data_2BCA # _entry.id 2BCA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2BCA pdb_00002bca 10.2210/pdb2bca/pdb WWPDB D_1000177819 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1993-10-31 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other 7 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2BCA _pdbx_database_status.recvd_initial_deposition_date 1993-08-18 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2BCB _pdbx_database_related.details . _pdbx_database_related.content_type ensemble # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kordel, J.' 1 'Skelton, N.J.' 2 'Akke, M.' 3 'Chazin, W.J.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'High-resolution structure of calcium-loaded calbindin D9k.' J.Mol.Biol. 231 711 734 1993 JMOBAK UK 0022-2836 0070 ? 8515447 10.1006/jmbi.1993.1322 1 ;The Rate and Structural Consequences of Proline Cis-Trans Isomerization in Calbindin D9K: NMR Studies of the Minor (Cis-Pro43) Isoform and the Pro43Gly Mutant ; Biochemistry 29 4400 ? 1990 BICHAW US 0006-2960 0033 ? ? ? 2 ;1H NMR Sequential Resonance Assignments, Secondary Structure, and Global Fold in Solution of the Major (Trans-Pro43) Form of Bovine Calbindin D9K ; Biochemistry 28 7065 ? 1989 BICHAW US 0006-2960 0033 ? ? ? 3 ;The Refined Structure of Vitamin D-Dependent Calcium-Binding Protein from Bovine Intestine. Molecular Details, Ion Binding, and Implications for the Structure of Other Calcium-Binding Proteins ; J.Biol.Chem. 261 8761 ? 1986 JBCHA3 US 0021-9258 0071 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kordel, J.' 1 ? primary 'Skelton, N.J.' 2 ? primary 'Akke, M.' 3 ? primary 'Chazin, W.J.' 4 ? 1 'Kordel, J.' 5 ? 1 'Forsen, S.' 6 ? 1 'Drakenberg, T.' 7 ? 1 'Chazin, W.J.' 8 ? 2 'Kordel, J.' 9 ? 2 'Forsen, S.' 10 ? 2 'Chazin, W.J.' 11 ? 3 'Szebenyi, D.M.E.' 12 ? 3 'Moffat, K.' 13 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'CALBINDIN D9K' _entity.formula_weight 8601.688 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MKSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ _entity_poly.pdbx_seq_one_letter_code_can MKSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 SER n 1 4 PRO n 1 5 GLU n 1 6 GLU n 1 7 LEU n 1 8 LYS n 1 9 GLY n 1 10 ILE n 1 11 PHE n 1 12 GLU n 1 13 LYS n 1 14 TYR n 1 15 ALA n 1 16 ALA n 1 17 LYS n 1 18 GLU n 1 19 GLY n 1 20 ASP n 1 21 PRO n 1 22 ASN n 1 23 GLN n 1 24 LEU n 1 25 SER n 1 26 LYS n 1 27 GLU n 1 28 GLU n 1 29 LEU n 1 30 LYS n 1 31 LEU n 1 32 LEU n 1 33 LEU n 1 34 GLN n 1 35 THR n 1 36 GLU n 1 37 PHE n 1 38 PRO n 1 39 SER n 1 40 LEU n 1 41 LEU n 1 42 LYS n 1 43 GLY n 1 44 GLY n 1 45 SER n 1 46 THR n 1 47 LEU n 1 48 ASP n 1 49 GLU n 1 50 LEU n 1 51 PHE n 1 52 GLU n 1 53 GLU n 1 54 LEU n 1 55 ASP n 1 56 LYS n 1 57 ASN n 1 58 GLY n 1 59 ASP n 1 60 GLY n 1 61 GLU n 1 62 VAL n 1 63 SER n 1 64 PHE n 1 65 GLU n 1 66 GLU n 1 67 PHE n 1 68 GLN n 1 69 VAL n 1 70 LEU n 1 71 VAL n 1 72 LYS n 1 73 LYS n 1 74 ILE n 1 75 SER n 1 76 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name cattle _entity_src_gen.gene_src_genus