data_2B58 # _entry.id 2B58 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.338 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2B58 RCSB RCSB034690 WWPDB D_1000034690 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2B3U . unspecified PDB 2B3V . unspecified PDB 2B47 . unspecified PDB 2B4B . unspecified PDB 2B4D . unspecified PDB 2B5G . unspecified TargetDB NYSGXRC-9502a . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2B58 _pdbx_database_status.recvd_initial_deposition_date 2005-09-27 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bewley, M.C.' 1 ? 'Graziano, V.' 2 ? 'Jiang, J.S.' 3 ? 'Matz, E.' 4 ? 'Studier, F.W.' 5 ? 'Pegg, A.P.' 6 ? 'Coleman, C.S.' 7 ? 'Flanagan, J.M.' 8 ? 'Burley, S.K.' 9 0000-0002-2487-9713 'New York SGX Research Center for Structural Genomics (NYSGXRC)' 10 ? # _citation.id primary _citation.title 'Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target' _citation.journal_abbrev Proc.Natl.Acad.Sci.Usa _citation.journal_volume 103 _citation.page_first 2063 _citation.page_last 2068 _citation.year 2006 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16455797 _citation.pdbx_database_id_DOI 10.1073/pnas.0511008103 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bewley, M.C.' 1 ? primary 'Graziano, V.' 2 ? primary 'Jiang, J.S.' 3 ? primary 'Matz, E.' 4 ? primary 'Studier, F.W.' 5 ? primary 'Pegg, A.P.' 6 ? primary 'Coleman, C.S.' 7 ? primary 'Flanagan, J.M.' 8 ? # _cell.entry_id 2B58 _cell.length_a 63.249 _cell.length_b 63.249 _cell.length_c 81.129 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2B58 _symmetry.space_group_name_H-M 'P 62' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 171 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Diamine acetyltransferase 1' 20404.268 1 2.3.1.57 ? ? ? 2 non-polymer syn 'COENZYME A' 767.534 1 ? ? ? ? 3 water nat water 18.015 82 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Spermidine/spermine N1, - acetyltransferase 1, SSAT, SSAT-1, Putrescine acetyltransferase, Polyamine N-acetyltransferase 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)AKFVIRPATAADCSDILRLIKELARYEY(MSE)EEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIV GFA(MSE)YYFTYDPWIGKLLYLEDFFV(MSE)SDYRGFGIGSEILKNLSQVA(MSE)RCRCSS(MSE)HFLVAEWNEPS INFYKRRGASDLSSEEGWRLFKIDKEYLLK(MSE)ATEE ; _entity_poly.pdbx_seq_one_letter_code_can ;MAKFVIRPATAADCSDILRLIKELARYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFT YDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKID KEYLLKMATEE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NYSGXRC-9502a # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ALA n 1 3 LYS n 1 4 PHE n 1 5 VAL n 1 6 ILE n 1 7 ARG n 1 8 PRO n 1 9 ALA n 1 10 THR n 1 11 ALA n 1 12 ALA n 1 13 ASP n 1 14 CYS n 1 15 SER n 1 16 ASP n 1 17 ILE n 1 18 LEU n 1 19 ARG n 1 20 LEU n 1 21 ILE n 1 22 LYS n 1 23 GLU n 1 24 LEU n 1 25 ALA n 1 26 ARG n 1 27 TYR n 1 28 GLU n 1 29 TYR n 1 30 MSE n 1 31 GLU n 1 32 GLU n 1 33 GLN n 1 34 VAL n 1 35 ILE n 1 36 LEU n 1 37 THR n 1 38 GLU n 1 39 LYS n 1 40 ASP n 1 41 LEU n 1 42 LEU n 1 43 GLU n 1 44 ASP n 1 45 GLY n 1 46 PHE n 1 47 GLY n 1 48 GLU n 1 49 HIS n 1 50 PRO n 1 51 PHE n 1 52 TYR n 1 53 HIS n 1 54 CYS n 1 55 LEU n 1 56 VAL n 1 57 ALA n 1 58 GLU n 1 59 VAL n 1 60 PRO n 1 61 LYS n 1 62 GLU n 1 63 HIS n 1 64 TRP n 1 65 THR n 1 66 PRO n 1 67 GLU n 1 68 GLY n 1 69 HIS n 1 70 SER n 1 71 ILE n 1 72 VAL n 1 73 GLY n 1 74 PHE n 1 75 ALA n 1 76 MSE n 1 77 TYR n 1 78 TYR n 1 79 PHE n 1 80 THR n 1 81 TYR n 1 82 ASP n 1 83 PRO n 1 84 TRP n 1 85 ILE n 1 86 GLY n 1 87 LYS n 1 88 LEU n 1 89 LEU n 1 90 TYR n 1 91 LEU n 1 92 GLU n 1 93 ASP n 1 94 PHE n 1 95 PHE n 1 96 VAL n 1 97 MSE n 1 98 SER n 1 99 ASP n 1 100 TYR n 1 101 ARG n 1 102 GLY n 1 103 PHE n 1 104 GLY n 1 105 ILE n 1 106 GLY n 1 107 SER n 1 108 GLU n 1 109 ILE n 1 110 LEU n 1 111 LYS n 1 112 ASN n 1 113 LEU n 1 114 SER n 1 115 GLN