data_2BDT # _entry.id 2BDT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.286 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2BDT RCSB RCSB034975 WWPDB D_1000034975 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id BhR61 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2BDT _pdbx_database_status.recvd_initial_deposition_date 2005-10-20 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Forouhar, F.' 1 'Abashidze, M.' 2 'Jayaraman, S.' 3 'Janjua, H.' 4 'Cooper, B.' 5 'Xiao, R.' 6 'Acton, T.B.' 7 'Montelione, G.T.' 8 'Tong, L.' 9 'Hunt, J.F.' 10 'Northeast Structural Genomics Consortium (NESG)' 11 # _citation.id primary _citation.title 'Crystal Structure of the Putative Gluconate Kinase from Bacillus halodurans, Northeast Structural Genomics Target BhR61' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Forouhar, F.' 1 primary 'Abashidze, M.' 2 primary 'Jayaraman, S.' 3 primary 'Janjua, H.' 4 primary 'Cooper, B.' 5 primary 'Xiao, R.' 6 primary 'Acton, T.B.' 7 primary 'Montelione, G.T.' 8 primary 'Tong, L.' 9 primary 'Hunt, J.F.' 10 # _cell.entry_id 2BDT _cell.length_a 43.675 _cell.length_b 43.675 _cell.length_c 198.846 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2BDT _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man BH3686 22009.365 1 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 water nat water 18.015 36 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)KKLYIITGPAGVGKSTTCKRLAAQLDNSAYIEGDIINH(MSE)VVGGYRPPWESDELLALTWKNITDLTVNFLLA QNDVVLDYIAFPDEAEALAQTVQAKVDDVEIRFIILWTNREELLRRDALRKKDEQ(MSE)GERCLELVEEFESKGIDERY FYNTSHLQPTNLNDIVKNLKTNPRFIFC(MSE)AGDPLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MKKLYIITGPAGVGKSTTCKRLAAQLDNSAYIEGDIINHMVVGGYRPPWESDELLALTWKNITDLTVNFLLAQNDVVLDY IAFPDEAEALAQTVQAKVDDVEIRFIILWTNREELLRRDALRKKDEQMGERCLELVEEFESKGIDERYFYNTSHLQPTNL NDIVKNLKTNPRFIFCMAGDPLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier BhR61 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 LYS n 1 3 LYS n 1 4 LEU n 1 5 TYR n 1 6 ILE n 1 7 ILE n 1 8 THR n 1 9 GLY n 1 10 PRO n 1 11 ALA n 1 12 GLY n 1 13 VAL n 1 14 GLY n 1 15 LYS n 1 16 SER n 1 17 THR n 1 18 THR n 1 19 CYS n 1 20 LYS n 1 21 ARG n 1 22 LEU n 1 23 ALA n 1 24 ALA n 1 25 GLN n 1 26 LEU n 1 27 ASP n 1 28 ASN n 1 29 SER n 1 30 ALA n 1 31 TYR n 1 32 ILE n 1 33 GLU n 1 34 GLY n 1 35 ASP n 1 36 ILE n 1 37 ILE n 1 38 ASN n 1 39 HIS n 1 40 MSE n 1 41 VAL n 1 42 VAL n 1 43 GLY n 1 44 GLY n 1 45 TYR n 1 46 ARG n 1 47 PRO n 1 48 PRO n 1 49 TRP n 1 50 GLU n 1 51 SER n 1 52 ASP n 1 53 GLU n 1 54 LEU n 1 55 LEU n 1 56 ALA n 1 57 LEU n 1 58 THR n 1 59 TRP n 1 60 LYS n 1 61 ASN n 1 62 ILE n 1 63 THR n 1 64 ASP n 1 65 LEU n 1 66 THR n 1 67 VAL n 1 68 ASN n 1 69 PHE n 1 70 LEU n 1 71 LEU n 1 72 ALA n 1 73 GLN n 1 74 ASN n 1 75 ASP n 1 76 VAL n 1 77 VAL n 1 78 LEU n 1 79 ASP n 1 80 TYR n 1 81 ILE n 1 82 ALA n 1 83 PHE n 1 84 PRO n 1 85 ASP n 1 86 GLU n 1 87 ALA n 1 88 GLU n 1 89 ALA n 1 90 LEU n 1 91 ALA n 1 92 GLN