Bos _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bos taurus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9913 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 LYS 2 1 1 LYS LYS A . n A 1 3 SER 3 2 2 SER SER A . n A 1 4 PRO 4 3 3 PRO PRO A . n A 1 5 GLU 5 4 4 GLU GLU A . n A 1 6 GLU 6 5 5 GLU GLU A . n A 1 7 LEU 7 6 6 LEU LEU A . n A 1 8 LYS 8 7 7 LYS LYS A . n A 1 9 GLY 9 8 8 GLY GLY A . n A 1 10 ILE 10 9 9 ILE ILE A . n A 1 11 PHE 11 10 10 PHE PHE A . n A 1 12 GLU 12 11 11 GLU GLU A . n A 1 13 LYS 13 12 12 LYS LYS A . n A 1 14 TYR 14 13 13 TYR TYR A . n A 1 15 ALA 15 14 14 ALA ALA A . n A 1 16 ALA 16 15 15 ALA ALA A . n A 1 17 LYS 17 16 16 LYS LYS A . n A 1 18 GLU 18 17 17 GLU GLU A . n A 1 19 GLY 19 18 18 GLY GLY A . n A 1 20 ASP 20 19 19 ASP ASP A . n A 1 21 PRO 21 20 20 PRO PRO A . n A 1 22 ASN 22 21 21 ASN ASN A . n A 1 23 GLN 23 22 22 GLN GLN A . n A 1 24 LEU 24 23 23 LEU LEU A . n A 1 25 SER 25 24 24 SER SER A . n A 1 26 LYS 26 25 25 LYS LYS A . n A 1 27 GLU 27 26 26 GLU GLU A . n A 1 28 GLU 28 27 27 GLU GLU A . n A 1 29 LEU 29 28 28 LEU LEU A . n A 1 30 LYS 30 29 29 LYS LYS A . n A 1 31 LEU 31 30 30 LEU LEU A . n A 1 32 LEU 32 31 31 LEU LEU A . n A 1 33 LEU 33 32 32 LEU LEU A . n A 1 34 GLN 34 33 33 GLN GLN A . n A 1 35 THR 35 34 34 THR THR A . n A 1 36 GLU 36 35 35 GLU GLU A . n A 1 37 PHE 37 36 36 PHE PHE A . n A 1 38 PRO 38 37 37 PRO PRO A . n A 1 39 SER 39 38 38 SER SER A . n A 1 40 LEU 40 39 39 LEU LEU A . n A 1 41 LEU 41 40 40 LEU LEU A . n A 1 42 LYS 42 41 41 LYS LYS A . n A 1 43 GLY 43 42 42 GLY GLY A . n A 1 44 GLY 44 43 43 GLY GLY A . n A 1 45 SER 45 44 44 SER SER A . n A 1 46 THR 46 45 45 THR THR A . n A 1 47 LEU 47 46 46 LEU LEU A . n A 1 48 ASP 48 47 47 ASP ASP A . n A 1 49 GLU 49 48 48 GLU GLU A . n A 1 50 LEU 50 49 49 LEU LEU A . n A 1 51 PHE 51 50 50 PHE PHE A . n A 1 52 GLU 52 51 51 GLU GLU A . n A 1 53 GLU 53 52 52 GLU GLU A . n A 1 54 LEU 54 53 53 LEU LEU A . n A 1 55 ASP 55 54 54 ASP ASP A . n A 1 56 LYS 56 55 55 LYS LYS A . n A 1 57 ASN 57 56 56 ASN ASN A . n A 1 58 GLY 58 57 57 GLY GLY A . n A 1 59 ASP 59 58 58 ASP ASP A . n A 1 60 GLY 60 59 59 GLY GLY A . n A 1 61 GLU 61 60 60 GLU GLU A . n A 1 62 VAL 62 61 61 VAL VAL A . n A 1 63 SER 63 62 62 SER SER A . n A 1 64 PHE 64 63 63 PHE PHE A . n A 1 65 GLU 65 64 64 GLU GLU A . n A 1 66 GLU 66 65 65 GLU GLU A . n A 1 67 PHE 67 66 66 PHE PHE A . n A 1 68 GLN 68 67 67 GLN GLN A . n A 1 69 VAL 69 68 68 VAL VAL A . n A 1 70 LEU 70 69 69 LEU LEU A . n A 1 71 VAL 71 70 70 VAL VAL A . n A 1 72 LYS 72 71 71 LYS LYS A . n A 1 73 LYS 73 72 72 LYS LYS A . n A 1 74 ILE 74 73 73 ILE ILE A . n A 1 75 SER 75 74 74 SER SER A . n A 1 76 GLN 76 75 75 GLN GLN A . n # _cell.entry_id 2BCA _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2BCA _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 2BCA _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2BCA _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2BCA _struct.title 'HIGH-RESOLUTION SOLUTION STRUCTURE OF CALCIUM-LOADED CALBINDIN