n 1 116 VAL n 1 117 ALA n 1 118 MSE n 1 119 ARG n 1 120 CYS n 1 121 ARG n 1 122 CYS n 1 123 SER n 1 124 SER n 1 125 MSE n 1 126 HIS n 1 127 PHE n 1 128 LEU n 1 129 VAL n 1 130 ALA n 1 131 GLU n 1 132 TRP n 1 133 ASN n 1 134 GLU n 1 135 PRO n 1 136 SER n 1 137 ILE n 1 138 ASN n 1 139 PHE n 1 140 TYR n 1 141 LYS n 1 142 ARG n 1 143 ARG n 1 144 GLY n 1 145 ALA n 1 146 SER n 1 147 ASP n 1 148 LEU n 1 149 SER n 1 150 SER n 1 151 GLU n 1 152 GLU n 1 153 GLY n 1 154 TRP n 1 155 ARG n 1 156 LEU n 1 157 PHE n 1 158 LYS n 1 159 ILE n 1 160 ASP n 1 161 LYS n 1 162 GLU n 1 163 TYR n 1 164 LEU n 1 165 LEU n 1 166 LYS n 1 167 MSE n 1 168 ALA n 1 169 THR n 1 170 GLU n 1 171 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene SAT _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET13a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SAT1_HUMAN _struct_ref.pdbx_db_accession P21673 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFT YDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKID KEYLLKMATEE ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2B58 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 171 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P21673 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 171 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 171 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2B58 _struct_ref_seq_dif.mon_id ARG _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 26 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P21673 _struct_ref_seq_dif.db_mon_id LYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 26 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 26 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 COA non-polymer . 'COENZYME A' ? 'C21 H36 N7 O16 P3 S' 767.534 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2B58 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.30 _exptl_crystal.density_percent_sol 46.41 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _reflns.entry_id 2B58 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.d_resolution_high 1.95 _reflns.d_resolution_low 30 _reflns.number_all 13447 _reflns.number_obs 13228 _reflns.percent_possible_obs ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _refine.entry_id 2B58 _refine.ls_d_res_high 1.95 _refine.ls_d_res_low 30.0 _refine.pdbx_ls_sigma_F -3 _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all 13477 _refine.ls_number_reflns_obs 13228 _refine.ls_number_reflns_R_free 658 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_work 0.204 _refine.ls_R_factor_R_free 0.253 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.details ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1380 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 48 _refine_hist.number_atoms_solvent 82 _refine_hist.number_atoms_total 1510 _refine_hist.d_res_high 1.95 _refine_hist.d_res_low 30.0 # _struct.entry_id 2B58 _struct.title 'SSAT with coa_sp, spermine disordered, K26R mutant' _struct.pdbx_descriptor 'Diamine acetyltransferase 1 (E.C.2.3.1.57)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2B58 _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, TRANSFERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 10 ? ALA A 12 ? THR A 10 ALA A 12 5 ? 3 HELX_P HELX_P2 2 ASP A 13 ? GLU A 28 ? ASP A 13 GLU A 28 1 ? 16 HELX_P HELX_P3 3 MSE A 30 ? VAL A 34 ? MSE A 30 VAL A 34 5 ? 5 HELX_P HELX_P4 4 THR A 37 ? GLY A 47 ? THR A 37 GLY A 47 1 ? 11 HELX_P HELX_P5 5 PRO A 60 ? TRP A 64 ? PRO A 60 TRP A 64 5 ? 5 HELX_P HELX_P6 6 SER A 98 ? ARG A 101 ? SER A 98 ARG A 101 5 ? 4 HELX_P HELX_P7 7 GLY A 104 ? CYS A 120 ? GLY A 104 CYS A 120 1 ? 17 HELX_P HELX_P8 8 ASN A 133 ? ARG A 143 ? ASN A 133 ARG A 143 1 ? 11 HELX_P HELX_P9 9 ASP A 160 ? GLU A 170 ? ASP A 160 GLU A 170 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A TYR 29 C ? ? ? 