data_2ASQ # _entry.id 2ASQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2ASQ pdb_00002asq 10.2210/pdb2asq/pdb RCSB RCSB034269 ? ? WWPDB D_1000034269 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-10-11 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2ASQ _pdbx_database_status.recvd_initial_deposition_date 2005-08-23 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1Z5S 'Another example of SUMO-1 in complex with the SUMO-binding Motif.' unspecified PDB 1WYW 'Another example of SUMO-1 in complex with the SUMO-binding Motif.' unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Song, J.' 1 'Zhang, Z.' 2 'Hu, W.' 3 'Chen, Y.' 4 # _citation.id primary _citation.title 'Small Ubiquitin-like Modifier (SUMO) Recognition of a SUMO Binding Motif: A reversal of the bound orientation' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 280 _citation.page_first 40122 _citation.page_last 40129 _citation.year 2005 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16204249 _citation.pdbx_database_id_DOI 10.1074/jbc.M507059200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Song, J.' 1 ? primary 'Zhang, Z.' 2 ? primary 'Hu, W.' 3 ? primary 'Chen, Y.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Small ubiquitin-related modifier 1' 11149.545 1 ? ? 'Structured Region of SUMO-1 (residues 21-97)' ? 2 polymer man 'Protein inhibitor of activated STAT2' 2835.079 1 ? ? 'SUMO-binding Motif in PIASx' ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 ;SUMO-1, Ubiquitin-like protein SMT3C, SMT3 homolog 3, Ubiquitin-homology domain protein PIC1, Ubiquitin-like protein UBL1, GAP modifying protein 1, GMP1, Sentrin ; 2 ;Protein inhibitor of activated STAT x, Msx-interacting zinc finger protein, Miz1, DAB2-interacting protein, DIP, Androgen receptor-interacting protein 3, ARIP3, PIAS-NY protein ; # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKEL GMEEEDVIEVYQEQTGG ; ;MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKEL GMEEEDVIEVYQEQTGG ; A ? 2 'polypeptide(L)' no no KVDVIDLTIESSSDEEEDPPAKRQM KVDVIDLTIESSSDEEEDPPAKRQM B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 ASP n 1 4 GLN n 1 5 GLU n 1 6 ALA n 1 7 LYS n 1 8 PRO n 1 9 SER n 1 10 THR n 1 11 GLU n 1 12 ASP n 1 13 LEU n 1 14 GLY n 1 15 ASP n 1 16 LYS n 1 17 LYS n 1 18 GLU n 1 19 GLY n 1 20 GLU n 1 21 TYR n 1 22 ILE n 1 23 LYS n 1 24 LEU n 1 25 LYS n 1 26 VAL n 1 27 ILE n 1 28 GLY n 1 29 GLN n 1 30 ASP n 1 31 