data_2BKN # _entry.id 2BKN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2BKN PDBE EBI-23016 WWPDB D_1290023016 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 2BKO unspecified 'STRUCTURE ANALYSIS OF UNKNOWN FUNCTION PROTEIN' PDB 2BKP unspecified 'STRUCTURE ANALYSIS OF UNKNOWN FUNCTION PROTEIN' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2BKN _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2005-02-17 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Inagaki, E.' 1 'Tahirov, T.H.' 2 # _citation.id primary _citation.title 'Crystal Analysis of Putative Potassium Channel Related Protein from Pyrococcus Horikoshii' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Inagaki, E.' 1 primary 'Tahirov, T.H.' 2 # _cell.entry_id 2BKN _cell.length_a 71.131 _cell.length_b 71.131 _cell.length_c 98.521 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2BKN _symmetry.space_group_name_H-M 'P 42 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 94 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'HYPOTHETICAL PROTEIN PH0236' 23012.564 1 ? ? ? ? 2 non-polymer syn 'CESIUM ION' 132.905 10 ? ? ? ? 3 water nat water 18.015 99 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEEVEEFKYEPKSVKEIFIEMKDTVELMVDLAYASLLFGDKEIAEEVLELEERIDLLNYQLMMHSVLAARNVKEAEQVIT ILQIANAIEDISNAAGDLAKMVLEGVELHPVIKETILEGEEIIGKIQVYPESVIVGKTLGELDLATNTGVWIIAVRRGKR WIFGPNENFKIRAGDVLIGRGTRTSIDHLKEIARGAIRVIGNERA ; _entity_poly.pdbx_seq_one_letter_code_can ;MEEVEEFKYEPKSVKEIFIEMKDTVELMVDLAYASLLFGDKEIAEEVLELEERIDLLNYQLMMHSVLAARNVKEAEQVIT ILQIANAIEDISNAAGDLAKMVLEGVELHPVIKETILEGEEIIGKIQVYPESVIVGKTLGELDLATNTGVWIIAVRRGKR WIFGPNENFKIRAGDVLIGRGTRTSIDHLKEIARGAIRVIGNERA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 GLU n 1 4 VAL n 1 5 GLU n 1 6 GLU n 1 7 PHE n 1 8 LYS n 1 9 TYR n 1 10 GLU n 1 11 PRO n 1 12 LYS n 1 13 SER n 1 14 VAL n 1 15 LYS n 1 16 GLU n 1 17 ILE n 1 18 PHE n 1 19 ILE n 1 20 GLU n 1 21 MET n 1 22 LYS n 1 23 ASP n 1 24 THR n 1 25 VAL n 1 26 GLU n 1 27 LEU n 1 28 MET n 1 29 VAL n 1 30 ASP n 1 31 LEU n 1 32 ALA n 1 33 TYR n 1 34 ALA n 1 35 SER n 1 36 LEU n 1 37 LEU n 1 38 PHE n 1 39 GLY n 1 40 ASP n 1 41 LYS n 1 42 GLU n 1 43 ILE n 1 44 ALA n 1 45 GLU n 1 46 GLU n 1 47 VAL n 1 48 LEU n 1 49 GLU n 1 50 LEU n 1 51 GLU n 1 52 GLU n 1 53 ARG n 1 54 ILE n 1 55 ASP n 1 56 LEU n 1 57 LEU n 1 58 ASN n 1 59 TYR n 1 60 GLN n 1 61 LEU n 1 62 MET n 1 63 MET n 1 64 HIS n 1 65 SER n 1 66 VAL n 1 67 LEU n 1 68 ALA n 1 69 ALA n 1 70 ARG n 1 71 ASN n 1 72 VAL n 1 73 LYS n 1 74 GLU n 1 75 ALA n 1 76 GLU n 1 77 GLN n 1 78 VAL n 1 79 ILE n 1 80 THR n 1 81 ILE n 1 82 LEU n 1 83 GLN n 1 84 ILE n 1 85 ALA n 1 86 ASN n 1 87 ALA n 1 88 ILE n 1 89 GLU n 1 90 ASP n 1 91 ILE n 1 92 SER n 1 93 ASN n 1 94 ALA n 1 95 ALA n 1 96 GLY n 1 97 ASP n 1 98 LEU n 1 99 ALA n 1 100 LYS n 1 101 MET n 1 102 VAL n 1 103 LEU n 1 104 GLU n 1 105 GLY n 1 106 VAL n 1 107 GLU n 1 108 LEU n 1 109 HIS n 1 110 PRO n 1 111 VAL n 1 112 ILE n 1 113 LYS n 1 114 GLU n 1 115 THR n 1 116 ILE n 1 117 LEU n 1 118 GLU n 1 119 GLY n 1 120 GLU n 1 121 GLU n 1 122 ILE n 1 123 ILE n 1 124 GLY n 1 125 LYS n 1 126 ILE n 1 127 GLN n 1 128 VAL n 1 129 TYR n 1 130 PRO n 1 131 GLU n 1 132 SER n 1 133 VAL n 1 134 ILE n 1 135 VAL n 1 136 GLY n 1 137 LYS n 1 138 THR n 1 139 LEU n 1 140 GLY n 1 141 GLU n 1 142 LEU n 1 143 ASP n 1 144 LEU n 1 145 ALA n 1 146 THR n 1 147 ASN n 1 148 THR n 1 149 GLY n 1 150 VAL n 1 151 TRP n 1 152 ILE n 1 153 ILE n 1 154 ALA n 1 155 VAL n 1 156 ARG n 1 157 ARG n 1 158 GLY n 1 159 LYS n 1 160 ARG n 1 161 TRP n 1 162 ILE n 1 163 PHE n 1 164 GLY n 1 165 PRO n 1 166 ASN n 1 167 GLU n 1 168 ASN n 1 169 PHE n 1 170 LYS n 1 171 ILE n 1 172 ARG n 1 173 ALA n 1 174 GLY n 1 175 ASP n 1 176 VAL n 1 177 LEU n 1 178 ILE n 1 179 GLY n 1 180 ARG n 1 181 GLY n 1 182 THR n 1 183 ARG n 1 184 THR n 1 185 SER n 1 186 ILE n 1 187 ASP n 1 188 HIS n 1 189 LEU n 1 190 LYS n 1 191 GLU n 1 192 ILE n 1 193 ALA n 1 194 ARG n 1 195 GLY n 1 196 ALA n 1 197 ILE n 1 198 ARG n 1 199 VAL n 1 200 ILE n 1 201 GLY n 1 202 ASN n 1 203 GLU n 1 204 ARG n 1 205 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain OT3 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'PYROCOCCUS HORIKOSHII' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 70601 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET11A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O57975_PYRHO _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession O57975 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2BKN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 205 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O57975 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 205 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 205 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CS non-polymer . 'CESIUM ION' ? 'Cs 1' 132.905 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2BKN _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.72 _exptl_crystal.density_percent_sol 54.43 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.70 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'ROTEIN WAS CRYSTALLIZED FROM 1.25 M SODIUM CHLORIDE, 50 MM ACATATE, PH 4.7; THEN SOAKED IN 1.5 M CSCL.' # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU IMAGE PLATE' _diffrn_detector.pdbx_collection_date 2003-10-30 _diffrn_detector.details MIRRORS # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'SILICON CRYSTAL' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SPRING-8 BEAMLINE BL26B1' _diffrn_source.pdbx_synchrotron_site SPring-8 _diffrn_source.pdbx_synchrotron_beamline BL26B1 _diffrn_source.pdbx_wavelength 1.0 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2BKN _reflns.observed_criterion_sigma_I -1.000 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 35.000 _reflns.d_resolution_high 2.600 _reflns.number_obs 8141 _reflns.number_all ? _reflns.percent_possible_obs 98.8 _reflns.pdbx_Rmerge_I_obs 0.10000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 15.2000 _reflns.B_iso_Wilson_estimate 32.9 _reflns.pdbx_redundancy 4.600 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.60 _reflns_shell.d_res_low 2.69 _reflns_shell.percent_possible_all 99.6 _reflns_shell.Rmerge_I_obs 0.40000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 3.400 _reflns_shell.pdbx_redundancy 4.60 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2BKN _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 7909 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 359332.47 _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 33.45 _refine.ls_d_res_high 2.60 _refine.ls_percent_reflns_obs 96.0 _refine.ls_R_factor_obs 0.226 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.226 _refine.ls_R_factor_R_free 0.257 _refine.ls_R_factor_R_free_error 0.012 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.4 _refine.ls_number_reflns_R_free 430 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 32.5 _refine.aniso_B[1][1] 4.97 _refine.aniso_B[2][2] 4.97 _refine.aniso_B[3][3] -9.93 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.378279 _refine.solvent_model_param_bsol 43.1 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'THE OCCUPANCIES OF SOME CESIUM IONS ARE NOT ONE.' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct OTHER _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.entry_id 2BKN _refine_analyze.Luzzati_coordinate_error_obs 0.31 _refine_analyze.Luzzati_sigma_a_obs 0.36 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.42 _refine_analyze.Luzzati_sigma_a_free 0.45 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1481 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.number_atoms_solvent 99 _refine_hist.number_atoms_total 1590 _refine_hist.d_res_high 2.60 _refine_hist.d_res_low 33.45 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.008 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.3 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 20.7 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.70 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 1.34 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 2.29 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 2.27 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 3.66 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.60 _refine_ls_shell.d_res_low 2.76 _refine_ls_shell.number_reflns_R_work 1150 _refine_ls_shell.R_factor_R_work 0.287 _refine_ls_shell.percent_reflns_obs 90.8 _refine_ls_shell.R_factor_R_free 0.326 _refine_ls_shell.R_factor_R_free_error 0.041 _refine_ls_shell.percent_reflns_R_free 5.2 _refine_ls_shell.number_reflns_R_free 63 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.pdbx_refine_id _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file 'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 WATER_REP.PARAM WATER.TOP 'X-RAY DIFFRACTION' 3 ION.PARAM ION.TOP # _struct.entry_id 2BKN _struct.title 'STRUCTURE ANALYSIS OF UNKNOWN FUNCTION PROTEIN' _struct.pdbx_descriptor 'HYPOTHETICAL PROTEIN PH0236' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2BKN _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text 'HELIX RICH, MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? I N N 2 ? J N N 2 ? K N N 2 ? L N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 13 ? GLY A 39 ? SER A 13 GLY A 39 1 ? 27 HELX_P HELX_P2 2 ASP A 40 ? ALA A 69 ? ASP A 40 ALA A 69 1 ? 30 HELX_P HELX_P3 3 ASN A 71 ? GLU A 104 ? ASN A 71 GLU A 104 1 ? 34 HELX_P HELX_P4 4 PRO A 110 ? GLU A 118 ? PRO A 110 GLU A 118 1 ? 9 HELX_P HELX_P5 5 THR A 138 ? ASP A 143 ? THR A 138 ASP A 143 1 ? 6 HELX_P HELX_P6 6 ASP A 143 ? GLY A 149 ? ASP A 143 GLY A 149 1 ? 7 HELX_P HELX_P7 7 THR A 182 ? ARG A 194 ? THR A 182 ARG A 194 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? B CS . CS ? ? ? 1_555 A VAL 66 O ? ? A CS 1201 A VAL 66 8_666 ? ? ? ? ? ? ? 3.101 ? metalc2 metalc ? ? B CS . CS ? ? ? 1_555 A LEU 67 O ? ? A CS 1201 A LEU 67 8_666 ? ? ? ? ? ? ? 3.906 ? metalc3 metalc ? ? B CS . CS ? ? ? 1_555 A ALA 69 O ? ? A CS 1201 A ALA 69 1_555 ? ? ? ? ? ? ? 2.788 ? metalc4 metalc ? ? B CS . CS ? ? ? 1_555 A VAL 66 O ? ? A CS 1201 A VAL 66 1_555 ? ? ? ? ? ? ? 3.103 ? metalc5 metalc ? ? B CS . CS ? ? ? 1_555 A LEU 67 O ? ? A CS 1201 A LEU 67 1_555 ? ? ? ? ? ? ? 3.909 ? metalc6 metalc ? ? B CS . CS ? ? ? 1_555 A ALA 69 O ? ? A CS 1201 A ALA 69 8_666 ? ? ? ? ? ? ? 2.787 ? metalc7 metalc ? ? C CS . CS ? ? ? 1_555 A ASP 90 OD1 ? ? A CS 1202 A ASP 90 8_666 ? ? ? ? ? ? ? 3.041 ? metalc8 metalc ? ? C CS . CS ? ? ? 1_555 A ASP 90 OD2 ? ? A CS 1202 A ASP 90 1_555 ? ? ? ? ? ? ? 3.752 ? metalc9 metalc ? ? C CS . CS ? ? ? 1_555 L HOH . O ? ? A CS 1202 A HOH 2039 8_666 ? ? ? ? ? ? ? 3.544 ? metalc10 metalc ? ? C CS . CS ? ? ? 1_555 L HOH . O ? ? A CS 1202 A HOH 2041 1_555 ? ? ? ? ? ? ? 3.419 ? metalc11 metalc ? ? C CS . CS ? ? ? 1_555 L HOH . O ? ? A CS 1202 A HOH 2041 2_665 ? ? ? ? ? ? ? 3.421 ? metalc12 metalc ? ? C CS . CS ? ? ? 1_555 L HOH . O ? ? A CS 1202 A HOH 2041 7_556 ? ? ? ? ? ? ? 3.421 ? metalc13 metalc ? ? C CS . CS ? ? ? 1_555 L HOH . O ? ? A CS 1202 A HOH 2041 8_666 ? ? ? ? ? ? ? 3.418 ? metalc14 metalc ? ? C CS . CS ? ? ? 1_555 A ASP 90 OD1 ? ? A CS 1202 A ASP 90 1_555 ? ? ? ? ? ? ? 3.041 ? metalc15 metalc ? ? C CS . CS ? ? ? 1_555 A ASP 90 OD2 ? ? A CS 1202 A ASP 90 8_666 ? ? ? ? ? ? ? 3.751 ? metalc16 metalc ? ? C CS . CS ? ? ? 1_555 L HOH . O ? ? A CS 1202 A HOH 2039 1_555 ? ? ? ? ? ? ? 3.542 ? metalc17 metalc ? ? D CS . CS ? ? ? 