data_2BM3 # _entry.id 2BM3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2BM3 PDBE EBI-23204 WWPDB D_1290023204 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2BM3 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2005-03-09 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Carvalho, A.L.' 1 'Gloster, T.M.' 2 'Pires, V.M.R.' 3 'Proctor, M.R.' 4 'Prates, J.A.M.' 5 'Ferreira, L.M.A.' 6 'Turkenburg, J.P.' 7 'Romao, M.J.' 8 'Davies, G.J.' 9 'Gilbert, H.J.' 10 'Fontes, C.M.G.A.' 11 # _citation.id primary _citation.title ;Insights Into the Structural Determinants of Cohesin-Dockerin Specificity Revealed by the Crystal Structure of the Type II Cohesin from Clostridium Thermocellum Sdba. ; _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 349 _citation.page_first 909 _citation.page_last ? _citation.year 2005 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15913653 _citation.pdbx_database_id_DOI 10.1016/J.JMB.2005.04.037 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Carvalho, A.L.' 1 primary 'Pires, V.M.R.' 2 primary 'Gloster, T.M.' 3 primary 'Turkenburg, J.P.' 4 primary 'Prates, J.A.M.' 5 primary 'Ferreira, L.M.A.' 6 primary 'Romao, M.J.' 7 primary 'Davies, G.J.' 8 primary 'Fontes, C.M.G.A.' 9 primary 'Gilbert, H.J.' 10 # _cell.entry_id 2BM3 _cell.length_a 79.677 _cell.length_b 79.677 _cell.length_c 101.745 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2BM3 _symmetry.space_group_name_H-M 'P 63 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 182 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'SCAFFOLDING DOCKERIN BINDING PROTEIN A' 18062.449 1 ? ? 'RESIDUES 29-191' ? 2 non-polymer syn 'ISOPROPYL ALCOHOL' 60.095 4 ? ? ? ? 3 water nat water 18.015 194 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'TYPE 2 COHESIN' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MASDKASSIELKFDRNKGEVGDILIGTVRINNIKNFAGFQVNIVYDPKVLMAVDPETGKEFTSSTFPPGRTVLKNNAYGP IQIADNDPEKGILNFALAYSYIAGYKETGVAEESGIIAKIGFKILQKKSTAVKFQDTLSMPGAISGTQLFDWDGEVITGY EVIQPD ; _entity_poly.pdbx_seq_one_letter_code_can ;MASDKASSIELKFDRNKGEVGDILIGTVRINNIKNFAGFQVNIVYDPKVLMAVDPETGKEFTSSTFPPGRTVLKNNAYGP IQIADNDPEKGILNFALAYSYIAGYKETGVAEESGIIAKIGFKILQKKSTAVKFQDTLSMPGAISGTQLFDWDGEVITGY EVIQPD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 SER n 1 4 ASP n 1 5 LYS n 1 6 ALA n 1 7 SER n 1 8 SER n 1 9 ILE n 1 10 GLU n 1 11 LEU n 1 12 LYS n 1 13 PHE n 1 14 ASP n 1 15 ARG n 1 16 ASN n 1 17 LYS n 1 18 GLY n 1 19 GLU n 1 20 VAL n 1 21 GLY n 1 22 ASP n 1 23 ILE n 1 24 LEU n 1 25 ILE n 1 26 GLY n 1 27 THR n 1 28 VAL n 1 29 ARG n 1 30 ILE n 1 31 ASN n 1 32 ASN n 1 33 ILE n 1 34 LYS n 1 35 ASN n 1 36 PHE n 1 37 ALA n 1 38 GLY n 1 39 PHE n 1 40 GLN n 1 41 VAL n 1 42 ASN n 1 43 ILE n 1 44 VAL n 1 45 TYR n 1 46 ASP n 1 47 PRO n 1 48 LYS n 1 49 VAL n 1 50 LEU n 1 51 MET n 1 52 ALA n 1 53 VAL n 1 54 ASP n 1 55 PRO n 1 56 GLU n 1 57 THR n 1 58 GLY n 1 59 LYS n 1 60 GLU n 1 61 PHE n 1 62 THR n 1 63 SER n 1 64 SER n 1 65 THR n 1 66 PHE n 1 67 PRO n 1 68 PRO n 1 69 GLY n 1 70 ARG n 1 71 THR n 1 72 VAL n 1 73 LEU n 1 74 LYS n 1 75 ASN n 1 76 ASN n 1 77 ALA n 1 78 TYR n 1 79 GLY n 1 80 PRO n 1 81 ILE n 1 82 GLN n 1 83 ILE n 1 84 ALA n 1 85 ASP n 1 86 ASN n 1 87 ASP n 1 88 PRO n 1 89 GLU n 1 90 LYS n 1 91 GLY n 1 92 ILE n 1 93 LEU n 1 94 ASN n 1 95 PHE n 1 96 ALA n 1 97 LEU n 1 98 ALA n 1 99 TYR n 1 100 SER n 1 101 TYR n 1 102 ILE n 1 103 ALA n 1 104 GLY n 1 105 TYR n 1 106 LYS n 1 107 GLU n 1 108 THR n 1 109 GLY n 1 110 VAL n 1 111 ALA n 1 112 GLU n 1 113 GLU n 1 114 SER n 1 115 GLY n 1 116 ILE n 1 117 ILE n 1 118 ALA n 1 119 LYS n 1 120 ILE n 1 121 GLY n 1 122 PHE n 1 123 LYS n 1 124 ILE n 1 125 LEU n 1 126 GLN n 1 127 LYS n 1 128 LYS n 1 129 SER n 1 130 THR n 1 131 ALA n 1 132 VAL n 1 133 LYS n 1 134 PHE n 1 135 GLN n 1 136 ASP n 1 137 THR n 1 138 LEU n 1 139 SER n 1 140 MET n 1 141 PRO n 1 142 GLY n 1 