SER n 1 32 SER n 1 33 GLU n 1 34 ILE n 1 35 HIS n 1 36 PHE n 1 37 LYS n 1 38 VAL n 1 39 LYS n 1 40 MET n 1 41 THR n 1 42 THR n 1 43 HIS n 1 44 LEU n 1 45 LYS n 1 46 LYS n 1 47 LEU n 1 48 LYS n 1 49 GLU n 1 50 SER n 1 51 TYR n 1 52 CYS n 1 53 GLN n 1 54 ARG n 1 55 GLN n 1 56 GLY n 1 57 VAL n 1 58 PRO n 1 59 MET n 1 60 ASN n 1 61 SER n 1 62 LEU n 1 63 ARG n 1 64 PHE n 1 65 LEU n 1 66 PHE n 1 67 GLU n 1 68 GLY n 1 69 GLN n 1 70 ARG n 1 71 ILE n 1 72 ALA n 1 73 ASP n 1 74 ASN n 1 75 HIS n 1 76 THR n 1 77 PRO n 1 78 LYS n 1 79 GLU n 1 80 LEU n 1 81 GLY n 1 82 MET n 1 83 GLU n 1 84 GLU n 1 85 GLU n 1 86 ASP n 1 87 VAL n 1 88 ILE n 1 89 GLU n 1 90 VAL n 1 91 TYR n 1 92 GLN n 1 93 GLU n 1 94 GLN n 1 95 THR n 1 96 GLY n 1 97 GLY n 2 1 LYS n 2 2 VAL n 2 3 ASP n 2 4 VAL n 2 5 ILE n 2 6 ASP n 2 7 LEU n 2 8 THR n 2 9 ILE n 2 10 GLU n 2 11 SER n 2 12 SER n 2 13 SER n 2 14 ASP n 2 15 GLU n 2 16 GLU n 2 17 GLU n 2 18 ASP n 2 19 PRO n 2 20 PRO n 2 21 ALA n 2 22 LYS n 2 23 ARG n 2 24 GLN n 2 25 MET n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample ? ? ? human Homo 'SUMO1, SMT3C, SMT3H3, UBL1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? 'BL21(DE3)(Novagen)' ? ? ? ? ? ? ? Plasmid ? ? ? 'PET11a+ (Novagen)' ? ? 2 1 sample ? ? ? human Homo 'PIAS2, PIASX' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? 'BLR(DE3)plysS (Novagen)' ? ? ? ? ? ? ? Plasmid ? ? ? PET31a+ ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 ASP 3 3 ? ? ? A . n A 1 4 GLN 4 4 ? ? ? A . n A 1 5 GLU 5 5 ? ? ? A . n A 1 6 ALA 6 6 ? ? ? A . n A 1 7 LYS 7 7 ? ? ? A . n A 1 8 PRO 8 8 ? ? ? A . n A 1 9 SER 9 9 ? ? ? A . n A 1 10 THR 10 10 ? ? ? A . n A 1 11 GLU 11 11 ? ? ? A . n A 1 12 ASP 12 12 ? ? ? A . n A 1 13 LEU 13 13 ? ? ? A . n A 1 14 GLY 14 14 ? ? ? A . n A 1 15 ASP 15 15 ? ? ? A . n A 1 16 LYS 16 16 ? ? ? A . n A 1 17 LYS 17 17 ? ? ? A . n A 1 18 GLU 18 18 ? ? ? A . n A 1 19 GLY 19 19 ? ? ? A . n A 1 20 GLU 20 20 ? ? ? A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 MET 40 40 40 MET MET A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 HIS 43 43 43 HIS HIS A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 CYS 52 52 52 CYS CYS A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 MET 59 59 59 MET MET A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 HIS 75 75 75 HIS HIS A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 MET 82 82 82 MET MET A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 