D9K' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2BCA _struct_keywords.pdbx_keywords 'CALCIUM-BINDING PROTEIN' _struct_keywords.text 'CALCIUM-BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code S100G_BOVIN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P02633 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code SAKKSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGPSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2BCA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 76 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02633 _struct_ref_seq.db_align_beg 4 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 78 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 75 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2BCA _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 44 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P02633 _struct_ref_seq_dif.db_mon_id PRO _struct_ref_seq_dif.pdbx_seq_db_seq_num 46 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 43 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 3 ? ALA A 16 ? SER A 2 ALA A 15 1 ? 14 HELX_P HELX_P2 2 LYS A 26 ? PHE A 37 ? LYS A 25 PHE A 36 1 ? 12 HELX_P HELX_P3 3 THR A 46 ? ASP A 55 ? THR A 45 ASP A 54 1 ? 10 HELX_P HELX_P4 4 PHE A 64 ? GLN A 76 ? PHE A 63 GLN A 75 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 23 ? SER A 25 ? GLN A 22 SER A 24 A 2 GLU A 61 ? SER A 63 ? GLU A 60 SER A 62 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id LEU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 24 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 23 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 62 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 61 # _pdbx_nmr_ensemble.entry_id 2BCA _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement DISGEO ? HAVEL,WUTHRICH 1 refinement Amber ? PEARLMAN,CASE,CALDWELL,SIEBEL,SINGH,WEINER,KOLLMAN 2 # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id MET _pdbx_unobs_or_zero_occ_residues.auth_seq_id 0 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id MET _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 GLN N N N N 47 GLN CA C N S 48 GLN C C N N 49 GLN O O N N 50 GLN CB C N N 51 GLN CG C N N 52 GLN CD C N N 53 GLN OE1 O N N 54 GLN NE2 N N N 55 GLN OXT O N N 56 GLN H H N N 57 GLN H2 H N N 58 GLN HA H N N 59 GLN HB2 H N N 60 GLN HB3 H N N 61 GLN HG2 H N N 62 GLN HG3 H N N 63 GLN HE21 H N N 64 GLN HE22 H N N 65 GLN HXT H N N 66 GLU N N N N 67 GLU CA C N S 68 GLU C C N N 69 GLU O O N N 70 GLU CB C N N 71 GLU CG C N N 72 GLU CD C N N 73 GLU OE1 O N N 74 GLU OE2 O N N 75 GLU OXT O N N 76 GLU H H N N 77 GLU H2 H N N 78 GLU HA H N N 79 GLU HB2 H N N 80 GLU HB3 H N N 81 GLU HG2 H N N 82 GLU HG3 H N N 83 GLU HE2 H N N 84 GLU HXT H N N 85 GLY N N N N 86 GLY CA C N N 87 GLY C C N N 88 GLY O O N N 89 GLY OXT O N N 90 GLY H H N N 91 GLY H2 H N N 92 GLY HA2 H N N 93 GLY HA3 H N N 94 GLY HXT H N N 95 ILE N N N N 96 ILE CA C N S 97 ILE C C N N 98 ILE O O N N 99 ILE CB C N S 100 ILE CG1 C N N 101 ILE CG2 C N N 102 ILE CD1 C N N 103 