1_555 A GLU 89 OE1 ? ? A CS 1203 A GLU 89 1_555 ? ? ? ? ? ? ? 3.313 ? metalc18 metalc ? ? D CS . CS ? ? ? 1_555 A ASN 93 OD1 ? ? A CS 1203 A ASN 93 1_555 ? ? ? ? ? ? ? 2.996 ? metalc19 metalc ? ? D CS . CS ? ? ? 1_555 A GLU 51 OE2 ? ? A CS 1203 A GLU 51 1_555 ? ? ? ? ? ? ? 3.778 ? metalc20 metalc ? ? D CS . CS ? ? ? 1_555 A SER 92 OG ? ? A CS 1203 A SER 92 1_555 ? ? ? ? ? ? ? 3.072 ? metalc21 metalc ? ? D CS . CS ? ? ? 1_555 A GLU 89 OE2 ? ? A CS 1203 A GLU 89 1_555 ? ? ? ? ? ? ? 3.341 ? metalc22 metalc ? ? D CS . CS ? ? ? 1_555 A ASP 55 OD2 ? ? A CS 1203 A ASP 55 1_555 ? ? ? ? ? ? ? 3.537 ? metalc23 metalc ? ? D CS . CS ? ? ? 1_555 L HOH . O ? ? A CS 1203 A HOH 2022 1_555 ? ? ? ? ? ? ? 3.058 ? metalc24 metalc ? ? D CS . CS ? ? ? 1_555 L HOH . O ? ? A CS 1203 A HOH 2027 1_555 ? ? ? ? ? ? ? 3.642 ? metalc25 metalc ? ? D CS . CS ? ? ? 1_555 A GLU 51 O ? ? A CS 1203 A GLU 51 1_555 ? ? ? ? ? ? ? 3.192 ? metalc26 metalc ? ? D CS . CS ? ? ? 1_555 A ASP 55 OD1 ? ? A CS 1203 A ASP 55 1_555 ? ? ? ? ? ? ? 2.765 ? metalc27 metalc ? ? E CS . CS ? ? ? 1_555 A ASP 90 OD2 ? ? A CS 1204 A ASP 90 1_555 ? ? ? ? ? ? ? 3.880 ? metalc28 metalc ? ? E CS . CS ? ? ? 1_555 A ASN 86 OD1 ? ? A CS 1204 A ASN 86 1_555 ? ? ? ? ? ? ? 2.616 ? metalc29 metalc ? ? E CS . CS ? ? ? 1_555 A ASP 90 OD1 ? ? A CS 1204 A ASP 90 1_555 ? ? ? ? ? ? ? 2.998 ? metalc30 metalc ? ? E CS . CS ? ? ? 1_555 L HOH . O ? ? A CS 1204 A HOH 2037 1_555 ? ? ? ? ? ? ? 3.251 ? metalc31 metalc ? ? E CS . CS ? ? ? 1_555 A ASN 86 O ? ? A CS 1204 A ASN 86 1_555 ? ? ? ? ? ? ? 3.575 ? metalc32 metalc ? ? F CS . CS ? ? ? 1_555 A VAL 106 O ? ? A CS 1205 A VAL 106 1_555 ? ? ? ? ? ? ? 3.297 ? metalc33 metalc ? ? F CS . CS ? ? ? 1_555 L HOH . O ? ? A CS 1205 A HOH 2047 1_555 ? ? ? ? ? ? ? 3.334 ? metalc34 metalc ? ? F CS . CS ? ? ? 1_555 L HOH . O ? ? A CS 1205 A HOH 2054 1_555 ? ? ? ? ? ? ? 3.341 ? metalc35 metalc ? ? F CS . CS ? ? ? 1_555 L HOH . O ? ? A CS 1205 A HOH 2055 1_555 ? ? ? ? ? ? ? 3.738 ? metalc36 metalc ? ? F CS . CS ? ? ? 1_555 L HOH . O ? ? A CS 1205 A HOH 2052 1_555 ? ? ? ? ? ? ? 3.764 ? metalc37 metalc ? ? F CS . CS ? ? ? 1_555 A GLY 105 O ? ? A CS 1205 A GLY 105 1_555 ? ? ? ? ? ? ? 3.386 ? metalc38 metalc ? ? G CS . CS ? ? ? 1_555 L HOH . O ? ? A CS 1206 A HOH 2013 1_555 ? ? ? ? ? ? ? 2.757 ? metalc39 metalc ? ? G CS . CS ? ? ? 1_555 A GLY 39 O ? ? A CS 1206 A GLY 39 1_555 ? ? ? ? ? ? ? 3.247 ? metalc40 metalc ? ? G CS . CS ? ? ? 1_555 L HOH . O ? ? A CS 1206 A HOH 2009 1_555 ? ? ? ? ? ? ? 2.693 ? metalc41 metalc ? ? G CS . CS ? ? ? 1_555 A PHE 38 O ? ? A CS 1206 A PHE 38 1_555 ? ? ? ? ? ? ? 3.127 ? metalc42 metalc ? ? H CS . CS ? ? ? 1_555 A GLY 164 O ? ? A CS 1207 A GLY 164 1_555 ? ? ? ? ? ? ? 2.920 ? metalc43 metalc ? ? H CS . CS ? ? ? 1_555 A PHE 163 O ? ? A CS 1207 A PHE 163 1_555 ? ? ? ? ? ? ? 3.049 ? metalc44 metalc ? ? H CS . CS ? ? ? 1_555 L HOH . O ? ? A CS 1207 A HOH 2032 1_555 ? ? ? ? ? ? ? 2.873 ? metalc45 metalc ? ? H CS . CS ? ? ? 1_555 L HOH . O ? ? A CS 1207 A HOH 2084 1_555 ? ? ? ? ? ? ? 3.014 ? metalc46 metalc ? ? H CS . CS ? ? ? 1_555 L HOH . O ? ? A CS 1207 A HOH 2085 1_555 ? ? ? ? ? ? ? 3.616 ? metalc47 metalc ? ? H CS . CS ? ? ? 1_555 L HOH . O ? ? A CS 1207 A HOH 2083 1_555 ? ? ? ? ? ? ? 3.867 ? metalc48 metalc ? ? I CS . CS ? ? ? 1_555 A GLY 164 O ? ? A CS 1208 A GLY 164 1_555 ? ? ? ? ? ? ? 3.314 ? metalc49 metalc ? ? I CS . CS ? ? ? 1_555 A PRO 165 O ? ? A CS 1208 A PRO 165 1_555 ? ? ? ? ? ? ? 3.606 ? metalc50 metalc ? ? I CS . CS ? ? ? 1_555 L HOH . O ? ? A CS 1208 A HOH 2084 1_555 ? ? ? ? ? ? ? 3.088 ? metalc51 metalc ? ? I CS . CS ? ? ? 1_555 A GLU 120 OE2 ? ? A CS 1208 A GLU 120 2_665 ? ? ? ? ? ? ? 3.510 ? metalc52 metalc ? ? J CS . CS ? ? ? 1_555 A GLN 127 NE2 ? ? A CS 1209 A GLN 127 1_555 ? ? ? ? ? ? ? 3.903 ? metalc53 metalc ? ? J CS . CS ? ? ? 1_555 A PRO 11 O ? ? A CS 1209 A PRO 11 5_656 ? ? ? ? ? ? ? 3.052 ? metalc54 metalc ? ? J CS . CS ? ? ? 1_555 A GLY 174 O ? ? A CS 1209 A GLY 174 1_555 ? ? ? ? ? ? ? 2.884 ? metalc55 metalc ? ? J CS . CS ? ? ? 1_555 L HOH . O ? ? A CS 1209 A HOH 2078 1_555 ? ? ? ? ? ? ? 3.596 ? metalc56 metalc ? ? J CS . CS ? ? ? 1_555 A GLN 127 OE1 ? ? A CS 1209 A GLN 127 1_555 ? ? ? ? ? ? ? 3.719 ? metalc57 metalc ? ? K CS . CS ? ? ? 1_555 L HOH . O ? ? A CS 1210 A HOH 2073 1_555 ? ? ? ? ? ? ? 2.852 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 ILE A 122 ? GLN A 127 ? ILE A 122 GLN A 127 AA 2 VAL A 176 ? GLY A 181 ? VAL A 176 GLY A 181 AA 3 TRP A 151 ? ARG A 157 ? TRP A 151 ARG A 157 AA 4 ARG A 160 ? PHE A 163 ? ARG A 160 PHE A 163 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N ILE A 126 ? N ILE A 126 O LEU A 177 ? O LEU A 177 AA 2 3 N ARG A 180 ? N ARG A 180 O TRP A 151 ? O TRP A 151 AA 3 4 N ARG A 157 ? N ARG A 157 O ARG A 160 ? O ARG A 160 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CS A1201' AC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CS A1202' AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CS A1203' AC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CS A1204' AC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CS A1205' AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CS A1206' AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CS A1207' AC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CS A1208' AC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CS A1209' BC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CS A1210' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 VAL A 66 ? VAL A 66 . ? 1_555 ? 2 AC1 2 ALA A 69 ? ALA A 69 . ? 1_555 ? 3 AC2 1 ASP A 90 ? ASP A 90 . ? 1_555 ? 4 AC3 6 GLU A 51 ? GLU A 51 . ? 1_555 ? 5 AC3 6 ASP A 55 ? ASP A 55 . ? 1_555 ? 6 AC3 6 GLU A 89 ? GLU A 89 . ? 1_555 ? 7 AC3 6 SER A 92 ? SER A 92 . ? 