GLN 94 94 94 GLN GLN A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 GLY 97 97 97 GLY GLY A . n B 2 1 LYS 1 1 1 LYS LYS B . n B 2 2 VAL 2 2 2 VAL VAL B . n B 2 3 ASP 3 3 3 ASP ASP B . n B 2 4 VAL 4 4 4 VAL VAL B . n B 2 5 ILE 5 5 5 ILE ILE B . n B 2 6 ASP 6 6 6 ASP ASP B . n B 2 7 LEU 7 7 7 LEU LEU B . n B 2 8 THR 8 8 8 THR THR B . n B 2 9 ILE 9 9 9 ILE ILE B . n B 2 10 GLU 10 10 10 GLU GLU B . n B 2 11 SER 11 11 11 SER SER B . n B 2 12 SER 12 12 12 SER SER B . n B 2 13 SER 13 13 13 SER SER B . n B 2 14 ASP 14 14 14 ASP ASP B . n B 2 15 GLU 15 15 ? ? ? B . n B 2 16 GLU 16 16 ? ? ? B . n B 2 17 GLU 17 17 ? ? ? B . n B 2 18 ASP 18 18 ? ? ? B . n B 2 19 PRO 19 19 ? ? ? B . n B 2 20 PRO 20 20 ? ? ? B . n B 2 21 ALA 21 21 ? ? ? B . n B 2 22 LYS 22 22 ? ? ? B . n B 2 23 ARG 23 23 ? ? ? B . n B 2 24 GLN 24 24 ? ? ? B . n B 2 25 MET 25 25 ? ? ? B . n # _exptl.entry_id 2ASQ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 2ASQ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2ASQ _struct.title 'Solution Structure of SUMO-1 in Complex with a SUMO-binding Motif (SBM)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2ASQ _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text ;Protein-Peptide Complex, SUMO-1, Small Ubiquitin-like Modifier 1, SUMO-Binding Motif, SBM, Protein Inhibitor of Activated STAT, PIASx, PROTEIN BINDING ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP SUMO1_HUMAN P63165 1 ;MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKEL GMEEEDVIEVYQEQTGG ; 1 ? 2 UNP PIAS2_HUMAN O75928 2 KVDVIDLTIESSSDEEEDPPAKR 466 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2ASQ A 1 ? 97 ? P63165 1 ? 97 ? 1 97 2 2 2ASQ B 1 ? 23 ? O75928 466 ? 488 ? 1 23 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 2 2ASQ GLN B 24 ? UNP O75928 ? ? 'cloning artifact' 24 1 2 2ASQ MET B 25 ? UNP O75928 ? ? 'cloning artifact' 25 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id HIS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 43 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 56 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id HIS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 43 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 56 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel A 4 5 ? anti-parallel A 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 69 ? ARG A 70 ? GLN A 69 ARG A 70 A 2 LEU A 62 ? PHE A 66 ? LEU A 