n 1 93 THR n 1 94 VAL n 1 95 GLN n 1 96 ALA n 1 97 LYS n 1 98 VAL n 1 99 ASP n 1 100 ASP n 1 101 VAL n 1 102 GLU n 1 103 ILE n 1 104 ARG n 1 105 PHE n 1 106 ILE n 1 107 ILE n 1 108 LEU n 1 109 TRP n 1 110 THR n 1 111 ASN n 1 112 ARG n 1 113 GLU n 1 114 GLU n 1 115 LEU n 1 116 LEU n 1 117 ARG n 1 118 ARG n 1 119 ASP n 1 120 ALA n 1 121 LEU n 1 122 ARG n 1 123 LYS n 1 124 LYS n 1 125 ASP n 1 126 GLU n 1 127 GLN n 1 128 MSE n 1 129 GLY n 1 130 GLU n 1 131 ARG n 1 132 CYS n 1 133 LEU n 1 134 GLU n 1 135 LEU n 1 136 VAL n 1 137 GLU n 1 138 GLU n 1 139 PHE n 1 140 GLU n 1 141 SER n 1 142 LYS n 1 143 GLY n 1 144 ILE n 1 145 ASP n 1 146 GLU n 1 147 ARG n 1 148 TYR n 1 149 PHE n 1 150 TYR n 1 151 ASN n 1 152 THR n 1 153 SER n 1 154 HIS n 1 155 LEU n 1 156 GLN n 1 157 PRO n 1 158 THR n 1 159 ASN n 1 160 LEU n 1 161 ASN n 1 162 ASP n 1 163 ILE n 1 164 VAL n 1 165 LYS n 1 166 ASN n 1 167 LEU n 1 168 LYS n 1 169 THR n 1 170 ASN n 1 171 PRO n 1 172 ARG n 1 173 PHE n 1 174 ILE n 1 175 PHE n 1 176 CYS n 1 177 MSE n 1 178 ALA n 1 179 GLY n 1 180 ASP n 1 181 PRO n 1 182 LEU n 1 183 GLU n 1 184 HIS n 1 185 HIS n 1 186 HIS n 1 187 HIS n 1 188 HIS n 1 189 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Bacillus _entity_src_gen.pdbx_gene_src_gene BH3686 _entity_src_gen.gene_src_species 'Bacillus halodurans' _entity_src_gen.gene_src_strain C-125 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus halodurans' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 272558 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain XL-10 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9K6P2_BACHD _struct_ref.pdbx_db_accession Q9K6P2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKKLYIITGPAGVGKSTTCKRLAAQLDNSAYIEGDIINHMVVGGYRPPWESDELLALTWKNITDLTVNFLLAQNDVVLDY IAFPDEAEALAQTVQAKVDDVEIRFIILWTNREELLRRDALRKKDEQMGERCLELVEEFESKGIDERYFYNTSHLQPTNL NDIVKNLKTNPRFIFC ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2BDT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 176 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9K6P2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 176 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 176 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2BDT MSE A 1 ? UNP Q9K6P2 MET 1 'MODIFIED RESIDUE' 1 1 1 2BDT MSE A 40 ? UNP Q9K6P2 MET 40 'MODIFIED RESIDUE' 40 2 1 2BDT MSE A 128 ? UNP Q9K6P2 MET 128 'MODIFIED RESIDUE' 128 3 1 2BDT MSE A 177 ? UNP Q9K6P2 ? ? 'SEE REMARK 999' 177 4 1 2BDT ALA A 178 ? UNP Q9K6P2 ? ? 'CLONING ARTIFACT' 178 5 1 2BDT GLY A 179 ? UNP Q9K6P2 ? ? 'CLONING ARTIFACT' 179 6 1 2BDT ASP A 180 ? UNP Q9K6P2 ? ? 'CLONING ARTIFACT' 180 7 1 2BDT PRO A 181 ? UNP Q9K6P2 ? ? 'CLONING ARTIFACT' 181 8 1 2BDT LEU A 182 ? UNP Q9K6P2 ? ? 'CLONING ARTIFACT' 182 9 1 2BDT GLU A 183 ? UNP Q9K6P2 ? ? 'CLONING ARTIFACT' 183 10 1 2BDT HIS A 184 ? UNP Q9K6P2 ? ? 'EXPRESSION TAG' 184 11 1 2BDT HIS A 185 ? UNP Q9K6P2 ? ? 'EXPRESSION TAG' 185 12 1 2BDT HIS A 186 ? UNP Q9K6P2 ? ? 