1_555 ? 8 AC3 6 ASN A 93 ? ASN A 93 . ? 1_555 ? 9 AC3 6 HOH L . ? HOH A 2022 . ? 1_555 ? 10 AC4 2 ASN A 86 ? ASN A 86 . ? 1_555 ? 11 AC4 2 ASP A 90 ? ASP A 90 . ? 1_555 ? 12 AC5 2 GLY A 105 ? GLY A 105 . ? 1_555 ? 13 AC5 2 VAL A 106 ? VAL A 106 . ? 1_555 ? 14 AC6 4 PHE A 38 ? PHE A 38 . ? 1_555 ? 15 AC6 4 GLY A 39 ? GLY A 39 . ? 1_555 ? 16 AC6 4 HOH L . ? HOH A 2009 . ? 1_555 ? 17 AC6 4 HOH L . ? HOH A 2013 . ? 1_555 ? 18 AC7 4 PHE A 163 ? PHE A 163 . ? 1_555 ? 19 AC7 4 GLY A 164 ? GLY A 164 . ? 1_555 ? 20 AC7 4 HOH L . ? HOH A 2032 . ? 1_555 ? 21 AC7 4 HOH L . ? HOH A 2084 . ? 1_555 ? 22 AC8 4 GLU A 120 ? GLU A 120 . ? 1_555 ? 23 AC8 4 GLY A 164 ? GLY A 164 . ? 1_555 ? 24 AC8 4 PRO A 165 ? PRO A 165 . ? 1_555 ? 25 AC8 4 HOH L . ? HOH A 2084 . ? 1_555 ? 26 AC9 2 PRO A 11 ? PRO A 11 . ? 1_555 ? 27 AC9 2 GLY A 174 ? GLY A 174 . ? 1_555 ? 28 BC1 3 THR A 146 ? THR A 146 . ? 1_555 ? 29 BC1 3 ASN A 147 ? ASN A 147 . ? 1_555 ? 30 BC1 3 HOH L . ? HOH A 2073 . ? 1_555 ? # _database_PDB_matrix.entry_id 2BKN _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2BKN _atom_sites.fract_transf_matrix[1][1] 0.014059 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014059 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010150 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CS N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 GLU 3 3 ? ? ? A . n A 1 4 VAL 4 4 ? ? ? A . n A 1 5 GLU 5 5 ? ? ? A . n A 1 6 GLU 6 6 ? ? ? A . n A 1 7 PHE 7 7 ? ? ? A . n A 1 8 LYS 8 8 ? ? ? A . n A 1 9 TYR 9 9 ? ? ? A . n A 1 10 GLU 10 10 ? ? ? A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 MET 28 28 28 MET MET A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 MET 62 62 62 MET MET A . n A 1 63 MET 63 63 63 MET MET A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 ASN 93 93 93 ASN ASN A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 MET 101 101 101 MET MET A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 HIS 109 109 109 HIS HIS A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 THR 115 115 115 THR THR A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 ILE 123 123 123 ILE ILE A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 GLN 127 127 127 GLN GLN A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 TYR 129 129 129 TYR TYR A . n A 1 130 PRO 130 130 130 PRO PRO A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 LYS 137 137 137 LYS LYS A . n A 1 138 THR 138 138 138 THR THR A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 ASP 143 143 143 ASP ASP A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 THR 146 146 146 THR THR A . n A 1 147 ASN 147 147 147 ASN ASN A . n A 1 148 THR 148 148 148 THR THR A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 VAL 150 150 150 VAL VAL A . n A 1 151 TRP 151 151 151 TRP TRP A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 ILE 153 153 153 ILE ILE A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 ARG 157 157 157 ARG ARG A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 LYS 159 159 159 LYS LYS A . n A 1 160 ARG 160 160 160 ARG ARG A . n A 1 161 TRP 161 161 161 TRP TRP A . n A 1 162 ILE 162 162 162 ILE ILE A . n A 1 163 PHE 163 163 163 PHE PHE A . n A 1 164 GLY 164 164 164 GLY GLY A . n A 1 165 PRO 165 165 165 PRO PRO A . n A 1 166 ASN 166 166 166 ASN ASN A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 ASN 168 168 168 ASN ASN A . n A 1 169 PHE 169 169 169 PHE PHE A . n A 1 170 LYS 170 170 170 LYS LYS A . n A 1 171 ILE 171 171 171 ILE ILE A . n A 1 172 ARG 172 172 172 ARG ARG A . n A 1 173 ALA 173 173 173 ALA ALA A . n A 1 174 GLY 174 174 174 GLY GLY A . n A 1 175 ASP 175 175 175 ASP ASP A . n A 1 176 VAL 176 176 176 VAL VAL A . n A 1 177 LEU 177 177 177 LEU LEU A . n A 1 178 ILE 178 178 178 ILE ILE A . n A 1 179 GLY 179 179 179 GLY GLY A . n A 1 180 ARG 180 180 180 ARG ARG A . n A 1 181 GLY 181 181 181 GLY GLY A . n A 1 182 THR 182 182 182 THR THR A . n A 1 183 ARG 183 183 183 ARG ARG A . n A 1 184 THR 184 184 184 THR THR A . n A 1 185 SER 185 185 185 SER SER A . n A 1 186 ILE 186 186 186 ILE ILE A . n A 1 187 ASP 187 187 187 ASP ASP A . n A 1 188 HIS 188 188 188 HIS HIS A . n A 1 189 LEU 189 189 189 LEU LEU A . n A 1 190 LYS 190 190 190 LYS LYS A . n A 1 191 GLU 191 191 191 GLU GLU A . n A 1 192 ILE 192 192 192 ILE ILE A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 ARG 194 194 194 ARG ARG A . n A 1 195 GLY 195 195 195 GLY GLY A . n A 1 196 ALA 196 196 196 ALA ALA A . n A 1 197 ILE 197 197 197 ILE ILE A . n A 1 198 ARG 198 198 198 ARG ARG A . n A 1 199 VAL 199 199 199 VAL VAL A . n A 1 200 ILE 200 200 200 ILE ILE A . n A 1 201 GLY 201 201 201 GLY GLY A . n A 1 202 ASN 202 202 ? ? ? A . n A 1 203 GLU 203 203 ? ? ? A . n A 1 204 ARG 204 204 ? ? ? A . n A 1 205 ALA 205 205 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CS 1 1201 1201 CS CS A . C 2 CS 1 1202 1202 CS CS A . D 2 CS 1 1203 1203 CS CS A . E 2 CS 1 1204 1204 CS CS A . F 2 CS 1 1205 1205 CS CS A . G 2 CS 1 1206 1206 CS CS A . H 2 CS 1 1207 1207 CS CS A . I 2 CS 1 1208 1208 CS CS A . J 2 CS 1 1209 1209 CS CS A . K 2 CS 1 1210 1210 CS CS A . L 3 HOH 1 2001 2001 HOH HOH A . L 3 HOH 2 2002 2002 HOH HOH A . L 3 HOH 3 2003 2003 HOH HOH A . L 3 HOH 4 2004 2004 HOH HOH A . L 3 HOH 5 2005 2005 HOH HOH A . L 3 HOH 6 2006 2006 HOH HOH A . L 3 HOH 7 2007 2007 HOH HOH A . L 3 HOH 8 2008 2008 HOH HOH A . L 3 HOH 9 2009 2009 HOH HOH A . L 3 HOH 10 2010 2010 HOH HOH A . L 3 HOH 11 2011 2011 HOH HOH A . L 3 HOH 12 2012 2012 HOH HOH A . L 3 HOH 13 2013 2013 HOH HOH A . L 3 HOH 14 2014 2014 HOH HOH A . L 3 HOH 15 2015 2015 HOH HOH A . L 3 HOH 16 2016 2016 HOH HOH A . L 3 HOH 17 2017 2017 HOH HOH A . L 3 HOH 18 2018 2018 HOH HOH A . L 3 HOH 19 2019 2019 HOH HOH A . L 3 HOH 20 2020 