data_2AYK # _entry.id 2AYK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2AYK pdb_00002ayk 10.2210/pdb2ayk/pdb WWPDB D_1000177800 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1AYK _pdbx_database_related.details . _pdbx_database_related.content_type ensemble # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2AYK _pdbx_database_status.recvd_initial_deposition_date 1997-11-06 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Powers, R.' 1 'Moy, F.J.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;High-resolution solution structure of the inhibitor-free catalytic fragment of human fibroblast collagenase determined by multidimensional NMR. ; Biochemistry 37 1495 1504 1998 BICHAW US 0006-2960 0033 ? 9484219 10.1021/bi972181w 1 'Assignments, Secondary Structure and Dynamics of the Inhibitor-Free Catalytic Fragment of Human Fibroblast Collagenase' J.Biomol.NMR 1 9 ? 1997 JBNME9 NE 0925-2738 0800 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Moy, F.J.' 1 ? primary 'Chanda, P.K.' 2 ? primary 'Cosmi, S.' 3 ? primary 'Pisano, M.R.' 4 ? primary 'Urbano, C.' 5 ? primary 'Wilhelm, J.' 6 ? primary 'Powers, R.' 7 ? 1 'Moy, F.J.' 8 ? 1 'Pisano, M.R.' 9 ? 1 'Chanda, P.K.' 10 ? 1 'Urbano, C.' 11 ? 1 'Killar, L.M.' 12 ? 1 'Sung, M.-L.' 13 ? 1 'Powers, R.' 14 ? # _cell.entry_id 2AYK _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2AYK _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man COLLAGENASE 18865.541 1 3.4.24.7 ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 3 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'MMP-1, FIBROBLAST COLLAGENASE' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;VLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGN LAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIY GRSQNPVQP ; _entity_poly.pdbx_seq_one_letter_code_can ;VLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGN LAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIY GRSQNPVQP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 LEU n 1 3 THR n 1 4 GLU n 1 5 GLY n 1 6 ASN n 1 7 PRO n 1 8 ARG n 1 9 TRP n 1 10 GLU n 1 11 GLN n 1 12 THR n 1 13 HIS n 1 14 LEU n 1 15 THR n 1 16 TYR n 1 17 ARG n 1 18 ILE n 1 19 GLU n 1 20 ASN n 1 21 TYR n 1 22 THR n 1 23 PRO n 1 24 ASP n 1 25 LEU n 1 26 PRO n 1 27 ARG n 1 28 ALA n 1 29 ASP n 1 30 VAL n 1 31 ASP n 1 32 HIS n 1 33 ALA n 1 34 ILE n 1 35 GLU n 1 36 LYS n 1 37 ALA n 1 38 PHE n 1 39 GLN n 1 40 LEU n 1 41 TRP n 1 42 SER n 1 43 ASN n 1 44 VAL n 1 45 THR n 1 46 PRO n 1 47 LEU n 1 48 THR n 1 49 PHE n 1 50 THR n 1 51 LYS n 1 52 VAL n 1 53 SER n 1 54 GLU n 1 55 GLY n 1 56 GLN n 1 57 ALA n 1 58 ASP n 1 59 ILE n 1 60 MET n 1 61 ILE n 1 62 SER n 1 63 PHE n 1 64 VAL n 1 65 ARG n 1 66 GLY n 1 67 ASP n 1 68 HIS n 1 69 ARG n 1 70 ASP n 1 71 ASN n 1 72 SER n 1 73 PRO n 1 74 PHE n 1 75 ASP n 1 76 GLY n 1 77 PRO n 1 78 GLY n 1 79 GLY n 1 80 ASN n 1 81 LEU n 1 82 ALA n 1 83 HIS n 1 84 ALA n 1 85 PHE n 1 86 GLN n 1 87 PRO n 1 88 GLY n 1 89 PRO n 1 90 GLY n 1 91 ILE n 1 92 GLY n 1 93 GLY n 1 94 ASP n 1 95 ALA n 1 96 HIS n 1 97 PHE n 1 98 ASP n 1 99 GLU n 1 100 ASP n 1 101 GLU n 1 102 ARG n 1 103 TRP n 1 104 THR n 1 105 ASN n 1 106 ASN n 1 107 PHE n 1 108 ARG n 1 109 GLU n 1 110 TYR n 1 111 ASN n 1 112 LEU n 1 113 HIS n 1 114 ARG n 1 115 VAL n 1 116 ALA n 1 117 