62 PHE A 66 A 3 ASP A 86 ? GLN A 92 ? ASP A 86 GLN A 92 A 4 ILE A 22 ? GLY A 28 ? ILE A 22 GLY A 28 A 5 SER A 32 ? VAL A 38 ? SER A 32 VAL A 38 A 6 VAL B 4 ? ASP B 6 ? VAL B 4 ASP B 6 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLN A 69 ? O GLN A 69 N PHE A 66 ? N PHE A 66 A 2 3 N ARG A 63 ? N ARG A 63 O TYR A 91 ? O TYR A 91 A 3 4 O ILE A 88 ? O ILE A 88 N LYS A 25 ? N LYS A 25 A 4 5 N ILE A 22 ? N ILE A 22 O VAL A 38 ? O VAL A 38 A 5 6 N HIS A 35 ? N HIS A 35 O ILE B 5 ? O ILE B 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HZ2 A LYS 48 ? ? OD1 A ASP 73 ? ? 1.56 2 1 HZ2 A LYS 23 ? ? OE2 A GLU 84 ? ? 1.58 3 1 HZ2 A LYS 25 ? ? OE1 A GLU 33 ? ? 1.59 4 3 HZ2 A LYS 48 ? ? OD1 A ASP 73 ? ? 1.60 5 4 OD1 A ASP 30 ? ? HG A SER 32 ? ? 1.59 6 7 HZ1 A LYS 45 ? ? OD2 A ASP 73 ? ? 1.59 7 8 HZ3 A LYS 37 ? ? OD2 B ASP 6 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 41 ? ? 154.31 -20.53 2 1 ASN A 60 ? ? 75.70 -0.85 3 1 ASN A 74 ? ? -86.99 34.24 4 1 LEU A 80 ? ? 73.62 -47.29 5 1 ILE B 9 ? ? -67.55 94.04 6 1 GLU B 10 ? ? -156.24 -63.50 7 2 THR A 41 ? ? -163.74 -46.32 8 2 LEU A 80 ? ? 72.72 -36.24 9 2 SER B 11 ? ? -141.29 -57.30 10 2 SER B 12 ? ? -166.75 -86.73 11 2 SER B 13 ? ? -94.48 50.59 12 3 THR A 41 ? ? -166.80 -60.31 13 3 ASN A 60 ? ? 78.96 -0.19 14 3 LEU A 80 ? ? 72.04 -29.96 15 3 GLU A 83 ? ? -125.37 -169.06 16 4 THR A 41 ? ? 168.52 -36.48 17 4 LEU A 80 ? ? 70.13 -9.37 18 5 THR A 41 ? ? -164.88 -51.59 19 5 ASN A 60 ? ? 78.53 -12.09 20 5 LEU A 80 ? ? 73.05 -29.54 21 6 THR A 41 ? ? -166.30 -55.82 22 6 LEU A 80 ? ? 72.07 -54.75 23 6 GLU A 83 ? ? -124.79 -168.74 24 6 GLU B 10 ? ? -144.24 -67.43 25 6 SER B 12 ? ? -55.37 108.22 26 6 SER B 13 ? ? -165.53 -23.62 27 7 MET A 40 ? ? -69.39 86.20 28 7 THR A 41 ? ? -164.53 -52.32 29 7 ASN A 60 ? ? -170.10 -18.36 30 7 LEU A 80 ? ? 68.68 -1.13 31 8 THR A 41 ? ? -167.74 -46.90 32 8 LEU A 80 ? ? 73.92 -49.94 33 8 SER B 11 ? ? -132.61 -54.71 34 9 THR A 41 ? ? -165.04 -59.42 35 9 ASN A 60 ? ? -156.87 -16.12 36 9 LEU A 80 ? ? 73.13 -3.23 37 10 THR A 41 ? ? -170.45 -44.62 38 10 LEU A 80 ? ? 