'EXPRESSION TAG' 186 13 1 2BDT HIS A 187 ? UNP Q9K6P2 ? ? 'EXPRESSION TAG' 187 14 1 2BDT HIS A 188 ? UNP Q9K6P2 ? ? 'EXPRESSION TAG' 188 15 1 2BDT HIS A 189 ? UNP Q9K6P2 ? ? 'EXPRESSION TAG' 189 16 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2BDT _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.15 _exptl_crystal.density_percent_sol 42.88 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pdbx_details '100mM Bis-Tris, 14% PEG3350, 200mM NH4SO4, 5mM DTT, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2005-10-13 _diffrn_detector.details Mirrors. # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si 111 CHANNEL' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X4A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X4A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.979 # _reflns.entry_id 2BDT _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 50.0 _reflns.d_resolution_high 1.75 _reflns.number_obs 16229 _reflns.number_all 20780 _reflns.percent_possible_obs 78.1 _reflns.pdbx_Rmerge_I_obs 0.077 _reflns.pdbx_Rsym_value 0.067 _reflns.pdbx_netI_over_sigmaI 29.1 _reflns.B_iso_Wilson_estimate 20.0 _reflns.pdbx_redundancy 15.1 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.75 _reflns_shell.d_res_low 1.81 _reflns_shell.percent_possible_all 81.9 _reflns_shell.Rmerge_I_obs 0.658 _reflns_shell.pdbx_Rsym_value 0.625 _reflns_shell.meanI_over_sigI_obs 6.6 _reflns_shell.pdbx_redundancy 18.4 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1639 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2BDT _refine.ls_number_reflns_obs 12334 _refine.ls_number_reflns_all 20780 _refine.pdbx_ls_sigma_I 2.0 _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF 483238.58 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 32.81 _refine.ls_d_res_high 2.40 _refine.ls_percent_reflns_obs 85.7 _refine.ls_R_factor_obs 0.233 _refine.ls_R_factor_all 0.235 _refine.ls_R_factor_R_work 0.233 _refine.ls_R_factor_R_free 0.287 _refine.ls_R_factor_R_free_error 0.008 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.8 _refine.ls_number_reflns_R_free 1211 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 27.9 _refine.aniso_B[1][1] -0.37 _refine.aniso_B[2][2] -0.37 _refine.aniso_B[3][3] 0.74 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.366674 _refine.solvent_model_param_bsol 34.2415 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model OVERALL _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 2BDT _refine_analyze.Luzzati_coordinate_error_obs 0.30 _refine_analyze.Luzzati_sigma_a_obs 0.16 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.41 _refine_analyze.Luzzati_sigma_a_free 0.31 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1391 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 36 _refine_hist.number_atoms_total 1432 _refine_hist.d_res_high 2.40 _refine_hist.d_res_low 32.81 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.006 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 