ALA n 1 118 HIS n 1 119 GLU n 1 120 LEU n 1 121 GLY n 1 122 HIS n 1 123 SER n 1 124 LEU n 1 125 GLY n 1 126 LEU n 1 127 SER n 1 128 HIS n 1 129 SER n 1 130 THR n 1 131 ASP n 1 132 ILE n 1 133 GLY n 1 134 ALA n 1 135 LEU n 1 136 MET n 1 137 TYR n 1 138 PRO n 1 139 SER n 1 140 TYR n 1 141 THR n 1 142 PHE n 1 143 SER n 1 144 GLY n 1 145 ASP n 1 146 VAL n 1 147 GLN n 1 148 LEU n 1 149 ALA n 1 150 GLN n 1 151 ASP n 1 152 ASP n 1 153 ILE n 1 154 ASP n 1 155 GLY n 1 156 ILE n 1 157 GLN n 1 158 ALA n 1 159 ILE n 1 160 TYR n 1 161 GLY n 1 162 ARG n 1 163 SER n 1 164 GLN n 1 165 ASN n 1 166 PRO n 1 167 VAL n 1 168 GLN n 1 169 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line BL21 _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'PET-21A(+)' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PNOT-3A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MMP1_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P03956 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPD AETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIM ISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSY TFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVF WPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRY DEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2AYK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 169 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P03956 _struct_ref_seq.db_align_beg 101 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 269 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 169 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 NOESY 1 2 1 COSY 1 3 1 TOCSY 1 4 1 TRIPLE-RESONANCE 1 5 1 ETC. 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 308 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '10 mM TRIS BASE, 100 mM NACL, 5 mM CACL2, 0.1 mM ZNCL2, 2mM NAN3, 10 mM DEUTERATED DTT, 90% H2O/10%D2O OR 100% D2O' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AMX2600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 2AYK _pdbx_nmr_refine.method 'HYBRID DISTANCE GEOMETRY-DYNAMICAL SIMULATED ANNEALING METHOD' _pdbx_nmr_refine.details 'REFINEMENT DETAILS CAN BE FOUND IN THE JRNL CITATION ABOVE.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2AYK _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'LOWEST ENERGY, LOWEST VIOLATIONS, CONSISTENT FOLD' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.84 BRUNGER 1 'structure solution' X-PLOR ? ? 2 # _exptl.entry_id 2AYK _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2AYK _struct.title 'INHIBITOR-FREE CATALYTIC FRAGMENT OF HUMAN FIBROBLAST COLLAGENASE, NMR, MINIMIZED AVERAGE STRUCTURE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2AYK _struct_keywords.pdbx_keywords METALLOPROTEASE _struct_keywords.text 'MATRIX METALLOPROTEINASE, HYDROLASE, METALLOPROTEASE, GLYCOPROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A Y N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 27 ? ASN A 43 ? ARG A 27 ASN A 43 1 ? 17 HELX_P HELX_P2 2 LEU A 112 ? SER A 123 ? LEU A 112 SER A 123 1 ? 12 HELX_P HELX_P3 3 GLN A 150 ? ILE A 159 ? GLN A 150 ILE A 159 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 68 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 68 A ZN 171 1_555 ? ? ? ? ? ? ? 1.977 ? ? metalc2 metalc ? ? A ASP 70 OD2 ? ? ? 