143 ALA n 1 144 ILE n 1 145 SER n 1 146 GLY n 1 147 THR n 1 148 GLN n 1 149 LEU n 1 150 PHE n 1 151 ASP n 1 152 TRP n 1 153 ASP n 1 154 GLY n 1 155 GLU n 1 156 VAL n 1 157 ILE n 1 158 THR n 1 159 GLY n 1 160 TYR n 1 161 GLU n 1 162 VAL n 1 163 ILE n 1 164 GLN n 1 165 PRO n 1 166 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'CLOSTRIDIUM THERMOCELLUM' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1515 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code P71143_CLOTM _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P71143 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2BM3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 166 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P71143 _struct_ref_seq.db_align_beg 29 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 191 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 166 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2BM3 MET A 1 ? UNP P71143 ? ? 'expression tag' 1 1 1 2BM3 ALA A 2 ? UNP P71143 ? ? 'expression tag' 2 2 1 2BM3 SER A 3 ? UNP P71143 ? ? 'expression tag' 3 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IPA non-polymer . 'ISOPROPYL ALCOHOL' 2-PROPANOL 'C3 H8 O' 60.095 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2BM3 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.17 _exptl_crystal.density_percent_sol 42.96 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '2MM CACL2, 5% ISOPROPANOL AND 2M AMONNIUM SULPHATE. CRYO-PROTECTED WITH 30% GLYCEROL' # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC CCD' _diffrn_detector.pdbx_collection_date 2005-02-12 _diffrn_detector.details 'TOROIDAL MIRROR' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'DIAMOND (111), GE(220)' _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.933 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID14-2' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID14-2 _diffrn_source.pdbx_wavelength 0.933 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2BM3 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20.000 _reflns.d_resolution_high 1.800 _reflns.number_obs 18256 _reflns.number_all ? _reflns.percent_possible_obs 100.0 _reflns.pdbx_Rmerge_I_obs 0.06000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 73.5000 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 35.200 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.80 _reflns_shell.d_res_low 1.86 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs 0.40000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 15.000 _reflns_shell.pdbx_redundancy 35.90 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2BM3 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 17299 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 69.01 _refine.ls_d_res_high 1.80 _refine.ls_percent_reflns_obs 99.7 _refine.ls_R_factor_obs 0.192 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.189 _refine.ls_R_factor_R_free 0.260 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.100 _refine.ls_number_reflns_R_free 928 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.959 _refine.correlation_coeff_Fo_to_Fc_free 0.921 _refine.B_iso_mean 22.79 _refine.aniso_B[1][1] 0.71000 _refine.aniso_B[2][2] 0.71000 _refine.aniso_B[3][3] -1.06000 _refine.aniso_B[1][2] 0.35000 _refine.aniso_B[1][3] 0.00000 _refine.aniso_B[2][3] 0.00000 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'COMBINED MULTIPLE WAVELENGTH AND MULTIPLE ISOMORPHOUS REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.128 _refine.pdbx_overall_ESU_R_Free 0.142 _refine.overall_SU_ML 0.092 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 2.907 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1229 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 16 _refine_hist.number_atoms_solvent 194 _refine_hist.number_atoms_total 1439 _refine_hist.d_res_high 1.80 _refine_hist.d_res_low 69.01 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.015 0.022 ? 