ILE OXT O N N 104 ILE H H N N 105 ILE H2 H N N 106 ILE HA H N N 107 ILE HB H N N 108 ILE HG12 H N N 109 ILE HG13 H N N 110 ILE HG21 H N N 111 ILE HG22 H N N 112 ILE HG23 H N N 113 ILE HD11 H N N 114 ILE HD12 H N N 115 ILE HD13 H N N 116 ILE HXT H N N 117 LEU N N N N 118 LEU CA C N S 119 LEU C C N N 120 LEU O O N N 121 LEU CB C N N 122 LEU CG C N N 123 LEU CD1 C N N 124 LEU CD2 C N N 125 LEU OXT O N N 126 LEU H H N N 127 LEU H2 H N N 128 LEU HA H N N 129 LEU HB2 H N N 130 LEU HB3 H N N 131 LEU HG H N N 132 LEU HD11 H N N 133 LEU HD12 H N N 134 LEU HD13 H N N 135 LEU HD21 H N N 136 LEU HD22 H N N 137 LEU HD23 H N N 138 LEU HXT H N N 139 LYS N N N N 140 LYS CA C N S 141 LYS C C N N 142 LYS O O N N 143 LYS CB C N N 144 LYS CG C N N 145 LYS CD C N N 146 LYS CE C N N 147 LYS NZ N N N 148 LYS OXT O N N 149 LYS H H N N 150 LYS H2 H N N 151 LYS HA H N N 152 LYS HB2 H N N 153 LYS HB3 H N N 154 LYS HG2 H N N 155 LYS HG3 H N N 156 LYS HD2 H N N 157 LYS HD3 H N N 158 LYS HE2 H N N 159 LYS HE3 H N N 160 LYS HZ1 H N N 161 LYS HZ2 H N N 162 LYS HZ3 H N N 163 LYS HXT H N N 164 MET N N N N 165 MET CA C N S 166 MET C C N N 167 MET O O N N 168 MET CB C N N 169 MET CG C N N 170 MET SD S N N 171 MET CE C N N 172 MET OXT O N N 173 MET H H N N 174 MET H2 H N N 175 MET HA H N N 176 MET HB2 H N N 177 MET HB3 H N N 178 MET HG2 H N N 179 MET HG3 H N N 180 MET HE1 H N N 181 MET HE2 H N N 182 MET HE3 H N N 183 MET HXT H N N 184 PHE N N N N 185 PHE CA C N S 186 PHE C C N N 187 PHE O O N N 188 PHE CB C N N 189 PHE CG C Y N 190 PHE CD1 C Y N 191 PHE CD2 C Y N 192 PHE CE1 C Y N 193 PHE CE2 C Y N 194 PHE CZ C Y N 195 PHE OXT O N N 196 PHE H H N N 197 PHE H2 H N N 198 PHE HA H N N 199 PHE HB2 H N N 200 PHE HB3 H N N 201 PHE HD1 H N N 202 PHE HD2 H N N 203 PHE HE1 H N N 204 PHE HE2 H N N 205 PHE HZ H N N 206 PHE HXT H N N 207 PRO N N N N 208 PRO CA C N S 209 PRO C C N N 210 PRO O O N N 211 PRO CB C N N 212 PRO CG C N N 213 PRO CD C N N 214 PRO OXT O N N 215 PRO H H N N 216 PRO HA H N N 217 PRO HB2 H N N 218 PRO HB3 H N N 219 PRO HG2 H N N 220 PRO HG3 H N N 221 PRO HD2 H N N 222 PRO HD3 H N N 223 PRO HXT H N N 224 SER N N N N 225 SER CA C N S 226 SER C C N N 227 SER O O N N 228 SER CB C N N 229 SER OG O N N 230 SER OXT O N N 231 SER H H N N 232 SER H2 H N N 233 SER HA H N N 234 SER HB2 H N N 235 SER HB3 H N N 236 SER HG H N N 237 SER HXT H N N 238 THR N N N N 239 THR CA C N S 240 THR C C N N 241 THR O O N N 242 THR CB C N R 243 THR OG1 O N N 244 THR CG2 C N N 245 THR OXT O N N 246 THR H H N N 247 THR H2 H N N 248 THR HA H N N 249 THR HB H N N 250 THR HG1 H N N 251 THR HG21 H N N 252 THR HG22 H N N 253 THR HG23 H N N 254 THR HXT H N N 255 TYR N N N N 256 TYR CA C N S 257 TYR C C N N 258 TYR O O N N 259 TYR CB C N N 260 TYR CG C Y N 261 TYR CD1 C Y N 262 TYR CD2 C Y N 263 TYR CE1 C Y N 264 TYR CE2 C Y N 265 TYR CZ C Y N 266 TYR OH O N N 267 TYR OXT O N N 268 TYR H H N N 269 TYR H2 H N N 270 TYR HA H N N 271 TYR HB2 H N N 272 TYR HB3 H N N 273 TYR HD1 H N N 274 TYR HD2 H N N 275 TYR HE1 H N N 276 TYR HE2 H N N 277 TYR HH H N N 278 TYR