data_2ARW # _entry.id 2ARW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.323 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2ARW RCSB RCSB034240 WWPDB D_1000034240 BMRB 5940 # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 5940 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2ARW _pdbx_database_status.recvd_initial_deposition_date 2005-08-22 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hecht, O.' 1 'Dingley, A.J.' 2 'Schwantner, A.' 3 'Ozbek, S.' 4 'Rose-John, S.' 5 'Grotzinger, J.' 6 # _citation.id primary _citation.title 'The solution structure of the membrane-proximal cytokine receptor domain of the human interleukin-6 receptor' _citation.journal_abbrev Biol.Chem. _citation.journal_volume 387 _citation.page_first 1255 _citation.page_last 1259 _citation.year 2006 _citation.journal_id_ASTM ? _citation.country GE _citation.journal_id_ISSN 1431-6730 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16972794 _citation.pdbx_database_id_DOI 10.1515/BC.2006.155 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hecht, O.' 1 ? primary 'Dingley, A.J.' 2 ? primary 'Schwanter, A.' 3 ? primary 'Ozbek, S.' 4 ? primary 'Rose-John, S.' 5 ? primary 'Grotzinger, J.' 6 ? # _cell.entry_id 2ARW _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2ARW _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Interleukin-6 receptor alpha chain' _entity.formula_weight 14680.381 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Third extracellular domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'IL-6R-alpha, IL-6R 1, CD126 antigen' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVV QLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTT ; _entity_poly.pdbx_seq_one_letter_code_can ;MGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVV QLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 ILE n 1 4 LEU n 1 5 GLN n 1 6 PRO n 1 7 ASP n 1 8 PRO n 1 9 PRO n 1 10 ALA n 1 11 ASN n 1 12 ILE n 1 13 THR n 1 14 VAL n 1 15 THR n 1 16 ALA n 1 17 VAL n 1 18 ALA n 1 19 ARG n 1 20 ASN n 1 21 PRO n 1 22 ARG n 1 23 TRP n 1 24 LEU n 1 25 SER n 1 26 VAL n 1 27 THR n 1 28 TRP n 1 29 GLN n 1 30 ASP n 1 31 PRO n 1 32 HIS n 1 33 SER n 1 34 TRP n 1 35 ASN n 1 36 SER n 1 37 SER n 1 38 PHE n 1 39 TYR n 1 40 ARG n 1 41 LEU n 1 42 ARG n 1 43 PHE n 1 44 GLU n 1 45 LEU n 1 46 ARG n 1 47 TYR n 1 48 ARG n 1 49 ALA n 1 50 GLU n 1 51 ARG n 1 52 SER n 1 53 LYS n 1 54 THR n 1 55 PHE n 1 56 THR n 1 57 THR n 1 58 TRP n 1 59 MET n 1 60 VAL n 1 61 LYS n 1 62 ASP n 1 63 LEU n 1 64 GLN n 1 65 HIS n 1 66 HIS n 1 67 CYS n 1 68 VAL n 1 69 ILE n 1 70 HIS n 1 71 ASP n 1 72 ALA n 1 73 TRP n 1 74 SER n 1 75 GLY n 1 76 LEU n 1 77 ARG n 1 78 HIS n 1 79 VAL n 1 80 VAL n 1 81 GLN n 1 82 LEU n 1 83 ARG n 1 84 ALA n 1 85 GLN n 1 86 GLU n 1 87 GLU n 1 88 PHE n 1 89 GLY n 1 90 GLN n 1 91 GLY n 1 92 GLU n 1 93 TRP n 1 94 SER n 1 95 GLU n 1 96 TRP n 1 97 SER n 1 98 PRO n 1 99 GLU n 1 100 ALA n 1 101 MET n 1 102 GLY n 1 103 THR n 1 104 PRO n 1 105 TRP n 1 106 THR n 1 107 GLU n 1 108 SER n 1 109 ARG n 1 110 SER n 1 111 PRO n 1 112 PRO n 1 113 ALA n 1 114 GLU n 1 115 ASN n 1 116 GLU n 1 117 VAL n 1 118 SER n 1 119 THR n 1 120 PRO n 1 121 MET n 1 122 GLN n 1 123 ALA n 1 124 LEU n 1 125 THR n 1 126 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pRSET 5b' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code IL6RA_HUMAN _struct_ref.pdbx_db_accession P08887 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQ LRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTT ; _struct_ref.pdbx_align_begin 212 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2ARW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 