2020 HOH HOH A . L 3 HOH 21 2021 2021 HOH HOH A . L 3 HOH 22 2022 2022 HOH HOH A . L 3 HOH 23 2023 2023 HOH HOH A . L 3 HOH 24 2024 2024 HOH HOH A . L 3 HOH 25 2025 2025 HOH HOH A . L 3 HOH 26 2026 2026 HOH HOH A . L 3 HOH 27 2027 2027 HOH HOH A . L 3 HOH 28 2028 2028 HOH HOH A . L 3 HOH 29 2029 2029 HOH HOH A . L 3 HOH 30 2030 2030 HOH HOH A . L 3 HOH 31 2031 2031 HOH HOH A . L 3 HOH 32 2032 2032 HOH HOH A . L 3 HOH 33 2033 2033 HOH HOH A . L 3 HOH 34 2034 2034 HOH HOH A . L 3 HOH 35 2035 2035 HOH HOH A . L 3 HOH 36 2036 2036 HOH HOH A . L 3 HOH 37 2037 2037 HOH HOH A . L 3 HOH 38 2038 2038 HOH HOH A . L 3 HOH 39 2039 2039 HOH HOH A . L 3 HOH 40 2040 2040 HOH HOH A . L 3 HOH 41 2041 2041 HOH HOH A . L 3 HOH 42 2042 2042 HOH HOH A . L 3 HOH 43 2043 2043 HOH HOH A . L 3 HOH 44 2044 2044 HOH HOH A . L 3 HOH 45 2045 2045 HOH HOH A . L 3 HOH 46 2046 2046 HOH HOH A . L 3 HOH 47 2047 2047 HOH HOH A . L 3 HOH 48 2048 2048 HOH HOH A . L 3 HOH 49 2049 2049 HOH HOH A . L 3 HOH 50 2050 2050 HOH HOH A . L 3 HOH 51 2051 2051 HOH HOH A . L 3 HOH 52 2052 2052 HOH HOH A . L 3 HOH 53 2053 2053 HOH HOH A . L 3 HOH 54 2054 2054 HOH HOH A . L 3 HOH 55 2055 2055 HOH HOH A . L 3 HOH 56 2056 2056 HOH HOH A . L 3 HOH 57 2057 2057 HOH HOH A . L 3 HOH 58 2058 2058 HOH HOH A . L 3 HOH 59 2059 2059 HOH HOH A . L 3 HOH 60 2060 2060 HOH HOH A . L 3 HOH 61 2061 2061 HOH HOH A . L 3 HOH 62 2062 2062 HOH HOH A . L 3 HOH 63 2063 2063 HOH HOH A . L 3 HOH 64 2064 2064 HOH HOH A . L 3 HOH 65 2065 2065 HOH HOH A . L 3 HOH 66 2066 2066 HOH HOH A . L 3 HOH 67 2067 2067 HOH HOH A . L 3 HOH 68 2068 2068 HOH HOH A . L 3 HOH 69 2069 2069 HOH HOH A . L 3 HOH 70 2070 2070 HOH HOH A . L 3 HOH 71 2071 2071 HOH HOH A . L 3 HOH 72 2072 2072 HOH HOH A . L 3 HOH 73 2073 2073 HOH HOH A . L 3 HOH 74 2074 2074 HOH HOH A . L 3 HOH 75 2075 2075 HOH HOH A . L 3 HOH 76 2076 2076 HOH HOH A . L 3 HOH 77 2077 2077 HOH HOH A . L 3 HOH 78 2078 2078 HOH HOH A . L 3 HOH 79 2079 2079 HOH HOH A . L 3 HOH 80 2080 2080 HOH HOH A . L 3 HOH 81 2081 2081 HOH HOH A . L 3 HOH 82 2082 2082 HOH HOH A . L 3 HOH 83 2083 2083 HOH HOH A . L 3 HOH 84 2084 2084 HOH HOH A . L 3 HOH 85 2085 2085 HOH HOH A . L 3 HOH 86 2086 2086 HOH HOH A . L 3 HOH 87 2087 2087 HOH HOH A . L 3 HOH 88 2088 2088 HOH HOH A . L 3 HOH 89 2089 2089 HOH HOH A . L 3 HOH 90 2090 2090 HOH HOH A . L 3 HOH 91 2091 2091 HOH HOH A . L 3 HOH 92 2092 2092 HOH HOH A . L 3 HOH 93 2093 2093 HOH HOH A . L 3 HOH 94 2094 2094 HOH HOH A . L 3 HOH 95 2095 2095 HOH HOH A . L 3 HOH 96 2096 2096 HOH HOH A . L 3 HOH 97 2097 2097 HOH HOH A . L 3 HOH 98 2098 2098 HOH HOH A . L 3 HOH 99 2099 2099 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 71.1310000000 0.0000000000 -1.0000000000 0.0000000000 71.1310000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A CS 1201 ? B CS . 2 1 A CS 1202 ? C CS . 3 1 A HOH 2041 ? L HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A VAL 66 ? A VAL 66 ? 8_666 CS ? B CS . ? A CS 1201 ? 1_555 O ? A LEU 67 ? A LEU 67 ? 8_666 62.7 ? 2 O ? A VAL 66 ? A VAL 66 ? 8_666 CS ? B CS . ? A CS 1201 ? 1_555 O ? A ALA 69 ? A ALA 69 ? 1_555 96.5 ? 3 O ? A LEU 67 ? A LEU 67 ? 8_666 CS ? B CS . ? A CS 1201 ? 1_555 O ? A ALA 69 ? A ALA 69 ? 1_555 96.1 ? 4 O ? A VAL 66 ? A VAL 66 ? 8_666 CS ? B CS . ? A CS 1201 ? 1_555 O ? A VAL 66 ? A VAL 66 ? 1_555 67.0 ? 5 O ? A LEU 67 ? A LEU 67 ? 8_666 CS ? B CS . ? A CS 1201 ? 1_555 O ? A VAL 66 ? A VAL 66 ? 1_555 129.4 ? 6 O ? A ALA 69 ? A ALA 69 ? 1_555 CS ? B CS . ? A CS 1201 ? 1_555 O ? A VAL 66 ? A VAL 66 ? 1_555 94.6 ? 7 O ? A VAL 66 ? A VAL 66 ? 8_666 CS ? B CS . ? A CS 1201 ? 1_555 O ? A LEU 67 ? A LEU 67 ? 1_555 129.3 ? 8 O ? A LEU 67 ? A LEU 67 ? 8_666 CS ? B CS . ? A CS 1201 ? 1_555 O ? A LEU 67 ? A LEU 67 ? 1_555 168.0 ? 9 O ? A ALA 69 ? A ALA 69 ? 1_555 CS ? B CS . ? A CS 1201 ? 1_555 O ? A LEU 67 ? A LEU 67 ? 1_555 82.6 ? 10 O ? A VAL 66 ? A VAL 66 ? 1_555 CS ? B CS . ? A CS 1201 ? 1_555 O ? A LEU 67 ? A LEU 67 ? 1_555 62.6 ? 11 O ? A VAL 66 ? A VAL 66 ? 8_666 CS ? B CS . ? A CS 1201 ? 1_555 O ? A ALA 69 ? A ALA 69 ? 8_666 94.6 ? 12 O ? A LEU 67 ? A LEU 67 ? 8_666 CS ? B CS . ? A CS 1201 ? 1_555 O ? A ALA 69 ? A ALA 69 ? 8_666 82.6 ? 13 O ? A ALA 69 ? A ALA 69 ? 1_555 CS ? B CS . ? A CS 1201 ? 1_555 O ? A ALA 69 ? A ALA 69 ? 8_666 166.7 ? 14 O ? A VAL 66 ? A VAL 66 ? 1_555 CS ? B CS . ? A CS 1201 ? 1_555 O ? A ALA 69 ? A ALA 69 ? 8_666 96.4 ? 15 O ? A LEU 67 ? A LEU 67 ? 1_555 CS ? B CS . ? A CS 1201 ? 1_555 O ? A ALA 69 ? A ALA 69 ? 8_666 96.0 ? 16 OD1 ? A ASP 90 ? A ASP 90 ? 8_666 CS ? C CS . ? A CS 1202 ? 1_555 OD2 ? A ASP 90 ? A ASP 90 ? 1_555 114.6 ? 17 OD1 ? A ASP 90 ? A ASP 90 ? 8_666 CS ? C CS . ? A CS 1202 ? 1_555 O ? L HOH . ? A HOH 2039 ? 8_666 44.2 ? 18 OD2 ? A ASP 90 ? A ASP 90 ? 1_555 CS ? C CS . ? A CS 1202 ? 1_555 O ? L HOH . ? A HOH 2039 ? 8_666 100.3 ? 19 OD1 ? A ASP 90 ? A ASP 90 ? 8_666 CS ? C CS . ? A CS 1202 ? 1_555 O ? L HOH . ? A HOH 2041 ? 1_555 156.4 ? 20 OD2 ? A ASP 90 ? A ASP 90 ? 1_555 CS ? C CS . ? A CS 1202 ? 1_555 O ? L HOH . ? A HOH 2041 ? 1_555 71.3 ? 21 O ? L HOH . ? A HOH 2039 ? 8_666 CS ? C CS . ? A CS 1202 ? 1_555 O ? L HOH . ? A HOH 2041 ? 1_555 113.3 ? 22 OD1 ? A ASP 90 ? A ASP 90 ? 8_666 CS ? C CS . ? A CS 1202 ? 1_555 O ? L HOH . ? A HOH 2041 ? 2_665 156.4 ? 23 OD2 ? A ASP 90 ? A ASP 90 ? 1_555 CS ? C CS . ? A CS 1202 ? 1_555 O ? L HOH . ? A HOH 2041 ? 2_665 71.4 ? 24 O ? L HOH . ? A HOH 2039 ? 8_666 CS ? C CS . ? A CS 1202 ? 1_555 O ? L HOH . ? A HOH 2041 ? 2_665 113.3 ? 25 O ? L HOH . ? A HOH 2041 ? 1_555 CS ? C CS . ? A CS 1202 ? 1_555 O ? L HOH . ? A HOH 2041 ? 2_665 0.1 ? 26 OD1 ? A ASP 90 ? A ASP 90 ? 8_666 CS ? C CS . ? A CS 1202 ? 1_555 O ? L HOH . ? A HOH 2041 ? 7_556 68.7 ? 27 OD2 ? A ASP 90 ? A ASP 90 ? 