0.9 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 22.2 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.62 ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.40 _refine_ls_shell.d_res_low 2.55 _refine_ls_shell.number_reflns_R_work 2064 _refine_ls_shell.R_factor_R_work 0.237 _refine_ls_shell.percent_reflns_obs 93.7 _refine_ls_shell.R_factor_R_free 0.346 _refine_ls_shell.R_factor_R_free_error 0.024 _refine_ls_shell.percent_reflns_R_free 8.9 _refine_ls_shell.number_reflns_R_free 201 _refine_ls_shell.number_reflns_obs 12334 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # _struct.entry_id 2BDT _struct.title 'Crystal Structure of the Putative Gluconate Kinase from Bacillus halodurans, Northeast Structural Genomics Target BhR61' _struct.pdbx_descriptor BH3686 _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2BDT _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;alpha-beta protein, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details 'Possibly dimer.' _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 14 ? LEU A 26 ? GLY A 14 LEU A 26 1 ? 13 HELX_P HELX_P2 2 GLY A 34 ? HIS A 39 ? GLY A 34 HIS A 39 1 ? 6 HELX_P HELX_P3 3 PRO A 47 ? GLU A 50 ? PRO A 47 GLU A 50 5 ? 4 HELX_P HELX_P4 4 SER A 51 ? ALA A 72 ? SER A 51 ALA A 72 1 ? 22 HELX_P HELX_P5 5 PHE A 83 ? VAL A 98 ? PHE A 83 VAL A 98 1 ? 16 HELX_P HELX_P6 6 ASN A 111 ? ASP A 119 ? ASN A 111 ASP A 119 1 ? 9 HELX_P HELX_P7 7 GLY A 129 ? CYS A 132 ? GLY A 129 CYS A 132 5 ? 4 HELX_P HELX_P8 8 LEU A 133 ? LYS A 142 ? LEU A 133 LYS A 142 1 ? 10 HELX_P HELX_P9 9 GLN A 156 ? THR A 158 ? GLN A 156 THR A 158 5 ? 3 HELX_P HELX_P10 10 ASN A 159 ? ASN A 170 ? ASN A 159 ASN A 170 1 ? 12 HELX_P HELX_P11 11 PRO A 171 ? ILE A 174 ? PRO A 171 ILE A 174 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A MSE 1 C ? ? ? 1_555 A LYS 2 N ? ? A MSE 1 A LYS 2 1_555 ? ? ? ? ? ? ? 1.330 ? covale2 covale ? ? A HIS 39 C ? ? ? 1_555 A MSE 40 N ? ? A HIS 39 A MSE 40 1_555 ? ? ? ? ? ? ? 1.328 ? covale3 covale ? ? A MSE 40 C ? ? ? 1_555 A VAL 41 N ? ? A MSE 40 A VAL 41 1_555 ? ? ? ? ? ? ? 1.331 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 29 ? GLU A 33 ? SER A 29 GLU A 33 A 2 ASP A 75 ? ASP A 79 ? ASP A 75 ASP A 79 A 3 LYS A 2 ? THR A 8 ? LYS A 2 THR A 8 A 4 VAL A 101 ? TRP A 109 ? VAL A 101 TRP A 109 A 5 PHE A 149 ? ASN A 151 ? PHE A 149 ASN A 151 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ALA A 30 ? N ALA A 30 O VAL A 77 ? O VAL A 77 A 2 3 O VAL A 76 ? O VAL A 76 N TYR A 5 ? N TYR A 5 A 3 4 N ILE A 6 ? N ILE A 6 O ARG A 104 ? O ARG A 104 A 4 5 N ILE A 107 ? N ILE A 107 O TYR A 150 ? O TYR A 150 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 7 _struct_site.details 'BINDING SITE FOR RESIDUE SO4 A 190' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 ALA A 11 ? ALA A 11 . ? 1_555 ? 2 AC1 7 GLY A 12 ? GLY A 12 . ? 1_555 ? 3 AC1 7 VAL A 13 ? VAL A 13 . ? 1_555 ? 4 AC1 7 GLY A 14 ? GLY A 14 . ? 1_555 ? 5 AC1 7 LYS A 15 ? LYS A 15 . ? 