1_555 C ZN . ZN ? ? A ASP 70 A ZN 171 1_555 ? ? ? ? ? ? ? 2.213 ? ? metalc3 metalc ? ? A GLY 76 O ? ? ? 1_555 D CA . CA ? ? A GLY 76 A CA 172 1_555 ? ? ? ? ? ? ? 2.893 ? ? metalc4 metalc ? ? A GLY 78 O ? ? ? 1_555 D CA . CA ? ? A GLY 78 A CA 172 1_555 ? ? ? ? ? ? ? 2.880 ? ? metalc5 metalc ? ? A ASN 80 O ? ? ? 1_555 D CA . CA ? ? A ASN 80 A CA 172 1_555 ? ? ? ? ? ? ? 2.901 ? ? metalc6 metalc ? ? A HIS 83 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 83 A ZN 171 1_555 ? ? ? ? ? ? ? 2.089 ? ? metalc7 metalc ? ? A HIS 96 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 96 A ZN 171 1_555 ? ? ? ? ? ? ? 2.117 ? ? metalc8 metalc ? ? A ASP 98 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 98 A CA 172 1_555 ? ? ? ? ? ? ? 2.901 ? ? metalc9 metalc ? ? A GLU 101 OE2 ? ? ? 1_555 D CA . CA ? ? A GLU 101 A CA 172 1_555 ? ? ? ? ? ? ? 2.878 ? ? metalc10 metalc ? ? A HIS 118 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 118 A ZN 170 1_555 ? ? ? ? ? ? ? 2.060 ? ? metalc11 metalc ? ? A HIS 122 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 122 A ZN 170 1_555 ? ? ? ? ? ? ? 2.006 ? ? metalc12 metalc ? ? A HIS 128 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 128 A ZN 170 1_555 ? ? ? ? ? ? ? 2.108 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 48 ? LYS A 51 ? THR A 48 LYS A 51 A 2 HIS A 13 ? ILE A 18 ? HIS A 13 ILE A 18 A 3 ILE A 59 ? VAL A 64 ? ILE A 59 VAL A 64 A 4 ALA A 95 ? ASP A 98 ? ALA A 95 ASP A 98 A 5 ALA A 82 ? ALA A 84 ? ALA A 82 ALA A 84 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O THR A 48 ? O THR A 48 N LEU A 14 ? N LEU A 14 A 2 3 O ARG A 17 ? O ARG A 17 N ILE A 59 ? N ILE A 59 A 3 4 O SER A 62 ? O SER A 62 N ALA A 95 ? N ALA A 95 A 4 5 O HIS A 96 ? O HIS A 96 N HIS A 83 ? N HIS A 83 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details ZNA Unknown ? ? ? ? 3 'ZN BINDING SITE.' ZNB Unknown ? ? ? ? 3 'ZN BINDING SITE.' CAB Unknown ? ? ? ? 3 'CA BINDING SITE.' AC1 Software A ZN 170 ? 3 'BINDING SITE FOR RESIDUE ZN A 170' AC2 Software A ZN 171 ? 4 'BINDING SITE FOR RESIDUE ZN A 171' AC3 Software A CA 172 ? 5 'BINDING SITE FOR RESIDUE CA A 172' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 ZNA 3 HIS A 118 ? HIS A 118 . ? 1_555 ? 2 ZNA 3 HIS A 122 ? HIS A 122 . ? 1_555 ? 3 ZNA 3 HIS A 128 ? HIS A 128 . ? 1_555 ? 4 ZNB 3 HIS A 68 ? HIS A 68 . ? 1_555 ? 5 ZNB 3 HIS A 83 ? HIS A 83 . ? 1_555 ? 6 ZNB 3 HIS A 96 ? HIS A 96 . ? 1_555 ? 7 CAB 3 GLY A 76 ? GLY A 76 . ? 1_555 ? 8 CAB 3 GLY A 78 ? GLY A 78 . ? 1_555 ? 9 CAB 3 ASN A 80 ? ASN A 80 . ? 1_555 ? 10 AC1 3 HIS A 118 ? HIS A 118 . ? 1_555 ? 11 AC1 3 HIS A 122 ? HIS A 122 . ? 1_555 ? 12 AC1 3 HIS A 128 ? HIS A 128 . ? 1_555 ? 13 AC2 4 HIS A 68 ? HIS A 68 . ? 1_555 ? 14 AC2 4 ASP A 70 ? ASP A 70 . ? 1_555 ? 15 AC2 4 HIS A 83 ? HIS A 83 . ? 1_555 ? 16 AC2 4 HIS A 96 ? HIS A 96 . ? 1_555 ? 17 AC3 5 GLY A 76 ? GLY A 76 . ? 1_555 ? 18 AC3 5 GLY A 78 ? GLY A 78 . ? 1_555 ? 19 AC3 5 ASN A 80 ? ASN A 80 . ? 1_555 ? 20 AC3 5 ASP A 98 ? ASP A 98 . ? 1_555 ? 21 AC3 5 GLU A 101 ? GLU A 101 . ? 