126 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P08887 _struct_ref_seq.db_align_beg 212 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 336 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 126 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2ARW _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P08887 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'initiating methionine' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 'CBCA(CO)NH' 1 2 1 CBCANH 1 3 1 HNCA 1 4 1 3D_15N-separated_NOESY 1 5 1 'HBHA(CBCACO)NH' 1 6 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 5.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50mM phosphate' _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '20mM phosphatebuffer pH 5.0, 95% H2O, 5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 DRX Bruker 600 ? 2 INOVA Varian 600 ? # _pdbx_nmr_refine.entry_id 2ARW _pdbx_nmr_refine.method 'torsion angle dynamicsu' _pdbx_nmr_refine.details 'The structures is based on a total of 932 NOE-derived distance restraints' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2ARW _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2ARW _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'structure solution' DYANA 1.5 Guentert 1 refinement DYANA 1.5 Guentert 2 # _exptl.entry_id 2ARW _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2ARW _struct.title 'The solution structure of the membrane proximal cytokine receptor domain of the human interleukin-6 receptor' _struct.pdbx_descriptor 'Interleukin-6 receptor alpha chain' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 2ARW _struct_keywords.pdbx_keywords CYTOKINE _struct_keywords.text 'fibronectin-type III like, CYTOKINE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 10 ? THR A 15 ? ALA A 10 THR A 15 A 2 SER A 25 ? GLN A 29 ? SER A 25 GLN A 29 A 3 HIS A 66 ? VAL A 68 ? HIS A 66 VAL A 68 B 1 ARG A 46 ? ALA A 49 ? ARG A 46 ALA A 49 B 2 HIS A 78 ? GLN A 81 ? HIS A 78 GLN A 81 B 3 GLU A 99 ? GLY A 102 ? GLU A 99 GLY A 102 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ALA A 10 ? N ALA A 10 O GLN A 29 ? O GLN A 29 A 2 3 N VAL A 26 ? N VAL A 26 O CYS A 67 ? O CYS A 67 B 1 2 N ARG A 46 ? N ARG A 46 O GLN A 81 ? O GLN A 81 B 2 3 N HIS A 78 ? N HIS A 78 O GLY A 102 ? O GLY A 102 # _database_PDB_matrix.entry_id 2ARW _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2ARW _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 TRP 23 23 23 TRP TRP A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 TRP 28 28 28 TRP TRP A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 TRP 34 34 34 TRP TRP A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 TRP 58 58 58 TRP TRP A . n A 1 59 MET 59 59 59 MET MET A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 HIS 65 65 65 HIS HIS A . n A 1 66 HIS 66 66 66 HIS HIS A . n A 1 67 CYS 67 67 67 CYS CYS A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 TRP 73 73 73 TRP TRP A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 HIS 78 78 78 HIS HIS A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 TRP 93 93 93 TRP TRP A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 TRP 96 96 96 TRP TRP A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 PRO 98 98 98 PRO PRO A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 MET 101 101 101 MET MET A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 PRO 104 104 ? ? ? A . n A 1 105 TRP 105 105 ? ? ? A . n A 1 106 THR 106 106 ? ? ? A . n A 1 107 GLU 107 107 ? ? ? A . n A 1 108 SER 108 108 ? ? ? A . n A 1 109 ARG 109 109 ? ? ? A . n A 1 110 SER 110 110 ? ? ? A . n A 1 111 PRO 111 111 ? ? ? A . n A 1 112 PRO 112 112 ? ? ? A . n A 1 113 ALA 113 113 ? ? ? A . n A 1 114 GLU 114 114 ? ? ? A . n A 1 115 ASN 115 115 ? ? ? A . n A 1 116 GLU 116 116 ? ? ? A . n A 1 117 VAL 117 117 ? ? ? A . n A 1 118 SER 118 118 ? ? ? A . n A 1 119 THR 119 119 ? ? ? A . n A 1 120 PRO 120 120 ? ? ? A . n A 1 121 MET 121 121 ? ? ? A . n A 1 122 GLN 122 122 ? ? ? A . n A 1 123 ALA 123 123 ? ? ? A . n A 1 124 LEU 124 124 ? ? ? A . n A 1 125 THR 125 125 ? ? ? A . n A 1 126 THR 126 126 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-09-12 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2020-02-26 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.status_code_cs' 2 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 TYR _pdbx_validate_rmsd_angle.auth_seq_id_1 47 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CG _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 TYR _pdbx_validate_rmsd_angle.auth_seq_id_2 47 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CD2 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 TYR _pdbx_validate_rmsd_angle.auth_seq_id_3 47 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 117.01 _pdbx_validate_rmsd_angle.angle_target_value 121.00 _pdbx_validate_rmsd_angle.angle_deviation -3.99 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.60 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 5 ? ? -11.35 92.48 2 1 ILE A 12 ? ? -60.98 94.96 3 1 VAL A 17 ? ? 58.73 144.70 4 1 ARG A 19 ? ? 79.40 -24.60 5 1 ASN A 20 ? ? -38.20 135.16 6 1 ASP A 30 ? ? -28.93 152.01 7 1 PRO A 31 ? ? -58.22 108.88 8 1 SER A 36 ? ? 69.61 -18.53 9 1 SER A 37 ? ? -70.13 33.57 10 1 PHE A 38 ? ? -168.72 -55.09 11 1 LEU A 45 ? ? -159.99 41.58 12 1 ARG A 48 ? ? -175.44 121.53 13 1 VAL A 60 ? ? -10.77 85.00 14 1 LYS A 61 ? ? 13.90 77.19 15 1 ASP A 62 ? ? 78.37 -62.08 16 1 LEU A 63 ? ? 178.55 104.75 17 1 HIS A 65 ? ? -75.58 20.29 18 1 HIS A 66 ? ? 179.36 115.24 19 1 CYS A 67 ? ? -140.58 -159.91 20 1 ILE A 69 ? ? -37.63 -26.09 21 1 HIS A 70 ? ? 46.68 -37.62 22 1 SER A 74 ? ? -4.97 -128.36 23 1 GLN A 85 ? ? -76.73 -120.23 24 1 GLU A 86 ? ? -174.19 139.78 25 1 GLU A 87 ? ? -73.64 38.38 26 1 PHE A 88 ? ? 177.66 -26.79 27 1 GLN A 90 ? ? -91.74 -108.99 28 1 GLU A 92 ? ? -175.79 149.91 29 1 TRP A 96 ? ? 62.57 146.86 # loop_ _pdbx_validate_main_chain_plane.id _pdbx_validate_main_chain_plane.PDB_model_num _pdbx_validate_main_chain_plane.auth_comp_id _pdbx_validate_main_chain_plane.auth_asym_id _pdbx_validate_main_chain_plane.auth_seq_id _pdbx_validate_main_chain_plane.PDB_ins_code _pdbx_validate_main_chain_plane.label_alt_id _pdbx_validate_main_chain_plane.improper_torsion_angle 1 1 ALA A 18 ? ? 10.53 2 1 THR A 56 ? ? 14.83 3 1 LEU A 63 ? ? 10.96 4 1 ALA A 84 ? ? 11.72 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 19 ? ? 0.137 'SIDE CHAIN' 2 1 TYR A 47 ? ? 0.089 'SIDE CHAIN' 3 1 PHE A 55 ? ? 0.103 'SIDE CHAIN' 4 1 HIS A 78 ? ? 0.091 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A PRO 104 ? A PRO 104 2 1 Y 1 A TRP 105 ? A TRP 105 3 1 Y 1 A THR 106 ? A THR 106 4 1 Y 1 A GLU 107 ? A GLU 107 5 1 Y 1 A SER 108 ? A SER 108 6 1 Y 1 A ARG 109 ? A ARG 109 7 1 Y 1 A SER 110 ? A SER 110 8 1 Y 1 A PRO 111 ? A PRO 111 9 1 Y 1 A PRO 112 ? A PRO 112 10 1 Y 1 A ALA 113 ? A ALA 113 11 1 Y 1 A GLU 114 ? A GLU 114 12 1 Y 1 A ASN 115 ? A ASN 115 13 1 Y 1 A GLU 116 ? A GLU 116 14 1 Y 1 A VAL 117 ? A VAL 117 15 1 Y 1 A SER 118 ? A SER 118 16 1 Y 1 A THR 119 ? A THR 119 17 1 Y 1 A PRO 120 ? A PRO 120 18 1 Y 1 A MET 121 ? A MET 121 19 1 Y 1 A GLN 122 ? A GLN 122 20 1 Y 1 A ALA 123 ? A ALA 123 21 1 Y 1 A LEU 124 ? A LEU 124 22 1 Y 1 A THR 125 ? A THR 125 23 1 Y 1 A THR 126 ? A THR 126 #