1_555 ? 6 AC1 7 SER A 16 ? SER A 16 . ? 1_555 ? 7 AC1 7 HOH C . ? HOH A 226 . ? 1_555 ? # _database_PDB_matrix.entry_id 2BDT _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2BDT _atom_sites.fract_transf_matrix[1][1] 0.022896 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022896 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005029 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 MSE 40 40 40 MSE MSE A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 TRP 49 49 49 TRP TRP A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 TRP 59 59 59 TRP TRP A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 PHE 105 105 105 PHE PHE A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 TRP 109 109 109 TRP TRP A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 ASP 119 119 119 ASP ASP A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 ASP 125 125 ? ? ? A . n A 1 126 GLU 126 126 ? ? ? A . n A 1 127 GLN 127 127 ? ? ? A . n A 1 128 MSE 128 128 ? ? ? A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 ARG 131 131 131 ARG ARG A . n A 1 132 CYS 132 132 132 CYS CYS A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 GLU 137 137 137 GLU GLU A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 PHE 139 139 139 PHE PHE A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 ILE 144 144 144 ILE ILE A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 ARG 147 147 147 ARG ARG A . n A 1 148 TYR 148 148 148 TYR TYR A . n A 1 149 PHE 149 149 149 PHE PHE A . n A 1 150 TYR 150 150 150 TYR TYR A . n A 1 151 ASN 151 151 151 ASN ASN A . n A 1 152 THR 152 152 152 THR THR A . n A 1 153 SER 153 153 153 SER SER A . n A 1 154 HIS 154 154 154 HIS HIS A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 GLN 156 156 156 GLN GLN A . n A 1 157 PRO 157 157 157 PRO PRO A . n A 1 158 THR 158 158 158 THR THR A . n A 1 159 ASN 159 159 159 ASN ASN A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 ASN 161 161 161 ASN ASN A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 ILE 163 163 163 ILE ILE A . n A 1 164 VAL 164 164 164 VAL VAL A . n A 1 165 LYS 165 165 165 LYS LYS A . n A 1 166 ASN 166 166 166 ASN ASN A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 LYS 168 168 168 LYS LYS A . n A 1 169 THR 169 169 169 THR THR A . n A 1 170 ASN 170 170 170 ASN ASN A . n A 1 171 PRO 171 171 171 PRO PRO A . n A 1 172 ARG 172 172 172 ARG ARG A . n A 1 173 PHE 173 173 173 PHE PHE A . n A 1 174 ILE 174 174 174 ILE ILE A . n A 1 175 PHE 175 175 175 PHE PHE A . n A 1 176 CYS 176 176 176 CYS CYS A . n A 1 177 MSE 177 177 ? ? ? A . n A 1 178 ALA 178 178 ? ? ? A . n A 1 179 GLY 179 179 ? ? ? A . n A 1 180 ASP 180 180 ? ? ? A . n A 1 181 PRO 181 181 ? ? ? A . n A 1 182 LEU 182 182 ? ? ? A . n A 1 183 GLU 183 183 ? ? ? A . n A 1 184 HIS 184 184 ? ? ? A . n A 1 185 HIS 185 185 ? ? ? A . n A 1 186 HIS 186 186 ? ? ? A . n A 1 187 HIS 187 187 ? ? ? A . n A 1 188 HIS 188 188 ? ? ? A . n A 1 189 HIS 189 189 