73.38 -42.56 # _pdbx_nmr_ensemble.entry_id 2ASQ _pdbx_nmr_ensemble.conformers_calculated_total_number 10 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'all calculated structures submitted' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1 mM 15N,13C-enriched PIASx-P peptide and unlabeled SUMO-1; 20mM phosphate buffer pH6.8; 92% H2O, 8% D2O, 17oC' '92% H2O, 8% D2O' 2 '1 mM 15N,13C-enriched SUMO-1 and unlabeled PIASx-P peptide; 20mM phosphate buffer pH6.8; 92% H2O, 8% D2O, 17oC' '92% H2O, 8% D2O' # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 HNCA-J 1 3 2 3D_13C-separated_NOESY 2 4 2 HNCA-J 2 5 1 HCCH-TOCSY 1 6 2 'CC(co)NH' 2 # _pdbx_nmr_refine.entry_id 2ASQ _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 1.1 Bruker 1 processing NMRPipe 1.1 'Delaglio, Frank' 2 refinement HADDOCK 1.3 'Bonvin, Alexandre' 3 'data analysis' Felix 2000 Accelrys 4 'data analysis' NMRView 5 'One Moon Scientific' 5 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A ASP 3 ? A ASP 3 4 1 Y 1 A GLN 4 ? A GLN 4 5 1 Y 1 A GLU 5 ? A GLU 5 6 1 Y 1 A ALA 6 ? A ALA 6 7 1 Y 1 A LYS 7 ? A LYS 7 8 1 Y 1 A PRO 8 ? A PRO 8 9 1 Y 1 A SER 9 ? A SER 9 10 1 Y 1 A THR 10 ? A THR 10 11 1 Y 1 A GLU 11 ? A GLU 11 12 1 Y 1 A ASP 12 ? A ASP 12 13 1 Y 1 A LEU 13 ? A LEU 13 14 1 Y 1 A GLY 14 ? A GLY 14 15 1 Y 1 A ASP 15 ? A ASP 15 16 1 Y 1 A LYS 16 ? A LYS 16 17 1 Y 1 A LYS 17 ? A LYS 17 18 1 Y 1 A GLU 18 ? A GLU 18 19 1 Y 1 A GLY 19 ? A GLY 19 20 1 Y 1 A GLU 20 ? A GLU 20 21 1 Y 1 B GLU 15 ? B GLU 15 22 1 Y 1 B GLU 16 ? B GLU 16 23 1 Y 1 B GLU 17 ? B GLU 17 24 1 Y 1 B ASP 18 ? B ASP 18 25 1 Y 1 B PRO 19 ? B PRO 19 26 1 Y 1 B PRO 20 ? B PRO 20 27 1 Y 1 B ALA 21 ? B ALA 21 28 1 Y 1 B LYS 22 ? B LYS 22 29 1 Y 1 B ARG 23 ? B ARG 23 30 1 Y 1 B GLN 24 ? B GLN 24 31 1 Y 1 B MET 25 ? B MET 25 32 2 Y 1 A MET 1 ? A MET 1 33 2 Y 1 A SER 2 ? A SER 2 34 2 Y 1 A ASP 3 ? A ASP 3 35 2 Y 1 A GLN 4 ? A GLN 4 36 2 Y 1 A GLU 5 ? A GLU 5 37 2 Y 1 A ALA 6 ? A ALA 6 38 2 Y 1 A LYS 7 ? A LYS 7 39 2 Y 1 A PRO 8 ? A PRO 8 40 2 Y 1 A SER 9 ? A SER 9 41 2 Y 1 A THR 10 ? A THR 10 42 2 Y 1 A GLU 11 ? A GLU 11 43 2 Y 1 A ASP 12 ? A ASP 12 44 2 Y 1 A LEU 13 ? A LEU 13 45 2 Y 1 A GLY 14 ? A GLY 14 46 2 Y 1 A ASP 15 ? A ASP 15 47 2 Y 1 A LYS 16 ? A LYS 16 48 2 Y 1 A LYS 17 ? A LYS 17 49 2 Y 1 A GLU 18 ? A GLU 18 50 2 Y 1 A GLY 19 ? A GLY 19 51 2 Y 1 A GLU 20 ? A GLU 20 52 2 Y 1 B GLU 15 ? B GLU 15 53 2 Y 1 B GLU 16 ? B GLU 16 54 2 Y 1 B GLU 17 ? B GLU 17 55 2 Y 1 B ASP 18 ? B ASP 18 56 2 Y 1 B PRO 19 ? B PRO 19 57 2 Y 1 B PRO 20 ? B PRO 20 58 2 Y 1 B ALA 21 ? B ALA 21 59 2 Y 1 B LYS 22 ? B LYS 22 60 2 Y 1 B ARG 23 ? B ARG 23 61 2 Y 1 B GLN 24 ? B GLN 24 62 2 Y 1 B MET 25 ? B MET 25 63 3 Y 1 A MET 1 ? A MET 1 64 3 Y 1 A SER 2 ? A SER 2 65 3 Y 1 A ASP 3 ? A ASP 3 66 3 Y 1 A GLN 4 ? A GLN 4 67 3 Y 