HXT H N N 279 VAL N N N N 280 VAL CA C N S 281 VAL C C N N 282 VAL O O N N 283 VAL CB C N N 284 VAL CG1 C N N 285 VAL CG2 C N N 286 VAL OXT O N N 287 VAL H H N N 288 VAL H2 H N N 289 VAL HA H N N 290 VAL HB H N N 291 VAL HG11 H N N 292 VAL HG12 H N N 293 VAL HG13 H N N 294 VAL HG21 H N N 295 VAL HG22 H N N 296 VAL HG23 H N N 297 VAL HXT H N N 298 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 GLN N CA sing N N 44 GLN N H sing N N 45 GLN N H2 sing N N 46 GLN CA C sing N N 47 GLN CA CB sing N N 48 GLN CA HA sing N N 49 GLN C O doub N N 50 GLN C OXT sing N N 51 GLN CB CG sing N N 52 GLN CB HB2 sing N N 53 GLN CB HB3 sing N N 54 GLN CG CD sing N N 55 GLN CG HG2 sing N N 56 GLN CG HG3 sing N N 57 GLN CD OE1 doub N N 58 GLN CD NE2 sing N N 59 GLN NE2 HE21 sing N N 60 GLN NE2 HE22 sing N N 61 GLN OXT HXT sing N N 62 GLU N CA sing N N 63 GLU N H sing N N 64 GLU N H2 sing N N 65 GLU CA C sing N N 66 GLU CA CB sing N N 67 GLU CA HA sing N N 68 GLU C O doub N N 69 GLU C OXT sing N N 70 GLU CB CG sing N N 71 GLU CB HB2 sing N N 72 GLU CB HB3 sing N N 73 GLU CG CD sing N N 74 GLU CG HG2 sing N N 75 GLU CG HG3 sing N N 76 GLU CD OE1 doub N N 77 GLU CD OE2 sing N N 78 GLU OE2 HE2 sing N N 79 GLU OXT HXT sing N N 80 GLY N CA sing N N 81 GLY N H sing N N 82 GLY N H2 sing N N 83 GLY CA C sing N N 84 GLY CA HA2 sing N N 85 GLY CA HA3 sing N N 86 GLY C O doub N N 87 GLY C OXT sing N N 88 GLY OXT HXT sing N N 89 ILE N CA sing N N 90 ILE N H sing N N 91 ILE N H2 sing N N 92 ILE CA C sing N N 93 ILE CA CB sing N N 94 ILE CA HA sing N N 95 ILE C O doub N N 96 ILE C OXT sing N N 97 ILE CB CG1 sing N N 98 ILE CB CG2 sing N N 99 ILE CB HB sing N N 100 ILE CG1 CD1 sing N N 101 ILE CG1 HG12 sing N N 102 ILE CG1 HG13 sing N N 103 ILE CG2 HG21 sing N N 104 ILE CG2 HG22 sing N N 105 ILE CG2 HG23 sing N N 106 ILE CD1 HD11 sing N N 107 ILE CD1 HD12 sing N N 108 ILE CD1 HD13 sing N N 109 ILE OXT HXT sing N N 110 LEU N CA sing N N 111 LEU N H sing N N 112 LEU N H2 sing N N 113 LEU CA C sing N N 114 LEU CA CB sing N N 115 LEU CA HA sing N N 116 LEU C O doub N N 117 LEU C OXT sing N N 118 LEU CB CG sing N N 119 LEU CB HB2 sing N N 120 LEU CB HB3 sing N N 121 LEU CG CD1 sing N N 122 LEU CG CD2 sing N N 123 LEU CG HG sing N N 124 LEU CD1 HD11 sing N N 125 LEU CD1 HD12 sing N N 126 LEU CD1 HD13 sing N N 127 LEU CD2 HD21 sing N N 128 LEU CD2 HD22 sing N N 129 LEU CD2 HD23 sing N N 130 LEU OXT HXT sing N N 131 LYS N CA sing N N 132 LYS N H sing N N 133 LYS N H2 sing N N 134 LYS CA C sing N N 135 LYS CA CB sing N N 136 LYS CA HA sing N N 137 LYS C O doub N N 138 LYS C OXT sing N N 139 LYS CB CG sing N N 140 LYS CB HB2 sing N N 141 LYS CB HB3 sing N N 142 LYS CG CD sing N N 143 LYS CG HG2 sing N N 144 LYS CG HG3 sing N N 145 LYS CD CE sing N N 146 LYS CD HD2 sing N N 147 LYS CD HD3 sing N N 148 LYS CE NZ sing N N 149 LYS CE HE2 sing N N 150 LYS CE HE3 sing N N 151 LYS NZ HZ1 sing N N 152 LYS NZ HZ2 sing N N 153 LYS NZ HZ3 sing N N 154 LYS OXT HXT sing N N 155 MET N CA sing N N 156 MET N H sing N N 157 MET N H2 sing N N 158 MET CA C sing N N 159 MET CA CB sing N N 160 MET CA HA sing N N 161 MET C O doub N N 162 MET C OXT sing N N 163 MET CB CG sing N N 164 MET CB HB2 sing N N 165 MET CB HB3 sing N N 166 MET CG SD sing N N 167 MET CG HG2 sing N N 168 MET CG HG3 sing N N 169 MET SD CE sing N N 170 MET CE HE1 sing N N 171 MET CE HE2 sing N N 172 MET CE HE3 sing N N 173 MET OXT HXT sing N N 174 PHE N CA sing N N 175 PHE N H sing N N 176 PHE N H2 sing N N 177 PHE CA C sing N N 178 PHE CA CB sing N N 179 PHE CA HA sing N N 180 PHE C O doub N N 181 PHE C OXT sing N N 182 PHE CB CG sing N N 183 PHE CB HB2 sing N N 184 PHE CB HB3 sing N N 185 PHE CG CD1 doub Y N 186 PHE CG CD2 sing Y N 187 PHE CD1 CE1 sing Y N 188 PHE CD1 HD1 sing N N 189 PHE CD2 CE2 doub Y N 190 PHE CD2 HD2 sing N N 191 PHE CE1 CZ doub Y N 192 PHE CE1 HE1 sing N N 193 PHE CE2 CZ sing Y N 194 PHE CE2 HE2 sing N N 195 PHE CZ HZ sing N N 196 PHE OXT HXT sing N N 197 PRO N CA sing N N 198 PRO N CD sing N N 199 PRO N H sing N N 200 PRO CA C sing N N 201 PRO CA CB sing N N 202 PRO CA HA sing N N 203 PRO C O doub N N 204 PRO C OXT sing N N 205 PRO CB CG sing N N 206 PRO CB HB2 sing N N 207 PRO CB HB3 sing N N 208 PRO CG CD sing N N 209 PRO CG HG2 sing N N 210 PRO CG HG3 sing N N 211 PRO CD HD2 sing N N 212 PRO CD HD3 sing N N 213 PRO OXT HXT sing N N 214 SER N CA sing N N 215 SER N H sing N N 216 SER N H2 sing N N 217 SER CA C sing N N 218 SER CA CB sing N N 219 SER CA HA sing N N 220 SER C O doub N N 221 SER C OXT sing N N 222 SER CB OG sing N N 223 SER CB HB2 sing N N 224 SER CB HB3 sing N N 225 SER OG HG sing N N 226 SER OXT HXT sing N N 227 THR N CA sing N N 228 THR N H sing N N 229 THR N H2 sing N N 230 THR CA C sing N N 231 THR CA CB sing N N 232 THR CA HA sing N N 233 THR C O doub N N 234 THR C OXT sing N N 235 THR CB OG1 sing N N 236 THR CB CG2 sing N N 237 THR CB HB sing N N 238 THR OG1 HG1 sing N N 239 THR CG2 HG21 sing N N 240 THR CG2 HG22 sing N N 241 THR CG2 HG23 sing N N 242 THR OXT HXT sing N N 243 TYR N CA sing N N 244 TYR N H sing N N 245 TYR N H2 sing N N 246 TYR CA C sing N N 247 TYR CA CB sing N N 248 TYR CA HA sing N N 249 TYR C O doub N N 250 TYR C OXT sing N N 251 TYR CB CG sing N N 252 TYR CB HB2 sing N N 253 TYR CB HB3 sing N N 254 TYR CG CD1 doub Y N 255 TYR CG CD2 sing Y N 256 TYR CD1 CE1 sing Y N 257 TYR CD1 HD1 sing N N 258 TYR CD2 CE2 doub Y N 259 TYR CD2 HD2 sing N N 260 TYR CE1 CZ doub Y N 261 TYR CE1 HE1 sing N N 262 TYR CE2 CZ sing Y N 263 TYR CE2 HE2 sing N N 264 TYR CZ OH sing N N 265 TYR OH HH sing N N 266 TYR OXT HXT sing N N 267 VAL N CA sing N N 268 VAL N H sing N N 269 VAL N H2 sing N N 270 VAL CA C sing N N 271 VAL CA CB sing N N 272 VAL CA HA sing N N 273 VAL C O doub N N 274 VAL C OXT sing N N 275 VAL CB CG1 sing N N 276 VAL CB CG2 sing N N 277 VAL CB HB sing N N 278 VAL CG1 HG11 sing N N 279 VAL CG1 HG12 sing N N 280 VAL CG1 HG13 sing N N 281 VAL CG2 HG21 sing N N 282 VAL CG2 HG22 sing N N 283 VAL CG2 HG23 sing N N 284 VAL OXT HXT sing N N 285 # _atom_sites.entry_id 2BCA _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_