1_555 A MSE 30 N ? ? A TYR 29 A MSE 30 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale2 covale both ? A MSE 30 C ? ? ? 1_555 A GLU 31 N ? ? A MSE 30 A GLU 31 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale3 covale both ? A ALA 75 C ? ? ? 1_555 A MSE 76 N ? ? A ALA 75 A MSE 76 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale4 covale both ? A MSE 76 C ? ? ? 1_555 A TYR 77 N ? ? A MSE 76 A TYR 77 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale5 covale both ? A VAL 96 C ? ? ? 1_555 A MSE 97 N ? ? A VAL 96 A MSE 97 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale6 covale both ? A MSE 97 C ? ? ? 1_555 A SER 98 N ? ? A MSE 97 A SER 98 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale7 covale both ? A ALA 117 C ? ? ? 1_555 A MSE 118 N ? ? A ALA 117 A MSE 118 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale8 covale both ? A MSE 118 C ? ? ? 1_555 A ARG 119 N ? ? A MSE 118 A ARG 119 1_555 ? ? ? ? ? ? ? 1.321 ? ? covale9 covale both ? A SER 124 C ? ? ? 1_555 A MSE 125 N ? ? A SER 124 A MSE 125 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale10 covale both ? A MSE 125 C ? ? ? 1_555 A HIS 126 N ? ? A MSE 125 A HIS 126 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale11 covale both ? A LYS 166 C ? ? ? 1_555 A MSE 167 N ? ? A LYS 166 A MSE 167 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale12 covale both ? A MSE 167 C ? ? ? 1_555 A ALA 168 N ? ? A MSE 167 A ALA 168 1_555 ? ? ? ? ? ? ? 1.329 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 5 ? PRO A 8 ? VAL A 5 PRO A 8 A 2 HIS A 53 ? GLU A 58 ? HIS A 53 GLU A 58 A 3 ILE A 71 ? ASP A 82 ? ILE A 71 ASP A 82 A 4 GLY A 86 ? VAL A 96 ? GLY A 86 VAL A 96 A 5 SER A 124 ? HIS A 126 ? SER A 124 HIS A 126 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 7 ? N ARG A 7 O VAL A 56 ? O VAL A 56 A 2 3 N ALA A 57 ? N ALA A 57 O VAL A 72 ? O VAL A 72 A 3 4 N ASP A 82 ? N ASP A 82 O GLY A 86 ? O GLY A 86 A 4 5 N LEU A 91 ? N LEU A 91 O HIS A 126 ? O HIS A 126 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id COA _struct_site.pdbx_auth_seq_id 172 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 21 _struct_site.details 'BINDING SITE FOR RESIDUE COA A 172' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 21 GLU A 28 ? GLU A 28 . ? 1_555 ? 2 AC1 21 PHE A 94 ? PHE A 94 . ? 1_555 ? 3 AC1 21 PHE A 95 ? PHE A 95 . ? 1_555 ? 4 AC1 21 VAL A 96 ? VAL A 96 . ? 1_555 ? 5 AC1 21 ARG A 101 ? ARG A 101 . ? 1_555 ? 6 AC1 21 GLY A 102 ? GLY A 102 . ? 1_555 ? 7 AC1 21 PHE A 103 ? PHE A 103 . ? 1_555 ? 8 AC1 21 GLY A 104 ? GLY A 104 . ? 1_555 ? 9 AC1 21 ILE A 105 ? ILE A 105 . ? 1_555 ? 10 AC1 21 GLY A 106 ? GLY A 106 . ? 1_555 ? 11 AC1 21 SER A 107 ? SER A 107 . ? 1_555 ? 12 AC1 21 ASN A 133 ? ASN A 133 . ? 1_555 ? 13 AC1 21 SER A 136 ? SER A 136 . ? 1_555 ? 14 AC1 21 PHE A 139 ? PHE A 139 . ? 1_555 ? 15 AC1 21 ARG A 142 ? ARG A 142 . ? 1_555 ? 16 AC1 21 ARG A 143 ? ARG A 143 . ? 1_555 ? 17 AC1 21 HOH C . ? HOH A 173 . ? 1_555 ? 18 AC1 21 HOH C . ? HOH A 187 . ? 1_555 ? 19 AC1 21 HOH C . ? HOH A 204 . ? 1_555 ? 20 AC1 21 HOH C . ? HOH A 222 . ? 1_555 ? 21 AC1 21 HOH C . ? HOH A 223 . ? 1_555 ? # _database_PDB_matrix.entry_id 2B58 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2B58 _atom_sites.fract_transf_matrix[1][1] 0.015811 _atom_sites.fract_transf_matrix[1][2] 0.009128 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018256 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012326 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 LYS 3 3 ? ? ? A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 MSE 30 30 30 MSE MSE A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 HIS 53 53 53 HIS HIS A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 HIS 63 63 63 HIS HIS A . n A 1 64 TRP 64 64 64 TRP TRP A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 MSE 76 76 76 MSE MSE A . n A 1 77 TYR 77 77 77 TYR TYR