1_555 CS ? C CS . ? A CS 1202 ? 1_555 O ? L HOH . ? A HOH 2041 ? 7_556 159.0 ? 28 O ? L HOH . ? A HOH 2039 ? 8_666 CS ? C CS . ? A CS 1202 ? 1_555 O ? L HOH . ? A HOH 2041 ? 7_556 66.9 ? 29 O ? L HOH . ? A HOH 2041 ? 1_555 CS ? C CS . ? A CS 1202 ? 1_555 O ? L HOH . ? A HOH 2041 ? 7_556 97.7 ? 30 O ? L HOH . ? A HOH 2041 ? 2_665 CS ? C CS . ? A CS 1202 ? 1_555 O ? L HOH . ? A HOH 2041 ? 7_556 97.6 ? 31 OD1 ? A ASP 90 ? A ASP 90 ? 8_666 CS ? C CS . ? A CS 1202 ? 1_555 O ? L HOH . ? A HOH 2041 ? 8_666 68.7 ? 32 OD2 ? A ASP 90 ? A ASP 90 ? 1_555 CS ? C CS . ? A CS 1202 ? 1_555 O ? L HOH . ? A HOH 2041 ? 8_666 159.0 ? 33 O ? L HOH . ? A HOH 2039 ? 8_666 CS ? C CS . ? A CS 1202 ? 1_555 O ? L HOH . ? A HOH 2041 ? 8_666 66.9 ? 34 O ? L HOH . ? A HOH 2041 ? 1_555 CS ? C CS . ? A CS 1202 ? 1_555 O ? L HOH . ? A HOH 2041 ? 8_666 97.7 ? 35 O ? L HOH . ? A HOH 2041 ? 2_665 CS ? C CS . ? A CS 1202 ? 1_555 O ? L HOH . ? A HOH 2041 ? 8_666 97.7 ? 36 O ? L HOH . ? A HOH 2041 ? 7_556 CS ? C CS . ? A CS 1202 ? 1_555 O ? L HOH . ? A HOH 2041 ? 8_666 0.1 ? 37 OD1 ? A ASP 90 ? A ASP 90 ? 8_666 CS ? C CS . ? A CS 1202 ? 1_555 OD1 ? A ASP 90 ? A ASP 90 ? 1_555 130.3 ? 38 OD2 ? A ASP 90 ? A ASP 90 ? 1_555 CS ? C CS . ? A CS 1202 ? 1_555 OD1 ? A ASP 90 ? A ASP 90 ? 1_555 36.0 ? 39 O ? L HOH . ? A HOH 2039 ? 8_666 CS ? C CS . ? A CS 1202 ? 1_555 OD1 ? A ASP 90 ? A ASP 90 ? 1_555 135.5 ? 40 O ? L HOH . ? A HOH 2041 ? 1_555 CS ? C CS . ? A CS 1202 ? 1_555 OD1 ? A ASP 90 ? A ASP 90 ? 1_555 68.7 ? 41 O ? L HOH . ? A HOH 2041 ? 2_665 CS ? C CS . ? A CS 1202 ? 1_555 OD1 ? A ASP 90 ? A ASP 90 ? 1_555 68.7 ? 42 O ? L HOH . ? A HOH 2041 ? 7_556 CS ? C CS . ? A CS 1202 ? 1_555 OD1 ? A ASP 90 ? A ASP 90 ? 1_555 156.5 ? 43 O ? L HOH . ? A HOH 2041 ? 8_666 CS ? C CS . ? A CS 1202 ? 1_555 OD1 ? A ASP 90 ? A ASP 90 ? 1_555 156.5 ? 44 OD1 ? A ASP 90 ? A ASP 90 ? 8_666 CS ? C CS . ? A CS 1202 ? 1_555 OD2 ? A ASP 90 ? A ASP 90 ? 8_666 36.0 ? 45 OD2 ? A ASP 90 ? A ASP 90 ? 1_555 CS ? C CS . ? A CS 1202 ? 1_555 OD2 ? A ASP 90 ? A ASP 90 ? 8_666 124.4 ? 46 O ? L HOH . ? A HOH 2039 ? 8_666 CS ? C CS . ? A CS 1202 ? 1_555 OD2 ? A ASP 90 ? A ASP 90 ? 8_666 79.5 ? 47 O ? L HOH . ? A HOH 2041 ? 1_555 CS ? C CS . ? A CS 1202 ? 1_555 OD2 ? A ASP 90 ? A ASP 90 ? 8_666 159.1 ? 48 O ? L HOH . ? A HOH 2041 ? 2_665 CS ? C CS . ? A CS 1202 ? 1_555 OD2 ? A ASP 90 ? A ASP 90 ? 8_666 159.0 ? 49 O ? L HOH . ? A HOH 2041 ? 7_556 CS ? C CS . ? A CS 1202 ? 1_555 OD2 ? A ASP 90 ? A ASP 90 ? 8_666 71.4 ? 50 O ? L HOH . ? A HOH 2041 ? 8_666 CS ? C CS . ? A CS 1202 ? 1_555 OD2 ? A ASP 90 ? A ASP 90 ? 8_666 71.4 ? 51 OD1 ? A ASP 90 ? A ASP 90 ? 1_555 CS ? C CS . ? A CS 1202 ? 1_555 OD2 ? A ASP 90 ? A ASP 90 ? 8_666 114.6 ? 52 OD1 ? A ASP 90 ? A ASP 90 ? 8_666 CS ? C CS . ? A CS 1202 ? 1_555 O ? L HOH . ? A HOH 2039 ? 1_555 135.6 ? 53 OD2 ? A ASP 90 ? A ASP 90 ? 1_555 CS ? C CS . ? A CS 1202 ? 1_555 O ? L HOH . ? A HOH 2039 ? 1_555 79.5 ? 54 O ? L HOH . ? A HOH 2039 ? 8_666 CS ? C CS . ? A CS 1202 ? 1_555 O ? L HOH . ? A HOH 2039 ? 1_555 179.7 ? 55 O ? L HOH . ? A HOH 2041 ? 1_555 CS ? C CS . ? A CS 1202 ? 1_555 O ? L HOH . ? A HOH 2039 ? 1_555 66.9 ? 56 O ? L HOH . ? A HOH 2041 ? 2_665 CS ? C CS . ? A CS 1202 ? 1_555 O ? L HOH . ? A HOH 2039 ? 1_555 66.9 ? 57 O ? L HOH . ? A HOH 2041 ? 7_556 CS ? C CS . ? A CS 1202 ? 1_555 O ? L HOH . ? A HOH 2039 ? 1_555 113.3 ? 58 O ? L HOH . ? A HOH 2041 ? 8_666 CS ? C CS . ? A CS 1202 ? 1_555 O ? L HOH . ? A HOH 2039 ? 1_555 113.4 ? 59 OD1 ? A ASP 90 ? A ASP 90 ? 1_555 CS ? C CS . ? A CS 1202 ? 1_555 O ? L HOH . ? A HOH 2039 ? 1_555 44.3 ? 60 OD2 ? A ASP 90 ? A ASP 90 ? 8_666 CS ? C CS . ? A CS 1202 ? 1_555 O ? L HOH . ? A HOH 2039 ? 1_555 100.4 ? 61 OE1 ? A GLU 89 ? A GLU 89 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 OD1 ? A ASN 93 ? A ASN 93 ? 1_555 71.3 ? 62 OE1 ? A GLU 89 ? A GLU 89 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 OE2 ? A GLU 51 ? A GLU 51 ? 1_555 121.1 ? 63 OD1 ? A ASN 93 ? A ASN 93 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 OE2 ? A GLU 51 ? A GLU 51 ? 1_555 49.8 ? 64 OE1 ? A GLU 89 ? A GLU 89 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 OG ? A SER 92 ? A SER 92 ? 1_555 103.6 ? 65 OD1 ? A ASN 93 ? A ASN 93 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 OG ? A SER 92 ? A SER 92 ? 1_555 94.9 ? 66 OE2 ? A GLU 51 ? A GLU 51 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 OG ? A SER 92 ? A SER 92 ? 1_555 85.1 ? 67 OE1 ? A GLU 89 ? A GLU 89 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 OE2 ? A GLU 89 ? A GLU 89 ? 1_555 38.8 ? 68 OD1 ? A ASN 93 ? A ASN 93 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 OE2 ? A GLU 89 ? A GLU 89 ? 1_555 109.6 ? 69 OE2 ? A GLU 51 ? A GLU 51 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 OE2 ? A GLU 89 ? A GLU 89 ? 1_555 158.4 ? 70 OG ? A SER 92 ? A SER 92 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 OE2 ? A GLU 89 ? A GLU 89 ? 1_555 105.6 ? 71 OE1 ? A GLU 89 ? A GLU 89 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 OD2 ? A ASP 55 ? A ASP 55 ? 1_555 100.3 ? 72 OD1 ? A ASN 93 ? A ASN 93 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 OD2 ? A ASP 55 ? A ASP 55 ? 1_555 109.6 ? 73 OE2 ? A GLU 51 ? A GLU 51 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 OD2 ? A ASP 55 ? A ASP 55 ? 1_555 97.7 ? 74 OG ? A SER 92 ? A SER 92 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 OD2 ? A ASP 55 ? A ASP 55 ? 1_555 150.2 ? 75 OE2 ? A GLU 89 ? A GLU 89 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 OD2 ? A ASP 55 ? A ASP 55 ? 1_555 82.4 ? 76 OE1 ? A GLU 89 ? A GLU 89 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 O ? L HOH . ? A HOH 2022 ? 1_555 102.2 ? 77 OD1 ? A ASN 93 ? A ASN 93 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 O ? L HOH . ? A HOH 2022 ? 