY 9 ? A GLY 9 220 16 Y 1 A GLU 86 ? A GLU 86 221 16 Y 1 A GLY 87 ? A GLY 87 222 16 Y 1 A PRO 88 ? A PRO 88 223 16 Y 1 A GLU 89 ? A GLU 89 224 16 Y 1 A ASN 90 ? A ASN 90 225 17 Y 1 A MET 1 ? A MET 1 226 17 Y 1 A ALA 2 ? A ALA 2 227 17 Y 1 A ALA 3 ? A ALA 3 228 17 Y 1 A PRO 4 ? A PRO 4 229 17 Y 1 A ALA 5 ? A ALA 5 230 17 Y 1 A GLY 6 ? A GLY 6 231 17 Y 1 A GLY 7 ? A GLY 7 232 17 Y 1 A GLY 8 ? A GLY 8 233 17 Y 1 A GLY 9 ? A GLY 9 234 17 Y 1 A GLU 86 ? A GLU 86 235 17 Y 1 A GLY 87 ? A GLY 87 236 17 Y 1 A PRO 88 ? A PRO 88 237 17 Y 1 A GLU 89 ? A GLU 89 238 17 Y 1 A ASN 90 ? A ASN 90 239 18 Y 1 A MET 1 ? A MET 1 240 18 Y 1 A ALA 2 ? A ALA 2 241 18 Y 1 A ALA 3 ? A ALA 3 242 18 Y 1 A PRO 4 ? A PRO 4 243 18 Y 1 A ALA 5 ? A ALA 5 244 18 Y 1 A GLY 6 ? A GLY 6 245 18 Y 1 A GLY 7 ? A GLY 7 246 18 Y 1 A GLY 8 ? A GLY 8 247 18 Y 1 A GLY 9 ? A GLY 9 248 18 Y 1 A GLU 86 ? A GLU 86 249 18 Y 1 A GLY 87 ? A GLY 87 250 18 Y 1 A PRO 88 ? A PRO 88 251 18 Y 1 A GLU 89 ? A GLU 89 252 18 Y 1 A ASN 90 ? A ASN 90 253 19 Y 1 A MET 1 ? A MET 1 254 19 Y 1 A ALA 2 ? A ALA 2 255 19 Y 1 A ALA 3 ? A ALA 3 256 19 Y 1 A PRO 4 ? A PRO 4 257 19 Y 1 A ALA 5 ? A ALA 5 258 19 Y 1 A GLY 6 ? A GLY 6 259 19 Y 1 A GLY 7 ? A GLY 7 260 19 Y 1 A GLY 8 ? A GLY 8 261 19 Y 1 A GLY 9 ? A GLY 9 262 19 Y 1 A GLU 86 ? A GLU 86 263 19 Y 1 A GLY 87 ? A GLY 87 264 19 Y 1 A PRO 88 ? A PRO 88 265 19 Y 1 A GLU 89 ? A GLU 89 266 19 Y 1 A ASN 90 ? A ASN 90 267 20 Y 1 A MET 1 ? A MET 1 268 20 Y 1 A ALA 2 ? A ALA 2 269 20 Y 1 A ALA 3 ? A ALA 3 270 20 Y 1 A PRO 4 ? A PRO 4 271 20 Y 1 A ALA 5 ? A ALA 5 272 20 Y 1 A GLY 6 ? A GLY 6 273 20 Y 1 A GLY 7 ? A GLY 7 274 20 Y 1 A GLY 8 ? A GLY 8 275 20 Y 1 A GLY 9 ? A GLY 9 276 20 Y 1 A GLU 86 ? A GLU 86 277 20 Y 1 A GLY 87 ? A GLY 87 278 20 Y 1 A PRO 88 ? A PRO 88 279 20 Y 1 A GLU 89 ? A GLU 89 280 20 Y 1 A ASN 90 ? A ASN 90 #