data_2AS1 # _entry.id 2AS1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2AS1 pdb_00002as1 10.2210/pdb2as1/pdb RCSB RCSB034245 ? ? WWPDB D_1000034245 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1AA4 'apo structure' unspecified PDB 2ANZ 'same protein, different ligand' unspecified PDB 2AQD 'same protein, different ligand' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2AS1 _pdbx_database_status.recvd_initial_deposition_date 2005-08-22 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Brenk, R.' 1 'Vetter, S.W.' 2 'Boyce, S.E.' 3 'Goodin, D.B.' 4 'Shoichet, B.K.' 5 # _citation.id primary _citation.title 'Probing molecular docking in a charged model binding site.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 357 _citation.page_first 1449 _citation.page_last 1470 _citation.year 2006 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16490206 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2006.01.034 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Brenk, R.' 1 ? primary 'Vetter, S.W.' 2 ? primary 'Boyce, S.E.' 3 ? primary 'Goodin, D.B.' 4 ? primary 'Shoichet, B.K.' 5 ? # _cell.entry_id 2AS1 _cell.length_a 51.076 _cell.length_b 76.023 _cell.length_c 107.164 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2AS1 _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cytochrome c peroxidase, mitochondrial' 33458.258 1 1.11.1.5 W191G 'cytochrome c peroxidase' ? 2 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487 1 ? ? ? ? 3 non-polymer syn THIOPHENE-3-CARBOXIMIDAMIDE 126.180 1 ? ? ? ? 4 water nat water 18.015 373 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name CCP # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKTLVHVASVEKGRSYEDFQKVYNAIALKLREDDEYDNYIGYGPVLVRLAWHISGTWDKHDNTGGSYGGTYRFKKEFNDP SNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCGRVDTPEDTTPDNGRLPDADKDAGYVRTFFQR LNMNDREVVALMGAHALGKTHLKNSGYEGPGGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGYMMLPTDYSLIQ DPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKDAPSPFIFKTLEEQGL ; _entity_poly.pdbx_seq_one_letter_code_can ;MKTLVHVASVEKGRSYEDFQKVYNAIALKLREDDEYDNYIGYGPVLVRLAWHISGTWDKHDNTGGSYGGTYRFKKEFNDP SNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCGRVDTPEDTTPDNGRLPDADKDAGYVRTFFQR LNMNDREVVALMGAHALGKTHLKNSGYEGPGGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGYMMLPTDYSLIQ DPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKDAPSPFIFKTLEEQGL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 THR n 1 4 LEU n 1 5 VAL n 1 6 HIS n 1 7 VAL n 1 8 ALA n 1 9 SER n 1 10 VAL n 1 11 GLU n 1 12 LYS n 1 13 GLY n 1 14 ARG n 1 15 SER n 1 16 TYR n 1 17 GLU n 1 18 ASP n 1 19 PHE n 1 20 GLN n 1 21 LYS n 1 22 VAL n 1 23 TYR n 1 24 ASN n 1 25 ALA n 1 26 ILE n 1 27 ALA n 1 28 LEU n 1 29 LYS n 1 30 LEU n 1 31 ARG n 1 32 GLU n 1 33 ASP n 1 34 ASP n 1 35 GLU n 1 36 TYR n 1 37 ASP n 1 38 ASN n 1 39 TYR n 1 40 ILE n 1 41 GLY n 1 42 TYR n 1 43 GLY n 1 44 PRO n 1 45 VAL n 1 46 LEU n 1 47 VAL n 1 48 ARG n 1 49 LEU n 1 50 ALA n 1 51 TRP n 1 52 HIS n 1 53 ILE n 1 54 SER n 1 55 GLY n 1 56 THR n 1 57 TRP n 1 58 ASP n 1 59 LYS n 1 60 HIS n 1 61 ASP n 1 62 ASN n 1 63 THR n 1 64 GLY n 1 65 GLY n 1 66 SER n 1 67 TYR n 1 68 GLY n 1 69 GLY n 1 70 THR n 1 71 TYR n 1 72 ARG n 1 73 PHE n 1 74 LYS n 1 75 LYS n 1 76 GLU n 1 77 PHE n 1 78 ASN n 1 79 ASP n 1 80 PRO n 1 81 SER n 1 82 ASN n 1 83 ALA n 1 84 GLY n 1 85 LEU n 1 86 GLN n 1 87 ASN n 1 88 GLY n 1 89 PHE n 1 90 LYS n 1 91 PHE n 1 92 LEU n 1 93 GLU n 1 94 PRO n 1 95 ILE n 1 96 HIS n 1 97 LYS n 1 98 GLU n 1 99 PHE n 1 100 PRO n 1 101 TRP n 1 102 ILE n 1 103 SER n 1 104 SER n 1 105 GLY n 1 106 ASP n 1 107 LEU n 1 108 PHE n 1 109 SER n 1 110 LEU n 1 111 GLY n 1 112 GLY n 1 113 VAL n 1 114 THR n 1 115 ALA n 1 116 VAL n 1 117 GLN n 1 118 GLU n 1 119 MET n 1 120 GLN n 1 121 GLY n 1 122 PRO n 1 123 LYS n 1 124 ILE n 1 125 PRO n 1 126 TRP n 1 127 ARG n 1 128 CYS n 1 129 GLY n 1 130 ARG n 1 131 VAL n 1 132 ASP n 1 133 THR n 1 134 PRO n 1 135 GLU n 1 136 ASP n 1 137 THR n 1 138 THR n 1 139 PRO n 1 140 ASP n 1 141 ASN n 1 142 GLY n 1 143 ARG n 1 144 LEU n 1 145 PRO n 1 146 ASP n 1 147 ALA n 1 148 ASP n 1 149 LYS n 1 150 ASP n 1 151 ALA n 1 152 GLY n 1 153 TYR n 1 154 VAL n 1 155 ARG n 1 156 THR n 1 157 PHE n 1 158 PHE n 1 159 GLN n 1 160 ARG n 1 161 LEU n 1 162 ASN n 1 163 MET n 1 164 ASN n 1 165 ASP n 1 166 ARG n 1 167 GLU n 1 168 VAL n 1 169 VAL n 1 170 ALA n 1 171 LEU n 1 172 MET n 1 173 GLY n 1 174 ALA n 1 175 HIS n 1 176 ALA n 1 177 LEU n 1 178 GLY n 1 179 LYS n 1 180 THR n 1 181 HIS n 1 182 LEU n 1 183 LYS n 1 184 ASN n 1 185 SER n 1 186 GLY n 1 187 TYR n 1 188 GLU n 1 189 GLY n 1 190 PRO n 1 191 GLY n 1 192 GLY n 1 193 ALA n 1 194 ALA n 1 195 ASN n 1 196 ASN n 1 197 VAL n 1 198 PHE n 1 199 THR n 1 200 ASN n 1 201 GLU n 1 202 PHE n 1 203 TYR n 1 204 LEU n 1 205 ASN n 1 206 LEU n 1 207 LEU n 1 208 ASN n 1 209 GLU n 1 210 ASP n 1 211 TRP n 1 212 LYS n 1 213 LEU n 1 214 GLU n 1 215 LYS n 1 216 ASN n 1 217 ASP n 1 218 ALA n 1 219 ASN n 1 220 ASN n 1 221 GLU n 1 