1_555 58.3 ? 78 OE2 ? A GLU 51 ? A GLU 51 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 O ? L HOH . ? A HOH 2022 ? 1_555 48.3 ? 79 OG ? A SER 92 ? A SER 92 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 O ? L HOH . ? A HOH 2022 ? 1_555 133.3 ? 80 OE2 ? A GLU 89 ? A GLU 89 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 O ? L HOH . ? A HOH 2022 ? 1_555 118.7 ? 81 OD2 ? A ASP 55 ? A ASP 55 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 O ? L HOH . ? A HOH 2022 ? 1_555 56.1 ? 82 OE1 ? A GLU 89 ? A GLU 89 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 O ? L HOH . ? A HOH 2027 ? 1_555 56.7 ? 83 OD1 ? A ASN 93 ? A ASN 93 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 O ? L HOH . ? A HOH 2027 ? 1_555 61.2 ? 84 OE2 ? A GLU 51 ? A GLU 51 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 O ? L HOH . ? A HOH 2027 ? 1_555 89.2 ? 85 OG ? A SER 92 ? A SER 92 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 O ? L HOH . ? A HOH 2027 ? 1_555 151.8 ? 86 OE2 ? A GLU 89 ? A GLU 89 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 O ? L HOH . ? A HOH 2027 ? 1_555 72.4 ? 87 OD2 ? A ASP 55 ? A ASP 55 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 O ? L HOH . ? A HOH 2027 ? 1_555 57.9 ? 88 O ? L HOH . ? A HOH 2022 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 O ? L HOH . ? A HOH 2027 ? 1_555 48.4 ? 89 OE1 ? A GLU 89 ? A GLU 89 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 O ? A GLU 51 ? A GLU 51 ? 1_555 138.0 ? 90 OD1 ? A ASN 93 ? A ASN 93 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 O ? A GLU 51 ? A GLU 51 ? 1_555 148.3 ? 91 OE2 ? A GLU 51 ? A GLU 51 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 O ? A GLU 51 ? A GLU 51 ? 1_555 99.5 ? 92 OG ? A SER 92 ? A SER 92 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 O ? A GLU 51 ? A GLU 51 ? 1_555 89.3 ? 93 OE2 ? A GLU 89 ? A GLU 89 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 O ? A GLU 51 ? A GLU 51 ? 1_555 99.3 ? 94 OD2 ? A ASP 55 ? A ASP 55 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 O ? A GLU 51 ? A GLU 51 ? 1_555 60.9 ? 95 O ? L HOH . ? A HOH 2022 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 O ? A GLU 51 ? A GLU 51 ? 1_555 96.8 ? 96 O ? L HOH . ? A HOH 2027 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 O ? A GLU 51 ? A GLU 51 ? 1_555 118.9 ? 97 OE1 ? A GLU 89 ? A GLU 89 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 OD1 ? A ASP 55 ? A ASP 55 ? 1_555 68.0 ? 98 OD1 ? A ASN 93 ? A ASN 93 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 OD1 ? A ASP 55 ? A ASP 55 ? 1_555 115.4 ? 99 OE2 ? A GLU 51 ? A GLU 51 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 OD1 ? A ASP 55 ? A ASP 55 ? 1_555 132.1 ? 100 OG ? A SER 92 ? A SER 92 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 OD1 ? A ASP 55 ? A ASP 55 ? 1_555 141.7 ? 101 OE2 ? A GLU 89 ? A GLU 89 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 OD1 ? A ASP 55 ? A ASP 55 ? 1_555 44.0 ? 102 OD2 ? A ASP 55 ? A ASP 55 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 OD1 ? A ASP 55 ? A ASP 55 ? 1_555 38.5 ? 103 O ? L HOH . ? A HOH 2022 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 OD1 ? A ASP 55 ? A ASP 55 ? 1_555 84.3 ? 104 O ? L HOH . ? A HOH 2027 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 OD1 ? A ASP 55 ? A ASP 55 ? 1_555 54.8 ? 105 O ? A GLU 51 ? A GLU 51 ? 1_555 CS ? D CS . ? A CS 1203 ? 1_555 OD1 ? A ASP 55 ? A ASP 55 ? 1_555 77.1 ? 106 OD2 ? A ASP 90 ? A ASP 90 ? 1_555 CS ? E CS . ? A CS 1204 ? 1_555 OD1 ? A ASN 86 ? A ASN 86 ? 1_555 85.8 ? 107 OD2 ? A ASP 90 ? A ASP 90 ? 1_555 CS ? E CS . ? A CS 1204 ? 1_555 OD1 ? A ASP 90 ? A ASP 90 ? 1_555 34.5 ? 108 OD1 ? A ASN 86 ? A ASN 86 ? 1_555 CS ? E CS . ? A CS 1204 ? 1_555 OD1 ? A ASP 90 ? A ASP 90 ? 1_555 120.3 ? 109 OD2 ? A ASP 90 ? A ASP 90 ? 1_555 CS ? E CS . ? A CS 1204 ? 1_555 O ? L HOH . ? A HOH 2037 ? 1_555 143.8 ? 110 OD1 ? A ASN 86 ? A ASN 86 ? 1_555 CS ? E CS . ? A CS 1204 ? 1_555 O ? L HOH . ? A HOH 2037 ? 1_555 66.3 ? 111 OD1 ? A ASP 90 ? A ASP 90 ? 1_555 CS ? E CS . ? A CS 1204 ? 1_555 O ? L HOH . ? A HOH 2037 ? 1_555 157.2 ? 112 OD2 ? A ASP 90 ? A ASP 90 ? 1_555 CS ? E CS . ? A CS 1204 ? 1_555 O ? A ASN 86 ? A ASN 86 ? 1_555 55.5 ? 113 OD1 ? A ASN 86 ? A ASN 86 ? 1_555 CS ? E CS . ? A CS 1204 ? 1_555 O ? A ASN 86 ? A ASN 86 ? 1_555 65.2 ? 114 OD1 ? A ASP 90 ? A ASP 90 ? 1_555 CS ? E CS . ? A CS 1204 ? 1_555 O ? A ASN 86 ? A ASN 86 ? 1_555 74.8 ? 115 O ? L HOH . ? A HOH 2037 ? 1_555 CS ? E CS . ? A CS 1204 ? 1_555 O ? A ASN 86 ? A ASN 86 ? 1_555 90.7 ? 116 O ? A VAL 106 ? A VAL 106 ? 1_555 CS ? F CS . ? A CS 1205 ? 1_555 O ? L HOH . ? A HOH 2047 ? 1_555 92.1 ? 117 O ? A VAL 106 ? A VAL 106 ? 1_555 CS ? F CS . ? A CS 1205 ? 1_555 O ? L HOH . ? A HOH 2054 ? 1_555 68.1 ? 118 O ? L HOH . ? A HOH 2047 ? 1_555 CS ? F CS . ? A CS 1205 ? 1_555 O ? L HOH . ? A HOH 2054 ? 1_555 108.8 ? 119 O ? A VAL 106 ? A VAL 106 ? 1_555 CS ? F CS . ? A CS 1205 ? 1_555 O ? L HOH . ? A HOH 2055 ? 1_555 91.4 ? 120 O ? L HOH . ? A HOH 2047 ? 1_555 CS ? F CS . ? A CS 1205 ? 1_555 O ? L HOH . ? A HOH 2055 ? 1_555 68.6 ? 121 O ? L HOH . ? A HOH 2054 ? 1_555 CS ? F CS . ? A CS 1205 ? 1_555 O ? L HOH . ? A HOH 2055 ? 1_555 46.1 ? 122 O ? A VAL 106 ? A VAL 106 ? 1_555 CS ? F CS . ? A CS 1205 ? 1_555 O ? L HOH . ? A HOH 2052 ? 1_555 86.3 ? 123 O ? L HOH . ? A HOH 2047 ? 1_555 CS ? F CS . ? A CS 1205 ? 1_555 O ? L HOH . ? A HOH 2052 ? 1_555 140.8 ? 124 O ? L HOH . ? A HOH 2054 ? 1_555 CS ? F CS . ? A CS 1205 ? 1_555 O ? L HOH . ? A HOH 2052 ? 1_555 106.8 ? 125 O ? L HOH . ? A HOH 2055 ? 1_555 CS ? F CS . ? A CS 1205 ? 1_555 O ? L HOH . ? A HOH 2052 ? 1_555 150.5 ? 126 O ? A VAL 106 ? A VAL 106 ? 