A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 TYR 81 81 81 TYR TYR A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 TRP 84 84 84 TRP TRP A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 MSE 97 97 97 MSE MSE A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 TYR 100 100 100 TYR TYR A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 GLN 115 115 115 GLN GLN A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 MSE 118 118 118 MSE MSE A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 CYS 120 120 120 CYS CYS A . n A 1 121 ARG 121 121 121 ARG ARG A . n A 1 122 CYS 122 122 122 CYS CYS A . n A 1 123 SER 123 123 123 SER SER A . n A 1 124 SER 124 124 124 SER SER A . n A 1 125 MSE 125 125 125 MSE MSE A . n A 1 126 HIS 126 126 126 HIS HIS A . n A 1 127 PHE 127 127 127 PHE PHE A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 TRP 132 132 132 TRP TRP A . n A 1 133 ASN 133 133 133 ASN ASN A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 PRO 135 135 135 PRO PRO A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 ILE 137 137 137 ILE ILE A . n A 1 138 ASN 138 138 138 ASN ASN A . n A 1 139 PHE 139 139 139 PHE PHE A . n A 1 140 TYR 140 140 140 TYR TYR A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 ARG 142 142 142 ARG ARG A . n A 1 143 ARG 143 143 143 ARG ARG A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 ASP 147 147 147 ASP ASP A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 SER 149 149 149 SER SER A . n A 1 150 SER 150 150 150 SER SER A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 GLY 153 153 153 GLY GLY A . n A 1 154 TRP 154 154 154 TRP TRP A . n A 1 155 ARG 155 155 155 ARG ARG A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 PHE 157 157 157 PHE PHE A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 ILE 159 159 159 ILE ILE A . n A 1 160 ASP 160 160 160 ASP ASP A . n A 1 161 LYS 161 161 161 LYS LYS A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 TYR 163 163 163 TYR TYR A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 LYS 166 166 166 LYS LYS A . n A 1 167 MSE 167 167 167 MSE MSE A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 THR 169 169 169 THR THR A . n A 1 170 GLU 170 170 170 GLU GLU A . n A 1 171 GLU 171 171 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'New York SGX Research Center for Structural Genomics' _pdbx_SG_project.initial_of_center NYSGXRC # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 COA 1 172 171 COA COA A . C 3 HOH 1 173 172 HOH HOH A . C 3 HOH 2 174 173 HOH HOH A . C 3 HOH 3 175 174 HOH HOH A . C 3 HOH 4 176 175 HOH HOH A . C 3 HOH 5 177 176 HOH HOH A . C 3 HOH 6 178 177 HOH HOH A . C 3 HOH 7 179 178 HOH HOH A . C 3 HOH 8 180 179 HOH HOH A . C 3 HOH 9 181 180 HOH HOH A . C 3 HOH 10 182 181 HOH HOH A . C 3 HOH 11 183 182 HOH HOH A . C 3 HOH 12 184 183 HOH HOH A . C 3 HOH 13 185 184 HOH HOH A . C 3 HOH 14 186 185 HOH HOH A . C 3 HOH 15 187 186 HOH HOH A . C 3 HOH 16 188 187 HOH HOH A . C 3 HOH 17 189 188 HOH HOH A . C 3 HOH 18 190 189 HOH HOH A . C 3 HOH 19 191 190 HOH HOH A . C 3 HOH 20 192 191 HOH HOH A . C 3 HOH 21 193 192 HOH HOH A . C 3 HOH 22 194 193 HOH HOH A . C 3 HOH 23 195 194 HOH HOH A . C 3 HOH 24 196 195 HOH HOH A . C 3 HOH 25 197 196 HOH HOH A . C 3 HOH 26 198 197 HOH HOH A . C 3 HOH 27 199 198 HOH HOH A . C 3 HOH 28 200 199 HOH HOH A . C 3 HOH 29 201 200 HOH HOH A . C 3 HOH 30 202 201 HOH HOH A . C 3 HOH 31 203 202 HOH HOH A . C 3 HOH 32 204 203 HOH HOH A . C 3 HOH 33 205 204 HOH HOH A . C 3 HOH 34 206 205 HOH HOH A . C 3 HOH 35 207 206 HOH HOH A . C 3 HOH 36 208 207 HOH HOH A . C 3 HOH 37 209 208 HOH HOH A . C 3 HOH 38 210 209 HOH HOH A . C 3 HOH 39 211 210 HOH HOH A . C 3 HOH 40 212 211 HOH HOH A . C 3 HOH 41 213 212 HOH HOH A . C 3 HOH 42 214 213 HOH HOH A . C 3 HOH 43 215 214 HOH HOH A . C 3 HOH 44 216 215 HOH HOH A . C 3 HOH 45 217 216 HOH HOH A . C 3 HOH 46 218 217 HOH HOH A . C 3 HOH 47 219 218 HOH HOH A . C 3 HOH 48 220 219 HOH HOH A . C 3 HOH 49 221 220 HOH HOH A . C 3 HOH 50 222 221 HOH HOH A . C 3 HOH 51 223 222 HOH HOH A . C 3 HOH 52 224 223 HOH HOH A . C 3 HOH 53 225 224 HOH HOH A . C 3 HOH 54 226 225 HOH HOH A . C 3 HOH 55 227 226 HOH HOH A . C 3 HOH 56 228 227 HOH HOH A . C 3 HOH 57 229 228 HOH HOH A . C 3 HOH 58 230 229 HOH HOH A . C 3 HOH 59 231 230 HOH HOH A . C 3 HOH 60 232 231 HOH HOH A . C 3 HOH 61 233 232 HOH HOH A . C 3 HOH 62 234 233 HOH HOH A . C 3 HOH 63 235 234 HOH HOH A . C 3 HOH 64 236 235 HOH HOH A . C 3 HOH 65 237 236 HOH HOH A . C 3 HOH 66 238 237 HOH HOH A . C 3 HOH 67 239 238 HOH HOH A . C 3 HOH 68 240 239 HOH HOH A . C 3 HOH 69 241 240 HOH HOH A . C 3 HOH 70 242 241 HOH HOH A . C 3 HOH 71 243 242 HOH HOH A . C 3 HOH 72 244 243 HOH HOH A . C 3 HOH 73 245 244 HOH HOH A . C 3 HOH 74 246 245 HOH HOH A . C 3 HOH 75 247 246 HOH HOH A . C 3 HOH 76 248 247 HOH HOH A . C 3 HOH 77 249 248 HOH HOH A . C 3 HOH 78 250 249 HOH HOH A . C 3 HOH 79 251 250 HOH HOH A . C 3 HOH 80 252 251 HOH HOH A . C 3 HOH 81 253 252 HOH HOH A . C 3 HOH 82 254 253 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 30 A MSE 30 ? MET SELENOMETHIONINE 2 A MSE 76 A MSE 76 ? MET SELENOMETHIONINE 3 A MSE 97 A MSE 97 ? MET SELENOMETHIONINE 4 A MSE 118 A MSE 118 ? MET SELENOMETHIONINE 5 A MSE 125 A MSE 125 ? MET SELENOMETHIONINE 6 A MSE 167 A MSE 167 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 9220 ? 1 MORE -60 ? 1 'SSA (A^2)' 16680 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_675 -x+1,-y+2,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 109.5504815279 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-01-24 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-02-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' audit_author 2 4 'Structure model' struct_conn 3 4 'Structure model' struct_ref_seq_dif 4 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_audit_author.identifier_ORCID' 2 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 3 4 'Structure model' '_struct_ref_seq_dif.details' 4 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 5 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 6 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _software.name CNS _software.classification refinement _software.version 1.1 _software.citation_id ? _software.pdbx_ordinal 1 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 198 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 198 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 4_675 _pdbx_validate_symm_contact.dist 1.15 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CG _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 MSE _pdbx_validate_rmsd_angle.auth_seq_id_1 118 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 SE _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 MSE _pdbx_validate_rmsd_angle.auth_seq_id_2 118 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CE _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 MSE _pdbx_validate_rmsd_angle.auth_seq_id_3 118 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 114.50 _pdbx_validate_rmsd_angle.angle_target_value 98.90 _pdbx_validate_rmsd_angle.angle_deviation 15.60 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.20 _pdbx_validate_rmsd_angle.linker_flag N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id MSE _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 30 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -146.81 _pdbx_validate_torsion.psi 33.00 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id TYR _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 90 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.078 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A LYS 3 ? A LYS 3 4 1 Y 1 A GLU 171 ? A GLU 171 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'COENZYME A' COA 3 water HOH #