222 GLN n 1 223 TRP n 1 224 ASP n 1 225 SER n 1 226 LYS n 1 227 SER n 1 228 GLY n 1 229 TYR n 1 230 MET n 1 231 MET n 1 232 LEU n 1 233 PRO n 1 234 THR n 1 235 ASP n 1 236 TYR n 1 237 SER n 1 238 LEU n 1 239 ILE n 1 240 GLN n 1 241 ASP n 1 242 PRO n 1 243 LYS n 1 244 TYR n 1 245 LEU n 1 246 SER n 1 247 ILE n 1 248 VAL n 1 249 LYS n 1 250 GLU n 1 251 TYR n 1 252 ALA n 1 253 ASN n 1 254 ASP n 1 255 GLN n 1 256 ASP n 1 257 LYS n 1 258 PHE n 1 259 PHE n 1 260 LYS n 1 261 ASP n 1 262 PHE n 1 263 SER n 1 264 LYS n 1 265 ALA n 1 266 PHE n 1 267 GLU n 1 268 LYS n 1 269 LEU n 1 270 LEU n 1 271 GLU n 1 272 ASN n 1 273 GLY n 1 274 ILE n 1 275 THR n 1 276 PHE n 1 277 PRO n 1 278 LYS n 1 279 ASP n 1 280 ALA n 1 281 PRO n 1 282 SER n 1 283 PRO n 1 284 PHE n 1 285 ILE n 1 286 PHE n 1 287 LYS n 1 288 THR n 1 289 LEU n 1 290 GLU n 1 291 GLU n 1 292 GLN n 1 293 GLY n 1 294 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;baker's yeast ; _entity_src_gen.gene_src_genus Saccharomyces _entity_src_gen.pdbx_gene_src_gene 'CCP1, CCP, CPO' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PT7CCP _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CCPR_YEAST _struct_ref.pdbx_db_accession P00431 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 71 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2AS1 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 294 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00431 _struct_ref_seq.db_align_beg 71 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 361 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 294 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2AS1 MET A 1 ? UNP P00431 ? ? 'cloning artifact' 1 1 1 2AS1 LYS A 2 ? UNP P00431 ? ? 'cloning artifact' 2 2 1 2AS1 THR A 3 ? UNP P00431 ? ? 'cloning artifact' 3 3 1 2AS1 ILE A 53 ? UNP P00431 THR 120 conflict 53 4 1 2AS1 GLY A 152 ? UNP P00431 ASP 219 conflict 152 5 1 2AS1 GLY A 191 ? UNP P00431 TRP 258 'engineered mutation' 191 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEM non-polymer . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TP5 non-polymer . THIOPHENE-3-CARBOXIMIDAMIDE ? 'C5 H6 N2 S' 126.180 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2AS1 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.11 _exptl_crystal.density_percent_sol 60.19 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pdbx_details 'MPD, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2005-04-10 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Double crystal' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.03313 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ALS BEAMLINE 8.3.1' _diffrn_source.pdbx_synchrotron_site ALS _diffrn_source.pdbx_synchrotron_beamline 8.3.1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.03313 # _reflns.entry_id 2AS1 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.d_resolution_high 1.55 _reflns.d_resolution_low 40.0 _reflns.number_all 61589 _reflns.number_obs 61090 _reflns.percent_possible_obs 99.3 _reflns.pdbx_Rmerge_I_obs 0.041 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 23.2 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.55 _reflns_shell.d_res_low 1.61 _reflns_shell.percent_possible_all 98.0 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 2AS1 _refine.ls_number_reflns_obs 55415 _refine.ls_number_reflns_all 58544 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 10.00 _refine.ls_d_res_high 1.55 _refine.ls_percent_reflns_obs 90.4 _refine.ls_R_factor_obs 0.152 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.152 _refine.ls_R_factor_R_free 0.1995 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 2927 _refine.ls_number_parameters 22594 _refine.ls_number_restraints 27425 _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method 'FREE R' _refine.details 'ANISOTROPIC REFINEMENT REDUCED FREE R (NO CUTOFF) BY 2.5 % and R WORK BY 3 %' _refine.pdbx_starting_model 1AC4 _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 2AS1 _refine_analyze.Luzzati_coordinate_error_obs ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues 1 _refine_analyze.occupancy_sum_hydrogen 0.00 _refine_analyze.occupancy_sum_non_hydrogen 2714.00 _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2291 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 51 _refine_hist.number_atoms_solvent 373 _refine_hist.number_atoms_total 2715 _refine_hist.d_res_high 1.55 _refine_hist.d_res_low 10.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function s_bond_d 0.004 ? ? ? 'X-RAY DIFFRACTION' ? s_angle_d 0.013 ? ? ? 'X-RAY DIFFRACTION' ? s_similar_dist 0.000 ? ? ? 'X-RAY DIFFRACTION' ? s_from_restr_planes 0.0290 ? ? ? 'X-RAY DIFFRACTION' ? s_zero_chiral_vol 0.065 ? ? ? 'X-RAY DIFFRACTION' ? s_non_zero_chiral_vol 0.056 ? ? ? 'X-RAY DIFFRACTION' ? s_anti_bump_dis_restr 0.010 ? ? ? 'X-RAY DIFFRACTION' ? s_rigid_bond_adp_cmpnt 0.003 ? ? ? 'X-RAY DIFFRACTION' ? s_similar_adp_cmpnt 0.043 ? ? ? 'X-RAY DIFFRACTION' ? s_approx_iso_adps 0.000 ? ? ? 'X-RAY DIFFRACTION' ? # _pdbx_refine.entry_id 2AS1 _pdbx_refine.R_factor_all_no_cutoff 0.152 _pdbx_refine.R_factor_obs_no_cutoff ? _pdbx_refine.free_R_factor_no_cutoff ? _pdbx_refine.free_R_val_test_set_size_perc_no_cutoff ? _pdbx_refine.free_R_val_test_set_ct_no_cutoff ? _pdbx_refine.R_factor_all_4sig_cutoff 0.1422 _pdbx_refine.R_factor_obs_4sig_cutoff ? _pdbx_refine.free_R_factor_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_ct_4sig_cutoff ? _pdbx_refine.number_reflns_obs_4sig_cutoff 46476 _pdbx_refine.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine.free_R_error_no_cutoff ? # _struct.entry_id 2AS1 _struct.title 'cytochrome c peroxidase in complex with thiopheneamidine' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2AS1 _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'oxidureductase, peroxidase, model binding site, Oxidoreductase' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 15 ? ASP A 33 ? SER A 15 ASP A 33 1 ? 19 HELX_P HELX_P2 2 GLU A 35 ? ILE A 40 ? GLU A 35 ILE A 40 1 ? 6 HELX_P HELX_P3 3 TYR A 42 ? GLY A 55 ? TYR A 42 GLY A 55 1 ? 14 HELX_P HELX_P4 4 GLY A 69 ? ARG A 72 ? GLY A 69 ARG A 72 5 ? 4 HELX_P HELX_P5 5 PHE A 73 ? ASN A 78 ? PHE A 73 ASN A 78 1 ? 6 HELX_P HELX_P6 6 ASP A 79 ? GLY A 84 ? ASP A 79 GLY A 84 5 ? 6 HELX_P HELX_P7 7 LEU A 85 ? PHE A 99 ? LEU A 85 PHE A 99 1 ? 15 HELX_P HELX_P8 8 SER A 103 ? MET A 119 ? SER A 103 MET A 119 1 ? 17 HELX_P HELX_P9 9 PRO A 134 ? THR A 138 ? PRO A 134 THR A 138 5 ? 5 HELX_P HELX_P10 10 ASP A 150 ? ARG A 160 ? ASP A 150 ARG A 160 1 ? 11 HELX_P HELX_P11 11 ASN A 164 ? GLY A 173 ? ASN A 164 GLY A 173 1 ? 10 HELX_P HELX_P12 12 ALA A 174 ? LEU A 177 ? ALA A 174 LEU A 177 5 ? 4 HELX_P HELX_P13 13 HIS A 181 ? GLY A 186 ? HIS A 181 GLY A 186 1 ? 6 HELX_P HELX_P14 14 ASN A 200 ? GLU A 209 ? ASN A 200 GLU A 209 1 ? 10 HELX_P HELX_P15 15 LEU A 232 ? ASP A 241 ? LEU A 232 ASP A 241 1 ? 10 HELX_P HELX_P16 16 ASP A 241 ? ASN A 253 ? ASP A 241 ASN A 253 1 ? 13 HELX_P HELX_P17 17 ASP A 254 ? ASN A 272 ? ASP A 254 ASN A 272 1 ? 19 HELX_P HELX_P18 18 THR A 288 ? GLY A 293 ? THR A 288 GLY A 293 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 175 NE2 ? ? ? 1_555 B HEM . FE ? ? A HIS 175 A HEM 400 1_555 ? ? ? ? ? ? ? 2.067 ? ? metalc2 metalc ? ? B HEM . FE ? ? ? 1_555 D HOH . O ? ? A HEM 400 A HOH 1415 1_555 ? ? ? ? ? ? ? 2.244 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? C ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 HIS A 6 ? VAL A 7 ? HIS A 6 VAL A 7 A 2 ILE A 274 ? THR A 275 ? ILE A 274 THR A 275 B 1 LYS A 179 ? THR A 180 ? LYS A 179 THR A 180 B 2 GLY A 189 ? PRO A 190 ? GLY A 189 PRO A 190 C 1 LYS A 212 ? LYS A 215 ? LYS A 212 LYS A 215 C 2 GLU A 221 ? ASP A 224 ? GLU A 221 ASP A 224 C 3 MET A 230 ? MET A 231 ? MET A 230 MET A 231 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N HIS A 6 ? N HIS A 6 O THR A 275 ? O THR A 275 B 1 2 N THR A 180 ? N THR A 180 O GLY A 189 ? O GLY A 189 C 1 2 N LYS A 212 ? N LYS A 212 O ASP A 224 ? O ASP A 224 C 2 3 N TRP A 223 ? N TRP A 223 O MET A 231 ? O MET A 231 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A HEM 400 ? 23 'BINDING SITE FOR RESIDUE HEM A 400' AC2 Software A TP5 500 ? 9 'BINDING SITE FOR RESIDUE TP5 A 500' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 23 PRO A 44 ? PRO A 44 . ? 1_555 ? 2 AC1 23 VAL A 45 ? VAL A 45 . ? 1_555 ? 3 AC1 23 ARG A 48 ? ARG A 48 . ? 1_555 ? 4 AC1 23 TRP A 51 ? TRP A 51 . ? 1_555 ? 5 AC1 23 PRO A 145 ? PRO A 145 . ? 1_555 ? 6 AC1 23 ASP A 146 ? ASP A 146 . ? 1_555 ? 7 AC1 23 LEU A 171 ? LEU A 171 . ? 1_555 ? 8 AC1 23 MET A 172 ? MET A 172 . ? 1_555 ? 9 AC1 23 ALA A 174 ? ALA A 174 . ? 1_555 ? 10 AC1 23 HIS A 175 ? HIS A 175 . ? 1_555 ? 11 AC1 23 GLY A 178 ? GLY A 178 . ? 1_555 ? 12 AC1 23 LYS A 179 ? LYS A 179 . ? 1_555 ? 13 AC1 23 THR A 180 ? THR A 180 . ? 1_555 ? 14 AC1 23 HIS A 181 ? HIS A 181 . ? 1_555 ? 15 AC1 23 ASN A 184 ? ASN A 184 . ? 1_555 ? 16 AC1 23 SER A 185 ? SER A 185 . ? 1_555 ? 17 AC1 23 LEU A 232 ? LEU A 232 . ? 1_555 ? 18 AC1 23 TP5 C . ? TP5 A 500 . ? 1_555 ? 19 AC1 23 HOH D . ? HOH A 1121 . ? 1_555 ? 20 AC1 23 HOH D . ? HOH A 1136 . ? 1_555 ? 21 AC1 23 HOH D . ? HOH A 1161 . ? 1_555 ? 22 AC1 23 HOH D . ? HOH A 1200 . ? 1_555 ? 23 AC1 23 HOH D . ? HOH A 1415 . ? 1_555 ? 24 AC2 9 HIS A 175 ? HIS A 175 . ? 1_555 ? 25 AC2 9 THR A 180 ? THR A 180 . ? 1_555 ? 26 AC2 9 GLY A 189 ? GLY A 189 . ? 1_555 ? 27 AC2 9 PRO A 190 ? PRO A 190 . ? 1_555 ? 28 AC2 9 GLY A 191 ? GLY A 191 . ? 1_555 ? 29 AC2 9 MET A 230 ? MET A 230 . ? 1_555 ? 30 AC2 9 MET A 231 ? MET A 231 . ? 1_555 ? 31 AC2 9 ASP A 235 ? ASP A 235 . ? 1_555 ? 32 AC2 9 HEM B . ? HEM A 400 . ? 1_555 ? # _database_PDB_matrix.entry_id 2AS1 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.000000 _database_PDB_matrix.origx_vector[2] 0.000000 _database_PDB_matrix.origx_vector[3] 0.000000 # _atom_sites.entry_id 2AS1 _atom_sites.fract_transf_matrix[1][1] 0.019579 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013154 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009331 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C FE N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 LYS 2 2 ? ? ? A . n A 1 3 THR 3 3 ? ? ? A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 TRP 51 51 51 TRP TRP A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 TRP 57 57 57 TRP TRP A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 TRP 101 101 101 TRP TRP A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 GLN 117 117 117 GLN GLN A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 MET 119 119 119 MET MET A . n A 1 120 GLN 120 120 120 GLN GLN A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 PRO 122 122 122 PRO PRO A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 PRO 125 125 125 PRO PRO A . n A 1 126 TRP 126 126 126 TRP TRP A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 CYS 128 128 128 CYS CYS A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 ARG 130 130 130 ARG ARG A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 ASP 132 132 132 ASP ASP A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 PRO 134 134 134 PRO PRO A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 ASP 136 136 136 ASP ASP A . n A 1 137 THR 137 137 137 THR THR A . n A 1 138 THR 138 138 138 THR THR A . n A 1 139 PRO 139 139 139 PRO PRO A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 ASN 141 141 141 ASN ASN A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 ARG 143 143 143 ARG ARG A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 PRO 145 145 145 PRO PRO A . n A 1 146 ASP 146 146 146 ASP ASP A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 ASP 148 148 148 ASP ASP A . n A 1 149 LYS 149 149 149 LYS LYS A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 GLY 152 152 152 GLY GLY A . n A 1 153 TYR 153 153 153 TYR TYR A . n A 1 154 VAL 154 154 154 VAL VAL A . n A 1 155 ARG 155 155 155 ARG ARG A . n A 1 156 THR 156 156 156 THR THR A . n A 1 157 PHE 157 157 157 PHE PHE A . n A 1 158 PHE 158 158 158 PHE PHE A . n A 1 159 GLN 159 159 159 GLN GLN A . n A 1 160 ARG 160 160 160 ARG ARG A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 ASN 162 162 162 ASN ASN A . n A 1 163 MET 163 163 163 MET MET A . n A 1 164 ASN 164 164 164 ASN ASN A . n A 1 165 ASP 165 165 165 ASP ASP A . n A 1 166 ARG 166 166 166 ARG ARG A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 VAL 168 168 168 VAL VAL A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 ALA 170 170 170 ALA ALA A . n A 1 171 LEU 171 171 171 LEU LEU A . n A 1 172 MET 172 172 172 MET MET A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 ALA 174 174 174 ALA ALA A . n A 1 175 HIS 175 175 175 HIS HIS A . n A 1 176 ALA 176 176 176 ALA ALA A . n A 1 177 LEU 177 177 177 LEU LEU A . n A 1 178 GLY 178 178 178 GLY GLY A . n A 1 179 LYS 179 179 179 LYS LYS A . n A 1 180 THR 180 180 180 THR THR A . n A 1 181 HIS 181 181 181 HIS HIS A . n A 1 182 LEU 182 182 182 LEU LEU A . n A 1 183 LYS 183 183 183 LYS LYS A . n A 1 184 ASN 184 184 184 ASN ASN A . n A 1 185 SER 185 185 185 SER SER A . n A 1 186 GLY 186 186 186 GLY GLY A . n A 1 187 TYR 187 187 187 TYR TYR A . n A 1 188 GLU 188 188 188 GLU GLU A . n A 1 189 GLY 189 189 189 GLY GLY A . n A 1 190 PRO 190 190 190 PRO PRO A . n A 1 191 GLY 191 191 191 GLY GLY A . n A 1 192 GLY 192 192 192 GLY GLY A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 ALA 194 194 194 ALA ALA A . n A 1 195 ASN 195 195 195 ASN ASN A . n A 1 196 ASN 196 196 196 ASN ASN A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 PHE 198 198 198 PHE PHE A . n A 1 199 THR 199 199 199 THR THR A . n A 1 200 ASN 200 200 200 ASN ASN A . n A 1 201 GLU 201 201 201 GLU GLU A . n A 1 202 PHE 202 202 202 PHE PHE A . n A 1 203 TYR 203 203 203 TYR TYR A . n A 1 204 LEU 204 204 204 LEU LEU A . n A 1 205 ASN 205 205 205 ASN ASN A . n A 1 206 LEU 206 206 206 LEU LEU A . n A 1 207 LEU 207 207 207 LEU LEU A . n A 1 208 ASN 208 208 208 ASN ASN A . n A 1 209 GLU 209 209 209 GLU GLU A . n A 1 210 ASP 210 210 210 ASP ASP A . n A 1 211 TRP 211 211 211 TRP TRP A . n A 1 212 LYS 212 212 212 LYS LYS A . n A 1 213 LEU 213 213 213 LEU LEU A . n A 1 214 GLU 214 214 214 GLU GLU A . n A 1 215 LYS 215 215 215 LYS LYS A . n A 1 216 ASN 216 216 216 ASN ASN A . n A 1 217 ASP 217 217 217 ASP ASP A . n A 1 218 ALA 218 218 218 ALA ALA A . n A 1 219 ASN 219 219 219 ASN ASN A . n A 1 220 ASN 220 220 220 ASN ASN A . n A 1 221 GLU 221 221 221 GLU GLU A . n A 1 222 GLN 222 222 222 GLN GLN A . n A 1 223 TRP 223 223 223 TRP TRP A . n A 1 224 ASP 224 224 224 ASP ASP A . n A 1 225 SER 225 225 225 SER SER A . n A 1 226 LYS 226 226 226 LYS LYS A . n A 1 227 SER 227 227 227 SER SER A . n A 1 228 GLY 228 228 228 GLY GLY A . n A 1 229 TYR 229 229 229 TYR TYR A . n A 1 230 MET 230 230 230 MET MET A . n A 1 231 MET 231 231 231 MET MET A . n A 1 232 LEU 232 232 232 LEU LEU A . n A 1 233 PRO 233 233 233 PRO PRO A . n A 1 234 THR 234 234 234 THR THR A . n A 1 235 ASP 235 235 235 ASP ASP A . n A 1 236 TYR 236 236 236 TYR TYR A . n A 1 237 SER 237 237 237 SER SER A . n A 1 238 LEU 238 238 238 LEU LEU A . n A 1 239 ILE 239 239 239 ILE ILE A . n A 1 240 GLN 240 240 240 GLN GLN A . n A 1 241 ASP 241 241 241 ASP ASP A . n A 1 242 PRO 242 242 242 PRO PRO A . n A 1 243 LYS 243 243 243 LYS LYS A . n A 1 244 TYR 244 244 244 TYR TYR A . n A 1 245 LEU 245 245 245 LEU LEU A . n A 1 246 SER 246 246 246 SER SER A . n A 1 247 ILE 247 247 247 ILE ILE A . n A 1 248 VAL 248 248 248 VAL VAL A . n A 1 249 LYS 249 249 249 LYS LYS A . n A 1 250 GLU 250 250 250 GLU GLU A . n A 1 251 TYR 251 251 251 TYR TYR A . n A 1 252 ALA 252 252 252 ALA ALA A . n A 1 253 ASN 253 253 253 ASN ASN A . n A 1 254 ASP 254 254 254 ASP ASP A . n A 1 255 GLN 255 255 255 GLN GLN A . n A 1 256 ASP 256 256 256 ASP ASP A . n A 1 257 LYS 257 257 257 LYS LYS A . n A 1 258 PHE 258 258 258 PHE PHE A . n A 1 259 PHE 259 259 259 PHE PHE A . n A 1 260 LYS 260 260 260 LYS LYS A . n A 1 261 ASP 261 261 261 ASP ASP A . n A 1 262 PHE 262 262 262 PHE PHE A . n A 1 263 SER 263 263 263 SER SER A . n A 1 264 LYS 264 264 264 LYS LYS A . n A 1 265 ALA 265 265 265 ALA ALA A . n A 1 266 PHE 266 266 266 PHE PHE A . n A 1 267 GLU 267 267 267 GLU GLU A . n A 1 268 LYS 268 268 268 LYS LYS A . n A 1 269 LEU 269 269 269 LEU LEU A . n A 1 270 LEU 270 270 270 LEU LEU A . n A 1 271 GLU 271 271 271 GLU GLU A . n A 1 272 ASN 272 272 272 ASN ASN A . n A 1 273 GLY 273 273 273 GLY GLY A . n A 1 274 ILE 274 274 274 ILE ILE A . n A 1 275 THR 275 275 275 THR THR A . n A 1 276 PHE 276 276 276 PHE PHE A . n A 1 277 PRO 277 277 277 PRO PRO A . n A 1 278 LYS 278 278 278 LYS LYS A . n A 1 279 ASP 279 279 279 ASP ASP A . n A 1 280 ALA 280 280 280 ALA ALA A . n A 1 281 PRO 281 281 281 PRO PRO A . n A 1 282 SER 282 282 282 SER SER A . n A 1 283 PRO 283 283 283 PRO PRO A . n A 1 284 PHE 284 284 284 PHE PHE A . n A 1 285 ILE 285 285 285 ILE ILE A . n A 1 286 PHE 286 286 286 PHE PHE A . n A 1 287 LYS 287 287 287 LYS LYS A . n A 1 288 THR 288 288 288 THR THR A . n A 1 289 LEU 289 289 289 LEU LEU A . n A 1 290 GLU 290 290 290 GLU GLU A . n A 1 291 GLU 291 291 291 GLU GLU A . n A 1 292 GLN 292 292 292 GLN GLN A . n A 1 293 GLY 293 293 293 GLY GLY A . n A 1 294 LEU 294 294 294 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HEM 1 400 400 HEM HEM A . C 3 TP5 1 500 500 TP5 TPC A . D 4 HOH 1 1000 1000 HOH TIP A . D 4 HOH 2 1100 1100 HOH TIP A . D 4 HOH 3 1101 1101 HOH TIP A . D 4 HOH 4 1102 1102 HOH TIP A . D 4 HOH 5 1103 1103 HOH TIP A . D 4 HOH 6 1104 1104 HOH TIP A . D 4 HOH 7 1105 1105 HOH TIP A . D 4 HOH 8 1106 1106 HOH TIP A . D 4 HOH 9 1107 1107 HOH TIP A . D 4 HOH 10 1108 1108 HOH TIP A . D 4 HOH 11 1109 1109 HOH TIP A . D 4 HOH 12 1110 1110 HOH TIP A . D 4 HOH 13 1111 1111 HOH TIP A . D 4 HOH 14 1112 1112 HOH TIP A . D 4 HOH 15 1113 1113 HOH TIP A . D 4 HOH 16 1114 1114 HOH TIP A . D 4 HOH 17 1115 1115 HOH TIP A . D 4 HOH 18 1116 1116 HOH TIP A . D 4 HOH 19 1117 1117 HOH TIP A . D 4 HOH 20 1118 1118 HOH TIP A . D 4 HOH 21 1119 1119 HOH TIP A . D 4 HOH 22 1120 1120 HOH TIP A . D 4 HOH 23 1121 1121 HOH TIP A . D 4 HOH 24 1122 1122 HOH TIP A . D 4 HOH 25 1123 1123 HOH TIP A . D 4 HOH 26 1124 1124 HOH TIP A . D 4 HOH 27 1125 1125 HOH TIP A . D 4 HOH 28 1126 1126 HOH TIP A . D 4 HOH 29 1127 1127 HOH TIP A . D 4 HOH 30 1128 1128 HOH TIP A . D 4 HOH 31 1129 1129 HOH TIP A . D 4 HOH 32 1130 1130 HOH TIP A . D 4 HOH 33 1131 1131 HOH TIP A . D 4 HOH 34 1132 1132 HOH TIP A . D 4 HOH 35 1133 1133 HOH TIP A . D 4 HOH 36 1134 1134 HOH TIP A . D 4 HOH 37 1135 1135 HOH TIP A . D 4 HOH 38 1136 1136 HOH TIP A . D 4 HOH 39 1137 1137 HOH TIP A . D 4 HOH 40 1138 1138 HOH TIP A . D 4 HOH 41 1139 1139 HOH TIP A . D 4 HOH 42 1140 1140 HOH TIP A . D 4 HOH 43 1141 1141 HOH TIP A . D 4 HOH 44 1142 1142 HOH TIP A . D 4 HOH 45 1143 1143 HOH TIP A . D 4 HOH 46 1144 1144 HOH TIP A . D 4 HOH 47 1145 1145 HOH TIP A . D 4 HOH 48 1146 1146 HOH TIP A . D 4 HOH 49 1147 1147 HOH TIP A . D 4 HOH 50 1148 1148 HOH TIP A . D 4 HOH 51 1149 1149 HOH TIP A . D 4 HOH 52 1150 1150 HOH TIP A . D 4 HOH 53 1151 1151 HOH TIP A . D 4 HOH 54 1152 1152 HOH TIP A . D 4 HOH 55 1153 1153 HOH TIP A . D 4 HOH 56 1154 1154 HOH TIP A . D 4 HOH 57 1155 1155 HOH TIP A . D 4 HOH 58 1156 1156 HOH TIP A . D 4 HOH 59 1157 1157 HOH TIP A . D 4 HOH 60 1158 1158 HOH TIP A . D 4 HOH 61 1159 1159 HOH TIP A . D 4 HOH 62 1160 1160 HOH TIP A . D 4 HOH 63 1161 1161 HOH TIP A . D 4 HOH 64 1162 1162 HOH TIP A . D 4 HOH 65 1163 1163 HOH TIP A . D 4 HOH 66 1164 1164 HOH TIP A . D 4 HOH 67 1165 1165 HOH TIP A . D 4 HOH 68 1166 1166 HOH TIP A . D 4 HOH 69 1167 1167 HOH TIP A . D 4 HOH 70 1168 1168 HOH TIP A . D 4 HOH 71 1169 1169 HOH TIP A . D 4 HOH 72 1170 1170 HOH TIP A . D 4 HOH 73 1171 1171 HOH TIP A . D 4 HOH 74 1172 1172 HOH TIP A . D 4 HOH 75 1173 1173 HOH TIP A . D 4 HOH 76 1174 1174 HOH TIP A . D 4 HOH 77 1175 1175 HOH TIP A . D 4 HOH 78 1176 1176 HOH TIP A . D 4 HOH 79 1177 1177 HOH TIP A . D 4 HOH 80 1178 1178 HOH TIP A . D 4 HOH 81 1179 1179 HOH TIP A . D 4 HOH 82 1180 1180 HOH TIP A . D 4 HOH 83 1181 1181 HOH TIP A . D 4 HOH 84 1182 1182 HOH TIP A . D 4 HOH 85 1183 1183 HOH TIP A . D 4 HOH 86 1184 1184 HOH TIP A . D 4 HOH 87 1185 1185 HOH TIP A . D 4 HOH 88 1186 1186 HOH TIP A . D 4 HOH 89 1187 1187 HOH TIP A . D 4 HOH 90 1188 1188 HOH TIP A . D 4 HOH 91 1189 1189 HOH TIP A . D 4 HOH 92 1190 1190 HOH TIP A . D 4 HOH 93 1191 1191 HOH TIP A . D 4 HOH 94 1192 1192 HOH TIP A . D 4 HOH 95 1193 1193 HOH TIP A . D 4 HOH 96 1194 1194 HOH TIP A . D 4 HOH 97 1195 1195 HOH TIP A . D 4 HOH 98 1196 1196 HOH TIP A . D 4 HOH 99 1197 1197 HOH TIP A . D 4 HOH 100 1198 1198 HOH TIP A . D 4 HOH 101 1199 1199 HOH TIP A . D 4 HOH 102 1200 1200 HOH TIP A . D 4 HOH 103 1201 1201 HOH TIP A . D 4 HOH 104 1202 1202 HOH TIP A . D 4 HOH 105 1203 1203 HOH TIP A . D 4 HOH 106 1206 1206 HOH TIP A . D 4 HOH 107 1207 1207 HOH TIP A . D 4 HOH 108 1208 1208 HOH TIP A . D 4 HOH 109 1209 1209 HOH TIP A . D 4 HOH 110 1210 1210 HOH TIP A . D 4 HOH 111 1211 1211 HOH TIP A . D 4 HOH 112 1212 1212 HOH TIP A . D 4 HOH 113 1213 1213 HOH TIP A . D 4 HOH 114 1214 1214 HOH TIP A . D 4 HOH 115 1215 1215 HOH TIP A . D 4 HOH 116 1216 1216 HOH TIP A . D 4 HOH 117 1217 1217 HOH TIP A . D 4 HOH 118 1218 1218 HOH TIP A . D 4 HOH 119 1219 1219 HOH TIP A . D 4 HOH 120 1220 1220 HOH TIP A . D 4 HOH 121 1221 1221 HOH TIP A . D 4 HOH 122 1222 1222 HOH TIP A . D 4 HOH 123 1223 1223 HOH TIP A . D 4 HOH 124 1224 1224 HOH TIP A . D 4 HOH 125 1225 1225 HOH TIP A . D 4 HOH 126 1226 1226 HOH TIP A . D 4 HOH 127 1227 1227 HOH TIP A . D 4 HOH 128 1228 1228 HOH TIP A . D 4 HOH 129 1229 1229 HOH TIP A . D 4 HOH 130 1230 1230 HOH TIP A . D 4 HOH 131 1231 1231 HOH TIP A . D 4 HOH 132 1232 1232 HOH TIP A . D 4 HOH 133 1233 1233 HOH TIP A . D 4 HOH 134 1234 1234 HOH TIP A . D 4 HOH 135 1235 1235 HOH TIP A . D 4 HOH 136 1236 1236 HOH TIP A . D 4 HOH 137 1237 1237 HOH TIP A . D 4 HOH 138 1238 1238 HOH TIP A . D 4 HOH 139 1239 1239 HOH TIP A . D 4 HOH 140 1240 1240 HOH TIP A . D 4 HOH 141 1243 1243 HOH TIP A . D 4 HOH 142 1244 1244 HOH TIP A . D 4 HOH 143 1245 1245 HOH TIP A . D 4 HOH 144 1246 1246 HOH TIP A . D 4 HOH 145 1247 1247 HOH TIP A . D 4 HOH 146 1248 1248 HOH TIP A . D 4 HOH 147 1249 1249 HOH TIP A . D 4 HOH 148 1250 1250 HOH TIP A . D 4 HOH 149 1251 1251 HOH TIP A . D 4 HOH 150 1252 1252 HOH TIP A . D 4 HOH 151 1253 1253 HOH TIP A . D 4 HOH 152 1254 1254 HOH TIP A . D 4 HOH 153 1255 1255 HOH TIP A . D 4 HOH 154 1256 1256 HOH TIP A . D 4 HOH 155 1257 1257 HOH TIP A . D 4 HOH 156 1258 1258 HOH TIP A . D 4 HOH 157 1259 1259 HOH TIP A . D 4 HOH 158 1260 1260 HOH TIP A . D 4 HOH 159 1261 1261 HOH TIP A . D 4 HOH 160 1263 1263 HOH TIP A . D 4 HOH 161 1264 1264 HOH TIP A . D 4 HOH 162 1265 1265 HOH TIP A . D 4 HOH 163 1267 1267 HOH TIP A . D 4 HOH 164 1268 1268 HOH TIP A . D 4 HOH 165 1269 1269 HOH TIP A . D 4 HOH 166 1270 1270 HOH TIP A . D 4 HOH 167 1271 1271 HOH TIP A . D 4 HOH 168 1272 1272 HOH TIP A . D 4 HOH 169 1273 1273 HOH TIP A . D 4 HOH 170 1274 1274 HOH TIP A . D 4 HOH 171 1275 1275 HOH TIP A . D 4 HOH 172 1276 1276 HOH TIP A . D 4 HOH 173 1277 1277 HOH TIP A . D 4 HOH 174 1278 1278 HOH TIP A . D 4 HOH 175 1279 1279 HOH TIP A . D 4 HOH 176 1280 1280 HOH TIP A . D 4 HOH 177 1282 1282 HOH TIP A . D 4 HOH 178 1283 1283 HOH TIP A . D 4 HOH 179 1284 1284 HOH TIP A . D 4 HOH 180 1285 1285 HOH TIP A . D 4 HOH 181 1286 1286 HOH TIP A . D 4 HOH 182 1287 1287 HOH TIP A . D 4 HOH 183 1288 1288 HOH TIP A . D 4 HOH 184 1289 1289 HOH TIP A . D 4 HOH 185 1290 1290 HOH TIP A . D 4 HOH 186 1291 1291 HOH TIP A . D 4 HOH 187 1292 1292 HOH TIP A . D 4 HOH 188 1293 1293 HOH TIP A . D 4 HOH 189 1294 1294 HOH TIP A . D 4 HOH 190 1295 1295 HOH TIP A . D 4 HOH 191 1296 1296 HOH TIP A . D 4 HOH 192 1297 1297 HOH TIP A . D 4 HOH 193 1298 1298 HOH TIP A . D 4 HOH 194 1299 1299 HOH TIP A . D 4 HOH 195 1300 1300 HOH TIP A . D 4 HOH 196 1301 1301 HOH TIP A . D 4 HOH 197 1302 1302 HOH TIP A . D 4 HOH 198 1303 1303 HOH TIP A . D 4 HOH 199 1304 1304 HOH TIP A . D 4 HOH 200 1305 1305 HOH TIP A . D 4 HOH 201 1306 1306 HOH TIP A . D 4 HOH 202 1307 1307 HOH TIP A . D 4 HOH 203 1308 1308 HOH TIP A . D 4 HOH 204 1309 1309 HOH TIP A . D 4 HOH 205 1310 1310 HOH TIP A . D 4 HOH 206 1311 1311 HOH TIP A . D 4 HOH 207 1312 1312 HOH TIP A . D 4 HOH 208 1313 1313 HOH TIP A . D 4 HOH 209 1315 1315 HOH TIP A . D 4 HOH 210 1316 1316 HOH TIP A . D 4 HOH 211 1317 1317 HOH TIP A . D 4 HOH 212 1318 1318 HOH TIP A . D 4 HOH 213 1319 1319 HOH TIP A . D 4 HOH 214 1320 1320 HOH TIP A . D 4 HOH 215 1321 1321 HOH TIP A . D 4 HOH 216 1322 1322 HOH TIP A . D 4 HOH 217 1323 1323 HOH TIP A . D 4 HOH 218 1325 1325 HOH TIP A . D 4 HOH 219 1326 1326 HOH TIP A . D 4 HOH 220 1327 1327 HOH TIP A . D 4 HOH 221 1328 1328 HOH TIP A . D 4 HOH 222 1329 1329 HOH TIP A . D 4 HOH 223 1330 1330 HOH TIP A . D 4 HOH 224 1331 1331 HOH TIP A . D 4 HOH 225 1332 1332 HOH TIP A . D 4 HOH 226 1333 1333 HOH TIP A . D 4 HOH 227 1334 1334 HOH TIP A . D 4 HOH 228 1336 1336 HOH TIP A . D 4 HOH 229 1337 1337 HOH TIP A . D 4 HOH 230 1338 1338 HOH TIP A . D 4 HOH 231 