1 A GLU 5 ? A GLU 5 68 3 Y 1 A ALA 6 ? A ALA 6 69 3 Y 1 A LYS 7 ? A LYS 7 70 3 Y 1 A PRO 8 ? A PRO 8 71 3 Y 1 A SER 9 ? A SER 9 72 3 Y 1 A THR 10 ? A THR 10 73 3 Y 1 A GLU 11 ? A GLU 11 74 3 Y 1 A ASP 12 ? A ASP 12 75 3 Y 1 A LEU 13 ? A LEU 13 76 3 Y 1 A GLY 14 ? A GLY 14 77 3 Y 1 A ASP 15 ? A ASP 15 78 3 Y 1 A LYS 16 ? A LYS 16 79 3 Y 1 A LYS 17 ? A LYS 17 80 3 Y 1 A GLU 18 ? A GLU 18 81 3 Y 1 A GLY 19 ? A GLY 19 82 3 Y 1 A GLU 20 ? A GLU 20 83 3 Y 1 B GLU 15 ? B GLU 15 84 3 Y 1 B GLU 16 ? B GLU 16 85 3 Y 1 B GLU 17 ? B GLU 17 86 3 Y 1 B ASP 18 ? B ASP 18 87 3 Y 1 B PRO 19 ? B PRO 19 88 3 Y 1 B PRO 20 ? B PRO 20 89 3 Y 1 B ALA 21 ? B ALA 21 90 3 Y 1 B LYS 22 ? B LYS 22 91 3 Y 1 B ARG 23 ? B ARG 23 92 3 Y 1 B GLN 24 ? B GLN 24 93 3 Y 1 B MET 25 ? B MET 25 94 4 Y 1 A MET 1 ? A MET 1 95 4 Y 1 A SER 2 ? A SER 2 96 4 Y 1 A ASP 3 ? A ASP 3 97 4 Y 1 A GLN 4 ? A GLN 4 98 4 Y 1 A GLU 5 ? A GLU 5 99 4 Y 1 A ALA 6 ? A ALA 6 100 4 Y 1 A LYS 7 ? A LYS 7 101 4 Y 1 A PRO 8 ? A PRO 8 102 4 Y 1 A SER 9 ? A SER 9 103 4 Y 1 A THR 10 ? A THR 10 104 4 Y 1 A GLU 11 ? A GLU 11 105 4 Y 1 A ASP 12 ? A ASP 12 106 4 Y 1 A LEU 13 ? A LEU 13 107 4 Y 1 A GLY 14 ? A GLY 14 108 4 Y 1 A ASP 15 ? A ASP 15 109 4 Y 1 A LYS 16 ? A LYS 16 110 4 Y 1 A LYS 17 ? A LYS 17 111 4 Y 1 A GLU 18 ? A GLU 18 112 4 Y 1 A GLY 19 ? A GLY 19 113 4 Y 1 A GLU 20 ? A GLU 20 114 4 Y 1 B GLU 15 ? B GLU 15 115 4 Y 1 B GLU 16 ? B GLU 16 116 4 Y 1 B GLU 17 ? B GLU 17 117 4 Y 1 B ASP 18 ? B ASP 18 118 4 Y 1 B PRO 19 ? B PRO 19 119 4 Y 1 B PRO 20 ? B PRO 20 120 4 Y 1 B ALA 21 ? B ALA 21 121 4 Y 1 B LYS 22 ? B LYS 22 122 4 Y 1 B ARG 23 ? B ARG 23 123 4 Y 1 B GLN 24 ? B GLN 24 124 4 Y 1 B MET 25 ? B MET 25 125 5 Y 1 A MET 1 ? A MET 1 126 5 Y 1 A SER 2 ? A SER 2 127 5 Y 1 A ASP 3 ? A ASP 3 128 5 Y 1 A GLN 4 ? A GLN 4 129 5 Y 1 A GLU 5 ? A GLU 5 130 5 Y 1 A ALA 6 ? A ALA 6 131 5 Y 1 A LYS 7 ? A LYS 7 132 5 Y 1 A PRO 8 ? A PRO 8 133 5 Y 1 A SER 9 ? A SER 9 134 5 Y 1 A THR 10 ? A THR 10 135 5 Y 1 A GLU 11 ? A GLU 11 136 5 Y 1 A ASP 12 ? A ASP 12 137 5 Y 1 A LEU 13 ? A LEU 13 138 5 Y 1 A GLY 14 ? A GLY 14 139 5 Y 1 A ASP 15 ? A ASP 15 140 5 Y 1 A LYS 16 ? A LYS 16 141 5 Y 1 A LYS 17 ? A LYS 17 142 5 Y 1 A GLU 18 ? A GLU 18 143 5 Y 1 A GLY 19 ? A GLY 19 144 5 Y 1 A GLU 20 ? A GLU 20 145 5 Y 1 B GLU 15 ? B GLU 15 146 5 Y 1 B GLU 16 ? B GLU 16 147 5 Y 1 B GLU 17 ? B GLU 17 148 5 Y 1 B ASP 18 ? B ASP 18 149 5 Y 1 B PRO 19 ? B PRO 19 150 5 Y 1 B PRO 20 ? B PRO 20 151 5 Y 1 B ALA 21 ? B ALA 21 152 5 Y 1 B LYS 22 ? B LYS 22 153 5 Y 1 B ARG 23 ? B ARG 23 154 5 Y 1 B GLN 24 ? B GLN 24 155 5 Y 1 B MET 25 ? B MET 25 156 6 Y 1 A MET 1 ? A MET 1 157 6 Y 1 A SER 2 ? A SER 2 158 6 Y 1 A ASP 3 ? A ASP 3 159 6 Y 1 A GLN 4 ? A GLN 4 160 6 Y 1 A GLU 5 ? A GLU 5 161 6 Y 1 A ALA 6 ? A ALA 6 162 6 Y 1 A LYS 7 ? A LYS 7 163 6 Y 1 A PRO 8 ? A PRO 8 164 6 Y 1 A SER 9 ? A SER 9 165 6 Y 1 A THR 10 ? A THR 10 166 6 Y 1 A GLU 11 ? A GLU 11 167 6 Y 1 A ASP 12 ? A ASP 12 168 6 Y 1 A LEU 13 ? A LEU 13 169 6 Y 1 A GLY 14 ? A GLY 14 170 6 Y 1 A ASP 15 ? A ASP 15 171 6 Y 1 A LYS 16 ? A LYS 16 172 6 Y 1 A LYS 17 ? A LYS 17 173 6 Y 1 A GLU 18 ? A GLU 18 174 6 Y 1 A GLY 19 ? A GLY 19 175 6 Y 1 A GLU 20 ? A GLU 20 176 6 Y 1 B GLU 15 ? B GLU 15 177 6 Y 1 B GLU 16 ? B GLU 16 178 6 Y 1 B GLU 17 ? B GLU 17 179 6 Y 1 B ASP 18 ? B ASP 18 180 6 Y 1 B PRO 19 ? B PRO 19 181 6 Y 1 B PRO 20 ? B PRO 20 182 6 Y 1 B ALA 21 ? B ALA 21 183 6 Y 1 B LYS 22 ? B LYS 22 184 6 Y 1 B ARG 23 ? B ARG 23 185 6 Y 1 B GLN 24 ? B GLN 24 186 6 Y 1 B MET 25 ? B MET 25 187 7 Y 1 A MET 1 ? A MET 1 188 7 Y 1 A SER 2 ? A SER 2 189 7 Y 1 A ASP 3 ? A ASP 3 190 7 Y 1 A GLN 4 ? A GLN 4 191 7 Y 1 A GLU 5 ? A GLU 5 192 7 Y 1 A ALA 6 ? A ALA 6 193 7 Y 1 A LYS 7 ? A LYS 7 194 7 Y 1 A PRO 8 ? A PRO 8 195 7 Y 1 A SER 9 ? A SER 9 196 7 Y 1 A THR 10 ? A THR 10 197 7 Y 1 A GLU 11 ? A GLU 11 198 7 Y 1 A ASP 12 ? A ASP 12 199 7 Y 1 A LEU 13 ? A LEU 13 200 7 Y 1 A GLY 14 ? A GLY 14 201 7 Y 1 A ASP 15 ? A ASP 15 202 7 Y 1 A LYS 16 ? A LYS 16 203 7 Y 1 A LYS 17 ? A LYS 17 204 7 Y 1 A GLU 18 ? A GLU 18 205 7 Y 1 A GLY 19 ? A GLY 19 206 7 Y 1 A GLU 20 ? A GLU 20 207 7 Y 1 B GLU 15 ? B GLU 15 208 7 Y 1 B GLU 16 ? B GLU 16 209 7 Y 1 B GLU 17 ? B GLU 17 210 7 Y 1 B ASP 18 ? B ASP 18 211 7 Y 1 B PRO 19 ? B PRO 19 212 7 Y 1 B PRO 20 ? B PRO 20 213 7 Y 1 B ALA 21 ? B ALA 21 214 7 Y 1 B LYS 22 ? B LYS 22 215 7 Y 1 B ARG 23 ? B ARG 23 216 7 Y 1 B GLN 24 ? B GLN 24 217 7 Y 1 B MET 25 ? B MET 25 218 8 Y 1 A MET 1 ? A MET 1 219 8 Y 1 A SER 2 ? A SER 2 220 8 Y 1 A ASP 3 ? A ASP 3 221 8 Y 1 A GLN 4 ? A GLN 4 222 8 Y 1 A GLU 5 ? A GLU 5 223 8 Y 1 A ALA 6 ? A ALA 6 224 8 Y 1 A LYS 7 ? A LYS 7 225 8 Y 1 A PRO 8 ? A PRO 8 226 8 Y 1 A SER 9 ? A SER 9 227 8 Y 1 A THR 10 ? A THR 10 228 8 Y 1 A GLU 11 ? A GLU 11 229 8 Y 1 A ASP 12 ? A ASP 12 230 8 Y 1 A LEU 13 ? A LEU 13 231 8 Y 1 A GLY 14 ? A GLY 14 232 8 Y 1 A ASP 15 ? A ASP 15 233 8 Y 1 A LYS 