1_555 CS ? F CS . ? A CS 1205 ? 1_555 O ? A GLY 105 ? A GLY 105 ? 1_555 61.2 ? 127 O ? L HOH . ? A HOH 2047 ? 1_555 CS ? F CS . ? A CS 1205 ? 1_555 O ? A GLY 105 ? A GLY 105 ? 1_555 93.4 ? 128 O ? L HOH . ? A HOH 2054 ? 1_555 CS ? F CS . ? A CS 1205 ? 1_555 O ? A GLY 105 ? A GLY 105 ? 1_555 125.0 ? 129 O ? L HOH . ? A HOH 2055 ? 1_555 CS ? F CS . ? A CS 1205 ? 1_555 O ? A GLY 105 ? A GLY 105 ? 1_555 147.3 ? 130 O ? L HOH . ? A HOH 2052 ? 1_555 CS ? F CS . ? A CS 1205 ? 1_555 O ? A GLY 105 ? A GLY 105 ? 1_555 52.0 ? 131 O ? L HOH . ? A HOH 2013 ? 1_555 CS ? G CS . ? A CS 1206 ? 1_555 O ? A GLY 39 ? A GLY 39 ? 1_555 108.6 ? 132 O ? L HOH . ? A HOH 2013 ? 1_555 CS ? G CS . ? A CS 1206 ? 1_555 O ? L HOH . ? A HOH 2009 ? 1_555 149.3 ? 133 O ? A GLY 39 ? A GLY 39 ? 1_555 CS ? G CS . ? A CS 1206 ? 1_555 O ? L HOH . ? A HOH 2009 ? 1_555 76.1 ? 134 O ? L HOH . ? A HOH 2013 ? 1_555 CS ? G CS . ? A CS 1206 ? 1_555 O ? A PHE 38 ? A PHE 38 ? 1_555 66.9 ? 135 O ? A GLY 39 ? A GLY 39 ? 1_555 CS ? G CS . ? A CS 1206 ? 1_555 O ? A PHE 38 ? A PHE 38 ? 1_555 62.4 ? 136 O ? L HOH . ? A HOH 2009 ? 1_555 CS ? G CS . ? A CS 1206 ? 1_555 O ? A PHE 38 ? A PHE 38 ? 1_555 90.8 ? 137 O ? A GLY 164 ? A GLY 164 ? 1_555 CS ? H CS . ? A CS 1207 ? 1_555 O ? A PHE 163 ? A PHE 163 ? 1_555 60.5 ? 138 O ? A GLY 164 ? A GLY 164 ? 1_555 CS ? H CS . ? A CS 1207 ? 1_555 O ? L HOH . ? A HOH 2032 ? 1_555 129.1 ? 139 O ? A PHE 163 ? A PHE 163 ? 1_555 CS ? H CS . ? A CS 1207 ? 1_555 O ? L HOH . ? A HOH 2032 ? 1_555 111.6 ? 140 O ? A GLY 164 ? A GLY 164 ? 1_555 CS ? H CS . ? A CS 1207 ? 1_555 O ? L HOH . ? A HOH 2084 ? 1_555 54.7 ? 141 O ? A PHE 163 ? A PHE 163 ? 1_555 CS ? H CS . ? A CS 1207 ? 1_555 O ? L HOH . ? A HOH 2084 ? 1_555 102.5 ? 142 O ? L HOH . ? A HOH 2032 ? 1_555 CS ? H CS . ? A CS 1207 ? 1_555 O ? L HOH . ? A HOH 2084 ? 1_555 83.0 ? 143 O ? A GLY 164 ? A GLY 164 ? 1_555 CS ? H CS . ? A CS 1207 ? 1_555 O ? L HOH . ? A HOH 2085 ? 1_555 91.6 ? 144 O ? A PHE 163 ? A PHE 163 ? 1_555 CS ? H CS . ? A CS 1207 ? 1_555 O ? L HOH . ? A HOH 2085 ? 1_555 101.8 ? 145 O ? L HOH . ? A HOH 2032 ? 1_555 CS ? H CS . ? A CS 1207 ? 1_555 O ? L HOH . ? A HOH 2085 ? 1_555 136.2 ? 146 O ? L HOH . ? A HOH 2084 ? 1_555 CS ? H CS . ? A CS 1207 ? 1_555 O ? L HOH . ? A HOH 2085 ? 1_555 117.1 ? 147 O ? A GLY 164 ? A GLY 164 ? 1_555 CS ? H CS . ? A CS 1207 ? 1_555 O ? L HOH . ? A HOH 2083 ? 1_555 61.4 ? 148 O ? A PHE 163 ? A PHE 163 ? 1_555 CS ? H CS . ? A CS 1207 ? 1_555 O ? L HOH . ? A HOH 2083 ? 1_555 69.7 ? 149 O ? L HOH . ? A HOH 2032 ? 1_555 CS ? H CS . ? A CS 1207 ? 1_555 O ? L HOH . ? A HOH 2083 ? 1_555 68.8 ? 150 O ? L HOH . ? A HOH 2084 ? 1_555 CS ? H CS . ? A CS 1207 ? 1_555 O ? L HOH . ? A HOH 2083 ? 1_555 45.2 ? 151 O ? L HOH . ? A HOH 2085 ? 1_555 CS ? H CS . ? A CS 1207 ? 1_555 O ? L HOH . ? A HOH 2083 ? 1_555 152.8 ? 152 O ? A GLY 164 ? A GLY 164 ? 1_555 CS ? I CS . ? A CS 1208 ? 1_555 O ? A PRO 165 ? A PRO 165 ? 1_555 54.8 ? 153 O ? A GLY 164 ? A GLY 164 ? 1_555 CS ? I CS . ? A CS 1208 ? 1_555 O ? L HOH . ? A HOH 2084 ? 1_555 50.3 ? 154 O ? A PRO 165 ? A PRO 165 ? 1_555 CS ? I CS . ? A CS 1208 ? 1_555 O ? L HOH . ? A HOH 2084 ? 1_555 98.5 ? 155 O ? A GLY 164 ? A GLY 164 ? 1_555 CS ? I CS . ? A CS 1208 ? 1_555 OE2 ? A GLU 120 ? A GLU 120 ? 2_665 140.3 ? 156 O ? A PRO 165 ? A PRO 165 ? 1_555 CS ? I CS . ? A CS 1208 ? 1_555 OE2 ? A GLU 120 ? A GLU 120 ? 2_665 103.3 ? 157 O ? L HOH . ? A HOH 2084 ? 1_555 CS ? I CS . ? A CS 1208 ? 1_555 OE2 ? A GLU 120 ? A GLU 120 ? 2_665 155.9 ? 158 NE2 ? A GLN 127 ? A GLN 127 ? 1_555 CS ? J CS . ? A CS 1209 ? 1_555 O ? A PRO 11 ? A PRO 11 ? 5_656 85.5 ? 159 NE2 ? A GLN 127 ? A GLN 127 ? 1_555 CS ? J CS . ? A CS 1209 ? 1_555 O ? A GLY 174 ? A GLY 174 ? 1_555 66.6 ? 160 O ? A PRO 11 ? A PRO 11 ? 5_656 CS ? J CS . ? A CS 1209 ? 1_555 O ? A GLY 174 ? A GLY 174 ? 1_555 97.5 ? 161 NE2 ? A GLN 127 ? A GLN 127 ? 1_555 CS ? J CS . ? A CS 1209 ? 1_555 O ? L HOH . ? A HOH 2078 ? 1_555 104.7 ? 162 O ? A PRO 11 ? A PRO 11 ? 5_656 CS ? J CS . ? A CS 1209 ? 1_555 O ? L HOH . ? A HOH 2078 ? 1_555 144.4 ? 163 O ? A GLY 174 ? A GLY 174 ? 1_555 CS ? J CS . ? A CS 1209 ? 1_555 O ? L HOH . ? A HOH 2078 ? 1_555 58.4 ? 164 NE2 ? A GLN 127 ? A GLN 127 ? 1_555 CS ? J CS . ? A CS 1209 ? 1_555 OE1 ? A GLN 127 ? A GLN 127 ? 1_555 34.4 ? 165 O ? A PRO 11 ? A PRO 11 ? 5_656 CS ? J CS . ? A CS 1209 ? 1_555 OE1 ? A GLN 127 ? A GLN 127 ? 1_555 99.0 ? 166 O ? A GLY 174 ? A GLY 174 ? 1_555 CS ? J CS . ? A CS 1209 ? 1_555 OE1 ? A GLN 127 ? A GLN 127 ? 1_555 96.1 ? 167 O ? L HOH . ? A HOH 2078 ? 1_555 CS ? J CS . ? A CS 1209 ? 1_555 OE1 ? A GLN 127 ? A GLN 127 ? 1_555 108.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-06-28 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 HKL-2000 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 CNS phasing . ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 148 ? A -154.81 -5.62 2 1 ARG A 157 ? ? -105.28 78.42 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A VAL 199 ? CG1 ? A VAL 199 CG1 2 1 Y 1 A VAL 199 ? CG2 ? A VAL 199 CG2 3 1 Y 1 A ILE 200 ? CG1 ? A ILE 200 CG1 4 1 Y 1 A ILE 200 ? CG2 ? A ILE 200 CG2 5 1 Y 1 A ILE 200 ? CD1 ? A ILE 200 CD1 6 1 Y 1 A GLY 201 ? CA ? A GLY 201 CA 7 1 Y 1 A GLY 201 ? C ? A GLY 201 C 8 1 Y 1 A GLY 201 ? O ? A GLY 201 O # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A GLU 3 ? A GLU 3 4 1 Y 1 A VAL 4 ? A VAL 4 5 1 Y 1 A GLU 5 ? A GLU 5 6 1 Y 1 A GLU 6 ? A GLU 6 7 1 Y 1 A PHE 7 ? A PHE 7 8 1 Y 1 A LYS 8 ? A LYS 8 9 1 Y 1 A TYR 9 ? A TYR 9 10 1 Y 1 A GLU 10 ? A GLU 10 11 1 Y 1 A ASN 202 ? A ASN 202 12 1 Y 1 A GLU 203 ? A GLU 203 13 1 Y 1 A ARG 204 ? A ARG 204 14 1 Y 1 A ALA 205 ? A ALA 205 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CESIUM ION' CS 3 water HOH #