1339 1339 HOH TIP A . D 4 HOH 232 1340 1340 HOH TIP A . D 4 HOH 233 1341 1341 HOH TIP A . D 4 HOH 234 1342 1342 HOH TIP A . D 4 HOH 235 1343 1343 HOH TIP A . D 4 HOH 236 1344 1344 HOH TIP A . D 4 HOH 237 1345 1345 HOH TIP A . D 4 HOH 238 1346 1346 HOH TIP A . D 4 HOH 239 1348 1348 HOH TIP A . D 4 HOH 240 1349 1349 HOH TIP A . D 4 HOH 241 1350 1350 HOH TIP A . D 4 HOH 242 1352 1352 HOH TIP A . D 4 HOH 243 1353 1353 HOH TIP A . D 4 HOH 244 1354 1354 HOH TIP A . D 4 HOH 245 1355 1355 HOH TIP A . D 4 HOH 246 1356 1356 HOH TIP A . D 4 HOH 247 1357 1357 HOH TIP A . D 4 HOH 248 1358 1358 HOH TIP A . D 4 HOH 249 1360 1360 HOH TIP A . D 4 HOH 250 1361 1361 HOH TIP A . D 4 HOH 251 1362 1362 HOH TIP A . D 4 HOH 252 1363 1363 HOH TIP A . D 4 HOH 253 1365 1365 HOH TIP A . D 4 HOH 254 1366 1366 HOH TIP A . D 4 HOH 255 1367 1367 HOH TIP A . D 4 HOH 256 1368 1368 HOH TIP A . D 4 HOH 257 1369 1369 HOH TIP A . D 4 HOH 258 1371 1371 HOH TIP A . D 4 HOH 259 1372 1372 HOH TIP A . D 4 HOH 260 1373 1373 HOH TIP A . D 4 HOH 261 1374 1374 HOH TIP A . D 4 HOH 262 1375 1375 HOH TIP A . D 4 HOH 263 1377 1377 HOH TIP A . D 4 HOH 264 1379 1379 HOH TIP A . D 4 HOH 265 1380 1380 HOH TIP A . D 4 HOH 266 1381 1381 HOH TIP A . D 4 HOH 267 1382 1382 HOH TIP A . D 4 HOH 268 1383 1383 HOH TIP A . D 4 HOH 269 1384 1384 HOH TIP A . D 4 HOH 270 1385 1385 HOH TIP A . D 4 HOH 271 1386 1386 HOH TIP A . D 4 HOH 272 1388 1388 HOH TIP A . D 4 HOH 273 1389 1389 HOH TIP A . D 4 HOH 274 1391 1391 HOH TIP A . D 4 HOH 275 1393 1393 HOH TIP A . D 4 HOH 276 1394 1394 HOH TIP A . D 4 HOH 277 1395 1395 HOH TIP A . D 4 HOH 278 1396 1396 HOH TIP A . D 4 HOH 279 1398 1398 HOH TIP A . D 4 HOH 280 1400 1400 HOH TIP A . D 4 HOH 281 1401 1401 HOH TIP A . D 4 HOH 282 1402 1402 HOH TIP A . D 4 HOH 283 1403 1403 HOH TIP A . D 4 HOH 284 1405 1405 HOH TIP A . D 4 HOH 285 1406 1406 HOH TIP A . D 4 HOH 286 1407 1407 HOH TIP A . D 4 HOH 287 1408 1408 HOH TIP A . D 4 HOH 288 1411 1411 HOH TIP A . D 4 HOH 289 1412 1412 HOH TIP A . D 4 HOH 290 1414 1414 HOH TIP A . D 4 HOH 291 1415 1415 HOH TIP A . D 4 HOH 292 1418 1418 HOH TIP A . D 4 HOH 293 1419 1419 HOH TIP A . D 4 HOH 294 1423 1423 HOH TIP A . D 4 HOH 295 1424 1424 HOH TIP A . D 4 HOH 296 1425 1425 HOH TIP A . D 4 HOH 297 1426 1426 HOH TIP A . D 4 HOH 298 1427 1427 HOH TIP A . D 4 HOH 299 1428 1428 HOH TIP A . D 4 HOH 300 1430 1430 HOH TIP A . D 4 HOH 301 1431 1431 HOH TIP A . D 4 HOH 302 1437 1437 HOH TIP A . D 4 HOH 303 1440 1440 HOH TIP A . D 4 HOH 304 1444 1444 HOH TIP A . D 4 HOH 305 1445 1445 HOH TIP A . D 4 HOH 306 1446 1446 HOH TIP A . D 4 HOH 307 1448 1448 HOH TIP A . D 4 HOH 308 1451 1451 HOH TIP A . D 4 HOH 309 1453 1453 HOH TIP A . D 4 HOH 310 1455 1455 HOH TIP A . D 4 HOH 311 1458 1458 HOH TIP A . D 4 HOH 312 1459 1459 HOH TIP A . D 4 HOH 313 1460 1460 HOH TIP A . D 4 HOH 314 1461 1461 HOH TIP A . D 4 HOH 315 1462 1462 HOH TIP A . D 4 HOH 316 1463 1463 HOH TIP A . D 4 HOH 317 1466 1466 HOH TIP A . D 4 HOH 318 1471 1471 HOH TIP A . D 4 HOH 319 1472 1472 HOH TIP A . D 4 HOH 320 1473 1473 HOH TIP A . D 4 HOH 321 1474 1474 HOH TIP A . D 4 HOH 322 1475 1475 HOH TIP A . D 4 HOH 323 1476 1476 HOH TIP A . D 4 HOH 324 1478 1478 HOH TIP A . D 4 HOH 325 1479 1479 HOH TIP A . D 4 HOH 326 1481 1481 HOH TIP A . D 4 HOH 327 1483 1483 HOH TIP A . D 4 HOH 328 1484 1484 HOH TIP A . D 4 HOH 329 1486 1486 HOH TIP A . D 4 HOH 330 1491 1491 HOH TIP A . D 4 HOH 331 1494 1494 HOH TIP A . D 4 HOH 332 1495 1495 HOH TIP A . D 4 HOH 333 1505 1505 HOH TIP A . D 4 HOH 334 1506 1506 HOH TIP A . D 4 HOH 335 1507 1507 HOH TIP A . D 4 HOH 336 1508 1508 HOH TIP A . D 4 HOH 337 1509 1509 HOH TIP A . D 4 HOH 338 1510 1510 HOH TIP A . D 4 HOH 339 1511 1511 HOH TIP A . D 4 HOH 340 1512 1512 HOH TIP A . D 4 HOH 341 1513 1513 HOH TIP A . D 4 HOH 342 1514 1514 HOH TIP A . D 4 HOH 343 1515 1515 HOH TIP A . D 4 HOH 344 1516 1516 HOH TIP A . D 4 HOH 345 1517 1517 HOH TIP A . D 4 HOH 346 1518 1518 HOH TIP A . D 4 HOH 347 1519 1519 HOH TIP A . D 4 HOH 348 1520 1520 HOH TIP A . D 4 HOH 349 1521 1521 HOH TIP A . D 4 HOH 350 1522 1522 HOH TIP A . D 4 HOH 351 1523 1523 HOH TIP A . D 4 HOH 352 1524 1524 HOH TIP A . D 4 HOH 353 1525 1525 HOH TIP A . D 4 HOH 354 1526 1526 HOH TIP A . D 4 HOH 355 1527 1527 HOH TIP A . D 4 HOH 356 1528 1528 HOH TIP A . D 4 HOH 357 1529 1529 HOH TIP A . D 4 HOH 358 1530 1530 HOH TIP A . D 4 HOH 359 1531 1531 HOH TIP A . D 4 HOH 360 1532 1532 HOH TIP A . D 4 HOH 361 1533 1533 HOH TIP A . D 4 HOH 362 1534 1534 HOH TIP A . D 4 HOH 363 1535 1535 HOH TIP A . D 4 HOH 364 1536 1536 HOH TIP A . D 4 HOH 365 1537 1537 HOH TIP A . D 4 HOH 366 1538 1538 HOH TIP A . D 4 HOH 367 1539 1539 HOH TIP A . D 4 HOH 368 1540 1540 HOH TIP A . D 4 HOH 369 1541 1541 HOH TIP A . D 4 HOH 370 1542 1542 HOH TIP A . D 4 HOH 371 1543 1543 HOH TIP A . D 4 HOH 372 1544 1544 HOH TIP A . D 4 HOH 373 1545 1545 HOH TIP A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 175 ? A HIS 175 ? 1_555 FE ? B HEM . ? A HEM 400 ? 1_555 NA ? B HEM . ? A HEM 400 ? 1_555 97.4 ? 2 NE2 ? A HIS 175 ? A HIS 175 ? 1_555 FE ? B HEM . ? A HEM 400 ? 1_555 NB ? B HEM . ? A HEM 400 ? 1_555 93.2 ? 3 NA ? B HEM . ? A HEM 400 ? 1_555 FE ? B HEM . ? A HEM 400 ? 1_555 NB ? B HEM . ? A HEM 400 ? 1_555 89.9 ? 4 NE2 ? A HIS 175 ? A HIS 175 ? 1_555 FE ? B HEM . ? A HEM 400 ? 1_555 NC ? B HEM . ? A HEM 400 ? 1_555 89.3 ? 5 NA ? B HEM . ? A HEM 400 ? 1_555 FE ? B HEM . ? A HEM 400 ? 1_555 NC ? B HEM . ? A HEM 400 ? 1_555 173.3 ? 6 NB ? B HEM . ? A HEM 400 ? 1_555 FE ? B HEM . ? A HEM 400 ? 1_555 NC ? B HEM . ? A HEM 400 ? 1_555 90.0 ? 7 NE2 ? A HIS 175 ? A HIS 175 ? 1_555 FE ? B HEM . ? A HEM 400 ? 1_555 ND ? B HEM . ? A HEM 400 ? 1_555 93.6 ? 8 NA ? B HEM . ? A HEM 400 ? 1_555 FE ? B HEM . ? A HEM 400 ? 1_555 ND ? B HEM . ? A HEM 400 ? 1_555 90.5 ? 9 NB ? B HEM . ? A HEM 400 ? 1_555 FE ? B HEM . ? A HEM 400 ? 1_555 ND ? B HEM . ? A HEM 400 ? 1_555 173.0 ? 10 NC ? B HEM . ? A HEM 400 ? 1_555 FE ? B HEM . ? A HEM 400 ? 1_555 ND ? B HEM . ? A HEM 400 ? 1_555 88.8 ? 11 NE2 ? A HIS 175 ? A HIS 175 ? 1_555 FE ? B HEM . ? A HEM 400 ? 1_555 O ? D HOH . ? A HOH 1415 ? 1_555 177.4 ? 12 NA ? B HEM . ? A HEM 400 ? 1_555 FE ? B HEM . ? A HEM 400 ? 1_555 O ? D HOH . ? A HOH 1415 ? 1_555 80.3 ? 13 NB ? B HEM . ? A HEM 400 ? 1_555 FE ? B HEM . ? A HEM 400 ? 1_555 O ? D HOH . ? A HOH 1415 ? 1_555 88.1 ? 14 NC ? B HEM . ? A HEM 400 ? 1_555 FE ? B HEM . ? A HEM 400 ? 1_555 O ? D HOH . ? A HOH 1415 ? 1_555 93.0 ? 15 ND ? B HEM . ? A HEM 400 ? 1_555 FE ? B HEM . ? A HEM 400 ? 1_555 O ? D HOH . ? A HOH 1415 ? 1_555 85.1 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-04-11 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' struct_conn 3 4 'Structure model' struct_ref_seq_dif 4 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 4 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 5 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 6 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 9 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 10 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 11 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 12 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 15 4 'Structure model' '_struct_ref_seq_dif.details' 16 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 17 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 18 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal SHELX 'model building' . ? 1 SHELXL-97 refinement . ? 2 HKL-2000 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 CNS phasing . ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 194 ? ? -109.38 71.18 2 1 ASP A 254 ? ? -156.09 89.64 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LEU 4 ? CD1 ? A LEU 4 CD1 2 1 Y 1 A LEU 4 ? CD2 ? A LEU 4 CD2 3 1 Y 1 A GLU 17 ? CG ? A GLU 17 CG 4 1 Y 1 A GLU 17 ? CD ? A GLU 17 CD 5 1 Y 1 A GLU 17 ? OE1 ? A GLU 17 OE1 6 1 Y 1 A GLU 17 ? OE2 ? A GLU 17 OE2 7 1 Y 1 A LYS 21 ? CE ? A LYS 21 CE 8 1 Y 1 A LYS 21 ? NZ ? A LYS 21 NZ 9 1 Y 1 A GLU 35 ? CG ? A GLU 35 CG 10 1 Y 1 A GLU 35 ? CD ? A GLU 35 CD 11 1 Y 1 A GLU 35 ? OE1 ? A GLU 35 OE1 12 1 Y 1 A GLU 35 ? OE2 ? A GLU 35 OE2 13 1 Y 1 A LYS 74 ? CD ? A LYS 74 CD 14 1 Y 1 A LYS 74 ? CE ? A LYS 74 CE 15 1 Y 1 A LYS 74 ? NZ ? A LYS 74 NZ 16 1 Y 1 A LYS 90 ? CD ? A LYS 90 CD 17 1 Y 1 A LYS 90 ? CE ? A LYS 90 CE 18 1 Y 1 A LYS 90 ? NZ ? A LYS 90 NZ 19 1 Y 1 A LYS 97 ? CG ? A LYS 97 CG 20 1 Y 1 A LYS 97 ? CD ? A LYS 97 CD 21 1 Y 1 A LYS 97 ? CE ? A LYS 97 CE 22 1 Y 1 A LYS 97 ? NZ ? A LYS 97 NZ 23 1 Y 1 A LYS 183 ? CG ? A LYS 183 CG 24 1 Y 1 A LYS 183 ? CD ? A LYS 183 CD 25 1 Y 1 A LYS 183 ? CE ? A LYS 183 CE 26 1 Y 1 A LYS 183 ? NZ ? A LYS 183 NZ 27 1 Y 1 A GLU 201 ? CG ? A GLU 201 CG 28 1 Y 1 A GLU 201 ? CD ? A GLU 201 CD 29 1 Y 1 A GLU 201 ? OE1 ? A GLU 201 OE1 30 1 Y 1 A GLU 201 ? OE2 ? A GLU 201 OE2 31 1 Y 1 A ASP 210 ? CG ? A ASP 210 CG 32 1 Y 1 A ASP 210 ? OD1 ? A ASP 210 OD1 33 1 Y 1 A ASP 210 ? OD2 ? A ASP 210 OD2 34 1 Y 1 A LYS 212 ? CD ? A LYS 212 CD 35 1 Y 1 A LYS 212 ? CE ? A LYS 212 CE 36 1 Y 1 A LYS 212 ? NZ ? A LYS 212 NZ 37 1 Y 1 A LYS 226 ? CG ? A LYS 226 CG 38 1 Y 1 A LYS 226 ? CD ? A LYS 226 CD 39 1 Y 1 A LYS 226 ? CE ? A LYS 226 CE 40 1 Y 1 A LYS 226 ? NZ ? A LYS 226 NZ 41 1 Y 1 A LYS 260 ? CD ? A LYS 260 CD 42 1 Y 1 A LYS 260 ? CE ? A LYS 260 CE 43 1 Y 1 A LYS 260 ? NZ ? A LYS 260 NZ 44 1 Y 1 A LYS 264 ? CE ? A LYS 264 CE 45 1 Y 1 A LYS 264 ? NZ ? A LYS 264 NZ 46 1 Y 1 A LYS 278 ? CG ? A LYS 278 CG 47 1 Y 1 A LYS 278 ? CD ? A LYS 278 CD 48 1 Y 1 A LYS 278 ? CE ? A LYS 278 CE 49 1 Y 1 A LYS 278 ? NZ ? A LYS 278 NZ 50 1 Y 1 A ASP 279 ? CG ? A ASP 279 CG 51 1 Y 1 A ASP 279 ? OD1 ? A ASP 279 OD1 52 1 Y 1 A ASP 279 ? OD2 ? A ASP 279 OD2 53 1 Y 1 A LYS 287 ? CD ? A LYS 287 CD 54 1 Y 1 A LYS 287 ? CE ? A LYS 287 CE 55 1 Y 1 A LYS 287 ? NZ ? A LYS 287 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A LYS 2 ? A LYS 2 3 1 Y 1 A THR 3 ? A THR 3 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PROTOPORPHYRIN IX CONTAINING FE' HEM 3 THIOPHENE-3-CARBOXIMIDAMIDE TP5 4 water HOH #