1_555 ? # _database_PDB_matrix.entry_id 2AYK _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2AYK _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 ? ? ? A . n A 1 2 LEU 2 2 ? ? ? A . n A 1 3 THR 3 3 ? ? ? A . n A 1 4 GLU 4 4 ? ? ? A . n A 1 5 GLY 5 5 ? ? ? A . n A 1 6 ASN 6 6 ? ? ? A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 TRP 9 9 9 TRP TRP A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 TRP 41 41 41 TRP TRP A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 HIS 83 83 83 HIS HIS A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 PHE 85 85 85 PHE PHE A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 PHE 97 97 97 PHE PHE A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 TRP 103 103 103 TRP TRP A . n A 1 104 THR 104 104 104 THR THR A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 ARG 108 108 108 ARG ARG A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 TYR 110 110 110 TYR TYR A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 HIS 113 113 113 HIS HIS A . n A 1 114 ARG 114 114 114 ARG ARG A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 HIS 118 118 118 HIS HIS A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 HIS 122 122 122 HIS HIS A . n A 1 123 SER 123 123 123 SER SER A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 SER 127 127 127 SER SER A . n A 1 128 HIS 128 128 128 HIS HIS A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 MET 136 136 136 MET MET A . n A 1 137 TYR 137 137 137 TYR TYR A . n A 1 138 PRO 138 138 138 PRO PRO A . n A 1 139 SER 139 139 139 SER SER A . n A 1 140 TYR 140 140 140 TYR TYR A . n A 1 141 THR 141 141 141 THR THR A . n A 1 142 PHE 142 142 142 PHE PHE A . n A 1 143 SER 143 143 143 SER SER A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 VAL 146 146 146 VAL VAL A . n A 1 147 GLN 147 147 147 GLN GLN A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 GLN 150 150 150 GLN GLN A . n A 1 151 ASP 151 151 151 ASP ASP A . n A 1 152 ASP 152 152 152 ASP ASP A . n A 1 153 ILE 153 153 153 ILE ILE A . n A 1 154 ASP 154 154 154 ASP ASP A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 GLN 157 157 157 GLN GLN A . n A 1 158 ALA 158 158 158 ALA ALA A . n A 1 159 ILE 159 159 159 ILE ILE A . n A 1 160 TYR 160 160 160 TYR TYR A . n A 1 161 GLY 161 161 161 GLY GLY A . n A 1 162 ARG 162 162 162 ARG ARG A . n A 1 163 SER 163 163 163 SER SER A . n A 1 164 GLN 164 164 ? ? ? A . n A 1 165 ASN 165 165 ? ? ? A . n A 1 166 PRO 166 166 ? ? ? A . n A 1 167 VAL 167 167 ? ? ? A . n A 1 168 GLN 168 168 ? ? ? A . n A 1 169 PRO 169 169 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 170 170 ZN ZN A . C 2 ZN 1 171 171 ZN ZN A . D 3 CA 1 172 172 CA CA A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 68 ? A HIS 68 ? 1_555 ZN ? C ZN . ? A ZN 171 ? 1_555 OD2 ? A ASP 70 ? A ASP 70 ? 1_555 74.9 ? 2 NE2 ? A HIS 68 ? A HIS 68 ? 1_555 ZN ? C ZN . ? A ZN 171 ? 1_555 NE2 ? A HIS 83 ? A HIS 83 ? 1_555 121.6 ? 3 OD2 ? A ASP 70 ? A ASP 70 ? 1_555 ZN ? C ZN . ? A ZN 171 ? 1_555 NE2 ? A HIS 83 ? A HIS 83 ? 1_555 136.8 ? 4 NE2 ? A HIS 68 ? A HIS 68 ? 1_555 ZN ? C ZN . ? A ZN 171 ? 1_555 ND1 ? A HIS 96 ? A HIS 96 ? 1_555 100.4 ? 5 OD2 ? A ASP 70 ? A ASP 70 ? 1_555 ZN ? C ZN . ? A ZN 171 ? 1_555 ND1 ? A HIS 96 ? A HIS 96 ? 1_555 99.4 ? 6 NE2 ? A HIS 83 ? A HIS 83 ? 1_555 ZN ? C ZN . ? A ZN 171 ? 1_555 ND1 ? A HIS 96 ? A HIS 96 ? 1_555 114.1 ? 7 O ? A GLY 76 ? A GLY 76 ? 1_555 CA ? D CA . ? A CA 172 ? 1_555 O ? A GLY 78 ? A GLY 78 ? 1_555 65.0 ? 8 O ? A GLY 76 ? A GLY 76 ? 1_555 CA ? D CA . ? A CA 172 ? 1_555 O ? A ASN 80 ? A ASN 80 ? 1_555 153.1 ? 9 O ? A GLY 78 ? A GLY 78 ? 1_555 CA ? D CA . ? A CA 172 ? 1_555 O ? A ASN 80 ? A ASN 80 ? 1_555 92.2 ? 10 O ? A GLY 76 ? A GLY 76 ? 1_555 CA ? D CA . ? A CA 172 ? 1_555 OD2 ? A ASP 98 ? A ASP 98 ? 1_555 97.7 ? 11 O ? A GLY 78 ? A GLY 78 ? 1_555 CA ? D CA . ? A CA 172 ? 1_555 OD2 ? A ASP 98 ? A ASP 98 ? 1_555 161.6 ? 12 O ? A ASN 80 ? A ASN 80 ? 1_555 CA ? D CA . ? A CA 172 ? 1_555 OD2 ? A ASP 98 ? A ASP 98 ? 1_555 102.8 ? 13 O ? A GLY 76 ? A GLY 76 ? 1_555 CA ? D CA . ? A CA 172 ? 1_555 OE2 ? A GLU 101 ? A GLU 101 ? 1_555 111.2 ? 14 O ? A GLY 78 ? A GLY 78 ? 1_555 CA ? D CA . ? A CA 172 ? 1_555 OE2 ? A GLU 101 ? A GLU 101 ? 1_555 136.2 ? 15 O ? A ASN 80 ? A ASN 80 ? 1_555 CA ? D CA . ? A CA 172 ? 1_555 OE2 ? A GLU 101 ? A GLU 101 ? 1_555 95.0 ? 16 OD2 ? A ASP 98 ? A ASP 98 ? 1_555 CA ? D CA . ? A CA 172 ? 1_555 OE2 ? A GLU 101 ? A GLU 101 ? 1_555 53.8 ? 17 NE2 ? A HIS 118 ? A HIS 118 ? 1_555 ZN ? B ZN . ? A ZN 170 ? 1_555 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 93.5 ? 18 NE2 ? A HIS 118 ? A HIS 118 ? 1_555 ZN ? B ZN . ? A ZN 170 ? 1_555 NE2 ? A HIS 128 ? A HIS 128 ? 1_555 118.5 ? 19 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 ZN ? B ZN . ? A ZN 170 ? 1_555 NE2 ? A HIS 128 ? A HIS 128 ? 1_555 89.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-02-25 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_atom_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 19 4 'Structure model' '_pdbx_struct_conn_angle.value' 20 4 'Structure model' '_struct_conn.pdbx_dist_value' 21 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 22 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 23 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 24 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 25 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 26 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 27 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 28 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 29 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 30 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 31 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 32 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 33 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 34 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 35 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.84 ? 1 X-PLOR refinement 3.84 ? 2 X-PLOR phasing 3.84 ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 23 ? ? -62.87 0.45 2 1 PRO A 46 ? ? -65.91 7.96 3 1 ASP A 75 ? ? -102.56 66.01 4 1 PRO A 77 ? ? -64.01 1.01 5 1 PRO A 87 ? ? -60.64 97.44 6 1 ASP A 98 ? ? -69.03 96.11 7 1 ARG A 108 ? ? -60.27 -153.84 8 1 HIS A 128 ? ? -56.39 170.67 9 1 TYR A 160 ? ? -100.04 -60.56 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A VAL 1 ? A VAL 1 2 1 Y 1 A LEU 2 ? A LEU 2 3 1 Y 1 A THR 3 ? A THR 3 4 1 Y 1 A GLU 4 ? A GLU 4 5 1 Y 1 A GLY 5 ? A GLY 5 6 1 Y 1 A ASN 6 ? A ASN 6 7 1 Y 1 A GLN 164 ? A GLN 164 8 1 Y 1 A ASN 165 ? A ASN 165 9 1 Y 1 A PRO 166 ? A PRO 166 10 1 Y 1 A VAL 167 ? A VAL 167 11 1 Y 1 A GLN 168 ? A GLN 168 12 1 Y 1 A PRO 169 ? A PRO 169 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'CALCIUM ION' CA #