16 ? A LYS 16 234 8 Y 1 A LYS 17 ? A LYS 17 235 8 Y 1 A GLU 18 ? A GLU 18 236 8 Y 1 A GLY 19 ? A GLY 19 237 8 Y 1 A GLU 20 ? A GLU 20 238 8 Y 1 B GLU 15 ? B GLU 15 239 8 Y 1 B GLU 16 ? B GLU 16 240 8 Y 1 B GLU 17 ? B GLU 17 241 8 Y 1 B ASP 18 ? B ASP 18 242 8 Y 1 B PRO 19 ? B PRO 19 243 8 Y 1 B PRO 20 ? B PRO 20 244 8 Y 1 B ALA 21 ? B ALA 21 245 8 Y 1 B LYS 22 ? B LYS 22 246 8 Y 1 B ARG 23 ? B ARG 23 247 8 Y 1 B GLN 24 ? B GLN 24 248 8 Y 1 B MET 25 ? B MET 25 249 9 Y 1 A MET 1 ? A MET 1 250 9 Y 1 A SER 2 ? A SER 2 251 9 Y 1 A ASP 3 ? A ASP 3 252 9 Y 1 A GLN 4 ? A GLN 4 253 9 Y 1 A GLU 5 ? A GLU 5 254 9 Y 1 A ALA 6 ? A ALA 6 255 9 Y 1 A LYS 7 ? A LYS 7 256 9 Y 1 A PRO 8 ? A PRO 8 257 9 Y 1 A SER 9 ? A SER 9 258 9 Y 1 A THR 10 ? A THR 10 259 9 Y 1 A GLU 11 ? A GLU 11 260 9 Y 1 A ASP 12 ? A ASP 12 261 9 Y 1 A LEU 13 ? A LEU 13 262 9 Y 1 A GLY 14 ? A GLY 14 263 9 Y 1 A ASP 15 ? A ASP 15 264 9 Y 1 A LYS 16 ? A LYS 16 265 9 Y 1 A LYS 17 ? A LYS 17 266 9 Y 1 A GLU 18 ? A GLU 18 267 9 Y 1 A GLY 19 ? A GLY 19 268 9 Y 1 A GLU 20 ? A GLU 20 269 9 Y 1 B GLU 15 ? B GLU 15 270 9 Y 1 B GLU 16 ? B GLU 16 271 9 Y 1 B GLU 17 ? B GLU 17 272 9 Y 1 B ASP 18 ? B ASP 18 273 9 Y 1 B PRO 19 ? B PRO 19 274 9 Y 1 B PRO 20 ? B PRO 20 275 9 Y 1 B ALA 21 ? B ALA 21 276 9 Y 1 B LYS 22 ? B LYS 22 277 9 Y 1 B ARG 23 ? B ARG 23 278 9 Y 1 B GLN 24 ? B GLN 24 279 9 Y 1 B MET 25 ? B MET 25 280 10 Y 1 A MET 1 ? A MET 1 281 10 Y 1 A SER 2 ? A SER 2 282 10 Y 1 A ASP 3 ? A ASP 3 283 10 Y 1 A GLN 4 ? A GLN 4 284 10 Y 1 A GLU 5 ? A GLU 5 285 10 Y 1 A ALA 6 ? A ALA 6 286 10 Y 1 A LYS 7 ? A LYS 7 287 10 Y 1 A PRO 8 ? A PRO 8 288 10 Y 1 A SER 9 ? A SER 9 289 10 Y 1 A THR 10 ? A THR 10 290 10 Y 1 A GLU 11 ? A GLU 11 291 10 Y 1 A ASP 12 ? A ASP 12 292 10 Y 1 A LEU 13 ? A LEU 13 293 10 Y 1 A GLY 14 ? A GLY 14 294 10 Y 1 A ASP 15 ? A ASP 15 295 10 Y 1 A LYS 16 ? A LYS 16 296 10 Y 1 A LYS 17 ? A LYS 17 297 10 Y 1 A GLU 18 ? A GLU 18 298 10 Y 1 A GLY 19 ? A GLY 19 299 10 Y 1 A GLU 20 ? A GLU 20 300 10 Y 1 B GLU 15 ? B GLU 15 301 10 Y 1 B GLU 16 ? B GLU 16 302 10 Y 1 B GLU 17 ? B GLU 17 303 10 Y 1 B ASP 18 ? B ASP 18 304 10 Y 1 B PRO 19 ? B PRO 19 305 10 Y 1 B PRO 20 ? B PRO 20 306 10 Y 1 B ALA 21 ? B ALA 21 307 10 Y 1 B LYS 22 ? B LYS 22 308 10 Y 1 B ARG 23 ? B ARG 23 309 10 Y 1 B GLN 24 ? B GLN 24 310 10 Y 1 B MET 25 ? B MET 25 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2ASQ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_