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 190 1 SO4 SO4 A . C 3 HOH 1 191 1 HOH HOH A . C 3 HOH 2 192 2 HOH HOH A . C 3 HOH 3 193 3 HOH HOH A . C 3 HOH 4 194 4 HOH HOH A . C 3 HOH 5 195 5 HOH HOH A . C 3 HOH 6 196 6 HOH HOH A . C 3 HOH 7 197 7 HOH HOH A . C 3 HOH 8 198 8 HOH HOH A . C 3 HOH 9 199 9 HOH HOH A . C 3 HOH 10 200 10 HOH HOH A . C 3 HOH 11 201 11 HOH HOH A . C 3 HOH 12 202 12 HOH HOH A . C 3 HOH 13 203 13 HOH HOH A . C 3 HOH 14 204 14 HOH HOH A . C 3 HOH 15 205 15 HOH HOH A . C 3 HOH 16 206 16 HOH HOH A . C 3 HOH 17 207 17 HOH HOH A . C 3 HOH 18 208 18 HOH HOH A . C 3 HOH 19 209 19 HOH HOH A . C 3 HOH 20 210 20 HOH HOH A . C 3 HOH 21 211 21 HOH HOH A . C 3 HOH 22 212 22 HOH HOH A . C 3 HOH 23 213 23 HOH HOH A . C 3 HOH 24 214 24 HOH HOH A . C 3 HOH 25 215 25 HOH HOH A . C 3 HOH 26 216 26 HOH HOH A . C 3 HOH 27 217 27 HOH HOH A . C 3 HOH 28 218 28 HOH HOH A . C 3 HOH 29 219 29 HOH HOH A . C 3 HOH 30 220 30 HOH HOH A . C 3 HOH 31 221 31 HOH HOH A . C 3 HOH 32 222 32 HOH HOH A . C 3 HOH 33 223 33 HOH HOH A . C 3 HOH 34 224 34 HOH HOH A . C 3 HOH 35 225 35 HOH HOH A . C 3 HOH 36 226 36 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET SELENOMETHIONINE 2 A MSE 40 A MSE 40 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_556 y,x,-z+1 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 198.8460000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-01 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Source and taxonomy' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Refinement description' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 4 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category software # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_software.name' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 HKL-2000 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 SnB phasing . ? 4 SOLVE phasing . ? 5 RESOLVE phasing . ? 6 XTALVIEW refinement . ? 7 # _pdbx_database_remark.id 999 _pdbx_database_remark.text ;SEQUENCE MSE 177 is a cloning artifact and a modified residue ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 8 ? ? -127.53 -166.54 2 1 VAL A 42 ? ? -100.35 -80.85 3 1 TYR A 80 ? ? -171.37 -178.47 4 1 THR A 110 ? ? -134.40 -80.06 5 1 ASN A 111 ? ? -171.19 144.76 6 1 ALA A 120 ? ? -64.87 5.56 7 1 LYS A 123 ? ? -175.00 66.97 8 1 ILE A 174 ? ? -53.45 8.55 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASP 125 ? A ASP 125 2 1 Y 1 A GLU 126 ? A GLU 126 3 1 Y 1 A GLN 127 ? A GLN 127 4 1 Y 1 A MSE 128 ? A MSE 128 5 1 Y 1 A MSE 177 ? A MSE 177 6 1 Y 1 A ALA 178 ? A ALA 178 7 1 Y 1 A GLY 179 ? A GLY 179 8 1 Y 1 A ASP 180 ? A ASP 180 9 1 Y 1 A PRO 181 ? A PRO 181 10 1 Y 1 A LEU 182 ? A LEU 182 11 1 Y 1 A GLU 183 ? A GLU 183 12 1 Y 1 A HIS 184 ? A HIS 184 13 1 Y 1 A HIS 185 ? A HIS 185 14 1 Y 1 A HIS 186 ? A HIS 186 15 1 Y 1 A HIS 187 ? A HIS 187 16 1 Y 1 A HIS 188 ? A HIS 188 17 1 Y 1 A HIS 189 ? A HIS 189 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH #