data_2BA3 # _entry.id 2BA3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2BA3 pdb_00002ba3 10.2210/pdb2ba3/pdb RCSB RCSB034864 ? ? WWPDB D_1000034864 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2BA3 _pdbx_database_status.recvd_initial_deposition_date 2005-10-14 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yoshida, H.' 1 'Furuya, N.' 2 'Lin, Y.J.' 3 'Guntert, P.' 4 'Komano, T.' 5 'Kainosho, M.' 6 # _citation.id primary _citation.title 'NMR Structure of NikA N-teminal Fragment' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yoshida, H.' 1 ? primary 'Furuya, N.' 2 ? primary 'Lin, Y.J.' 3 ? primary 'Guntert, P.' 4 ? primary 'Komano, T.' 5 ? primary 'Kainosho, M.' 6 ? # _cell.entry_id 2BA3 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2BA3 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description NikA _entity.formula_weight 5732.487 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-TERMINAL FRAGMENT(RESIDUES 1-51)' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SDSAVRKKSEVRQKTVVRTLRFSPVEDETIRKKAEDSGLTVSAYIRNAALN _entity_poly.pdbx_seq_one_letter_code_can SDSAVRKKSEVRQKTVVRTLRFSPVEDETIRKKAEDSGLTVSAYIRNAALN _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASP n 1 3 SER n 1 4 ALA n 1 5 VAL n 1 6 ARG n 1 7 LYS n 1 8 LYS n 1 9 SER n 1 10 GLU n 1 11 VAL n 1 12 ARG n 1 13 GLN n 1 14 LYS n 1 15 THR n 1 16 VAL n 1 17 VAL n 1 18 ARG n 1 19 THR n 1 20 LEU n 1 21 ARG n 1 22 PHE n 1 23 SER n 1 24 PRO n 1 25 VAL n 1 26 GLU n 1 27 ASP n 1 28 GLU n 1 29 THR n 1 30 ILE n 1 31 ARG n 1 32 LYS n 1 33 LYS n 1 34 ALA n 1 35 GLU n 1 36 ASP n 1 37 SER n 1 38 GLY n 1 39 LEU n 1 40 THR n 1 41 VAL n 1 42 SER n 1 43 ALA n 1 44 TYR n 1 45 ILE n 1 46 ARG n 1 47 ASN n 1 48 ALA n 1 49 ALA n 1 50 LEU n 1 51 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene NIKA _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Plasmid R64' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2492 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET11a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name GB _struct_ref.db_code BAA78022 _struct_ref.pdbx_db_accession 4903137 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2BA3 A 1 ? 51 ? 4903137 2 ? 52 ? 1 51 2 1 2BA3 B 1 ? 51 ? 4903137 2 ? 52 ? 1 51 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '2mM NIKA(1-51) U-15N, 13C; 50mM phosphate buffer NA; 50mM NaCL' _pdbx_nmr_sample_details.solvent_system 'H2O and D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AVANCE Bruker 500 ? 2 AVANCE Bruker 600 ? # _pdbx_nmr_refine.entry_id 2BA3 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ;20 CYANA conformers with the lowest final target function values were subjected to restrained energy minimization in explicit solvent against the AMBER force field using the program OPALp ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2BA3 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2BA3 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'structure solution' CYANA 2.2.1 'Guntert et al.' 1 refinement OPALp 1.4 'Koradi, R., Billeter, M., Guntert, P.' 2 # _exptl.entry_id 2BA3 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2BA3 _struct.title 'NMR Structure of NikA N-terminal Fragment' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2BA3 _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'DIMER, BACTERIAL CONJUGATION, RELAXASE, DNA BINDING, RIBBON-HELIX-HELIX, DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 23 ? GLY A 38 ? SER A 23 GLY A 38 1 ? 16 HELX_P HELX_P2 2 THR A 40 ? ASN A 51 ? THR A 40 ASN A 51 1 ? 12 HELX_P HELX_P3 3 SER B 23 ? GLY B 38 ? SER B 23 GLY B 38 1 ? 16 HELX_P HELX_P4 4 THR B 40 ? ASN B 51 ? THR B 40 ASN B 51 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 16 ? PHE A 22 ? VAL A 16 PHE A 22 A 2 VAL B 16 ? PHE B 22 ? VAL B 16 PHE B 22 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LEU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 20 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 20 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ARG _pdbx_struct_sheet_hbond.range_2_label_asym_id B _pdbx_struct_sheet_hbond.range_2_label_seq_id 18 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ARG _pdbx_struct_sheet_hbond.range_2_auth_asym_id B _pdbx_struct_sheet_hbond.range_2_auth_seq_id 18 # _database_PDB_matrix.entry_id 2BA3 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2BA3 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ASN 51 51 51 ASN ASN A . n B 1 1 SER 1 1 1 SER SER B . n B 1 2 ASP 2 2 2 ASP ASP B . n B 1 3 SER 3 3 3 SER SER B . n B 1 4 ALA 4 4 4 ALA ALA B . n B 1 5 VAL 5 5 5 VAL VAL B . n B 1 6 ARG 6 6 6 ARG ARG B . n B 1 7 LYS 7 7 7 LYS LYS B . n B 1 8 LYS 8 8 8 LYS LYS B . n B 1 9 SER 9 9 9 SER SER B . n B 1 10 GLU 10 10 10 GLU GLU B . n B 1 11 VAL 11 11 11 VAL VAL B . n B 1 12 ARG 12 12 12 ARG ARG B . n B 1 13 GLN 13 13 13 GLN GLN B . n B 1 14 LYS 14 14 14 LYS LYS B . n B 1 15 THR 15 15 15 THR THR B . n B 1 16 VAL 16 16 16 VAL VAL B . n B 1 17 VAL 17 17 17 VAL VAL B . n B 1 18 ARG 18 18 18 ARG ARG B . n B 1 19 THR 19 19 19 THR THR B . n B 1 20 LEU 20 20 20 LEU LEU B . n B 1 21 ARG 21 21 21 ARG ARG B . n B 1 22 PHE 22 22 22 PHE PHE B . n B 1 23 SER 23 23 23 SER SER B . n B 1 24 PRO 24 24 24 PRO PRO B . n B 1 25 VAL 25 25 25 VAL VAL B . n B 1 26 GLU 26 26 26 GLU GLU B . n B 1 27 ASP 27 27 27 ASP ASP B . n B 1 28 GLU 28 28 28 GLU GLU B . n B 1 29 THR 29 29 29 THR THR B . n B 1 30 ILE 30 30 30 ILE ILE B . n B 1 31 ARG 31 31 31 ARG ARG B . n B 1 32 LYS 32 32 32 LYS LYS B . n B 1 33 LYS 33 33 33 LYS LYS B . n B 1 34 ALA 34 34 34 ALA ALA B . n B 1 35 GLU 35 35 35 GLU GLU B . n B 1 36 ASP 36 36 36 ASP ASP B . n B 1 37 SER 37 37 37 SER SER B . n B 1 38 GLY 38 38 38 GLY GLY B . n B 1 39 LEU 39 39 39 LEU LEU B . n B 1 40 THR 40 40 40 THR THR B . n B 1 41 VAL 41 41 41 VAL VAL B . n B 1 42 SER 42 42 42 SER SER B . n B 1 43 ALA 43 43 43 ALA ALA B . n B 1 44 TYR 44 44 44 TYR TYR B . n B 1 45 ILE 45 45 45 ILE ILE B . n B 1 46 ARG 46 46 46 ARG ARG B . n B 1 47 ASN 47 47 47 ASN ASN B . n B 1 48 ALA 48 48 48 ALA ALA B . n B 1 49 ALA 49 49 49 ALA ALA B . n B 1 50 LEU 50 50 50 LEU LEU B . n B 1 51 ASN 51 51 51 ASN ASN B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-10-03 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_spectrometer 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HG B SER 23 ? ? OE2 B GLU 26 ? ? 1.59 2 10 HG B SER 23 ? ? OE2 B GLU 26 ? ? 1.58 3 14 HG B SER 23 ? ? OE2 B GLU 26 ? ? 1.59 4 17 HG1 A THR 15 ? ? O B PHE 22 ? ? 1.58 5 19 O A PHE 22 ? ? HG1 B THR 15 ? ? 1.58 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 7 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH2 A ARG 12 ? ? 116.70 120.30 -3.60 0.50 N 2 9 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 123.77 120.30 3.47 0.50 N 3 10 NE B ARG 46 ? ? CZ B ARG 46 ? ? NH2 B ARG 46 ? ? 117.29 120.30 -3.01 0.50 N 4 15 NE B ARG 21 ? ? CZ B ARG 21 ? ? NH1 B ARG 21 ? ? 123.57 120.30 3.27 0.50 N 5 18 C A SER 1 ? ? N A ASP 2 ? ? CA A ASP 2 ? ? 142.36 121.70 20.66 2.50 Y 6 18 C B SER 1 ? ? N B ASP 2 ? ? CA B ASP 2 ? ? 142.20 121.70 20.50 2.50 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 4 ? ? -55.62 -71.34 2 1 VAL A 11 ? ? -133.84 -89.43 3 1 GLU B 10 ? ? -155.79 83.64 4 1 ARG B 12 ? ? -170.26 147.32 5 2 VAL A 5 ? ? -66.98 5.48 6 2 ASP B 2 ? ? -153.19 -143.07 7 2 VAL B 5 ? ? -69.52 12.59 8 2 ARG B 6 ? ? -67.27 2.39 9 3 ALA A 4 ? ? -163.70 93.58 10 3 GLN A 13 ? ? -52.87 99.49 11 3 ALA B 4 ? ? -175.81 88.98 12 3 THR B 15 ? ? -74.54 -168.96 13 4 VAL A 5 ? ? 37.38 44.53 14 4 LYS A 7 ? ? -141.51 -18.94 15 4 LYS A 8 ? ? -157.83 86.14 16 4 LYS B 7 ? ? -154.12 -34.32 17 4 THR B 29 ? ? -91.92 -61.44 18 5 LYS A 7 ? ? 29.98 57.76 19 5 THR A 40 ? ? -48.13 158.75 20 5 ARG B 6 ? ? -133.39 -59.60 21 5 LYS B 7 ? ? 35.22 72.58 22 5 THR B 40 ? ? -48.82 158.83 23 6 SER A 3 ? ? -67.23 10.09 24 6 ARG B 6 ? ? -135.26 -54.26 25 6 VAL B 25 ? ? -93.85 -61.75 26 7 LYS A 7 ? ? -149.10 -51.60 27 7 GLU A 10 ? ? 178.19 157.23 28 7 GLN A 13 ? ? -59.54 98.46 29 7 ASP B 2 ? ? -146.33 -45.79 30 7 LYS B 7 ? ? -137.16 -45.76 31 7 THR B 40 ? ? -46.74 151.66 32 8 LYS A 8 ? ? -133.72 -77.52 33 8 GLU A 10 ? ? -153.61 -159.74 34 8 LYS B 8 ? ? -140.00 -64.55 35 8 THR B 19 ? ? -115.27 76.67 36 9 VAL A 11 ? ? -157.78 -20.96 37 9 ASP B 2 ? ? -84.23 49.60 38 9 SER B 9 ? ? -143.34 -13.39 39 10 ASP A 2 ? ? -144.16 -149.76 40 10 SER A 3 ? ? -147.48 17.03 41 10 ASP B 2 ? ? -149.26 -153.92 42 10 SER B 3 ? ? -145.09 13.74 43 11 LYS A 8 ? ? -150.25 -69.07 44 11 SER A 9 ? ? 67.03 -11.31 45 11 THR A 40 ? ? -48.37 151.36 46 11 LYS B 8 ? ? -157.60 -35.88 47 11 SER B 9 ? ? 59.45 -21.33 48 12 VAL A 11 ? ? -133.58 -42.78 49 12 SER B 9 ? ? -71.25 -76.94 50 12 VAL B 11 ? ? -132.24 -50.88 51 12 THR B 40 ? ? -48.04 155.20 52 13 SER A 3 ? ? -163.21 -84.05 53 13 THR A 40 ? ? -46.72 160.54 54 13 LYS B 8 ? ? 30.54 50.57 55 13 SER B 9 ? ? -60.66 -70.67 56 14 ARG A 6 ? ? -140.02 -75.84 57 14 ALA B 4 ? ? -133.37 -44.96 58 14 ARG B 6 ? ? -132.26 -68.84 59 14 THR B 40 ? ? -45.85 151.32 60 15 ASP A 2 ? ? -18.07 -70.55 61 15 SER A 3 ? ? -63.10 26.39 62 15 LYS A 8 ? ? 175.24 108.27 63 15 ASP B 2 ? ? -65.52 -177.02 64 15 SER B 9 ? ? 115.66 145.97 65 15 THR B 15 ? ? -75.27 -154.35 66 16 ASP A 2 ? ? -170.22 -174.01 67 16 GLU A 10 ? ? -148.02 -6.90 68 16 GLN A 13 ? ? 59.46 19.69 69 16 THR A 15 ? ? -160.45 -166.51 70 16 THR A 40 ? ? -49.21 152.57 71 16 ASP B 2 ? ? -170.41 -166.00 72 16 LYS B 8 ? ? -138.32 -70.65 73 16 ARG B 12 ? ? 47.88 24.05 74 16 THR B 40 ? ? -45.51 153.78 75 17 ALA A 4 ? ? -53.47 -8.62 76 17 ALA B 4 ? ? -62.33 76.30 77 17 THR B 15 ? ? -70.08 -167.71 78 18 ASP A 2 ? ? -45.08 22.83 79 18 SER A 3 ? ? -66.24 61.52 80 18 ASP B 2 ? ? -46.45 31.73 81 18 SER B 3 ? ? -67.27 63.62 82 19 GLN B 13 ? ? -151.36 80.01 83 19 THR B 40 ? ? -45.27 150.83 84 20 LYS A 7 ? ? -129.52 -92.84 85 20 LYS B 7 ? ? -133.40 -77.37 86 20 LYS B 8 ? ? -154.51 88.07 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 44 ? ? 0.091 'SIDE CHAIN' 2 2 ARG B 31 ? ? 0.160 'SIDE CHAIN' 3 3 TYR B 44 ? ? 0.073 'SIDE CHAIN' 4 4 ASP A 2 ? ? 0.079 'SIDE CHAIN' 5 4 ARG A 6 ? ? 0.080 'SIDE CHAIN' 6 4 ASP B 2 ? ? 0.077 'SIDE CHAIN' 7 7 ARG A 6 ? ? 0.076 'SIDE CHAIN' 8 7 TYR B 44 ? ? 0.072 'SIDE CHAIN' 9 8 TYR A 44 ? ? 0.090 'SIDE CHAIN' 10 8 ASP B 2 ? ? 0.074 'SIDE CHAIN' 11 9 ARG A 12 ? ? 0.085 'SIDE CHAIN' 12 9 ARG A 46 ? ? 0.132 'SIDE CHAIN' 13 9 ARG B 18 ? ? 0.099 'SIDE CHAIN' 14 10 ARG A 21 ? ? 0.109 'SIDE CHAIN' 15 11 ARG A 46 ? ? 0.081 'SIDE CHAIN' 16 12 ARG B 31 ? ? 0.113 'SIDE CHAIN' 17 13 ARG A 46 ? ? 0.075 'SIDE CHAIN' 18 13 ARG B 18 ? ? 0.089 'SIDE CHAIN' 19 14 ARG A 18 ? ? 0.088 'SIDE CHAIN' 20 15 ARG B 18 ? ? 0.076 'SIDE CHAIN' 21 16 ARG A 46 ? ? 0.090 'SIDE CHAIN' 22 16 ARG B 46 ? ? 0.077 'SIDE CHAIN' 23 18 ARG A 12 ? ? 0.128 'SIDE CHAIN' 24 18 ARG A 31 ? ? 0.102 'SIDE CHAIN' 25 19 ARG B 12 ? ? 0.094 'SIDE CHAIN' #