1376 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.529 1.979 ? 1891 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.097 5.000 ? 196 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 42.092 26.562 ? 64 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 13.859 15.000 ? 238 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 24.534 15.000 ? 3 'X-RAY DIFFRACTION' ? r_chiral_restr 0.119 0.200 ? 213 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.006 0.020 ? 1068 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.205 0.200 ? 630 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.315 0.200 ? 948 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.153 0.200 ? 129 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.211 0.200 ? 54 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.127 0.200 ? 11 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.033 1.500 ? 887 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1.640 2.000 ? 1405 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 2.447 3.000 ? 555 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it 3.493 4.500 ? 468 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.80 _refine_ls_shell.d_res_low 1.85 _refine_ls_shell.number_reflns_R_work 1222 _refine_ls_shell.R_factor_R_work 0.2530 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.3700 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 76 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 2BM3 _struct.title 'Structure of the Type II cohesin from Clostridium thermocellum SdbA' _struct.pdbx_descriptor 'SCAFFOLDING DOCKERIN BINDING PROTEIN A' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2BM3 _struct_keywords.pdbx_keywords 'NUCLEAR PROTEIN' _struct_keywords.text 'COHESIN, TYPE 2, CELLULOSOME, DOCKERIN, NUCLEAR PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 75 ? TYR A 78 ? ASN A 75 TYR A 78 5 ? 4 HELX_P HELX_P2 2 PRO A 88 ? LYS A 90 ? PRO A 88 LYS A 90 5 ? 3 HELX_P HELX_P3 3 TYR A 101 ? GLY A 109 ? TYR A 101 GLY A 109 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 5 ? AB ? 4 ? AC ? 5 ? AD ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AA 4 5 ? parallel AB 1 2 ? anti-parallel AB 2 3 ? anti-parallel AB 3 4 ? anti-parallel AC 1 2 ? anti-parallel AC 2 3 ? anti-parallel AC 3 4 ? anti-parallel AC 4 5 ? anti-parallel AD 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 LEU A 50 ? VAL A 53 ? LEU A 50 VAL A 53 AA 2 GLY A 115 ? ILE A 124 ? GLY A 115 ILE A 124 AA 3 ILE A 23 ? ASN A 31 ? ILE A 23 ASN A 31 AA 4 SER A 8 ? PHE A 13 ? SER A 8 PHE A 13 AA 5 GLU A 161 ? ILE A 163 ? GLU A 161 ILE A 163 AB 1 PRO A 80 ? ALA A 84 ? PRO A 80 ALA A 84 AB 2 ILE A 92 ? TYR A 99 ? ILE A 92 TYR A 99 AB 3 PHE A 36 ? VAL A 44 ? PHE A 36 VAL A 44 AB 4 LYS A 133 ? PHE A 134 ? LYS A 133 PHE A 134 AC 1 PRO A 80 ? ALA A 84 ? PRO A 80 ALA A 84 AC 2 ILE A 92 ? TYR A 99 ? ILE A 92 TYR A 99 AC 3 PHE A 36 ? VAL A 44 ? PHE A 36 VAL A 44 AC 4 THR A 147 ? ASP A 151 ? THR A 147 ASP A 151 AC 5 VAL A 156 ? ILE A 157 ? VAL A 156 ILE A 157 AD 1 LYS A 133 ? PHE A 134 ? LYS A 133 PHE A 134 AD 2 PHE A 36 ? VAL A 44 ? PHE A 36 VAL A 44 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N VAL A 53 ? N VAL A 53 O GLY A 121 ? O GLY A 121 AA 2 3 N PHE A 122 ? N PHE A 122 O LEU A 24 ? O LEU A 24 AA 3 4 N ASN A 31 ? N ASN A 31 O SER A 8 ? O SER A 8 AA 4 5 N ILE A 9 ? N ILE A 9 O GLU A 161 ? O GLU A 161 AB 1 2 N ILE A 83 ? N ILE A 83 O ALA A 96 ? O ALA A 96 AB 2 3 N TYR A 99 ? N TYR A 99 O ALA A 37 ? O ALA A 37 AB 3 4 N VAL A 44 ? N VAL A 44 O LYS A 133 ? O LYS A 133 AC 1 2 N ILE A 83 ? N ILE A 83 O ALA A 96 ? O ALA A 96 AC 2 3 N TYR A 99 ? N TYR A 99 O ALA A 37 ? O ALA A 37 AC 3 4 N GLN A 40 ? N GLN A 40 O GLN A 148 ? O GLN A 148 AC 4 5 N LEU A 149 ? N LEU A 149 O ILE A 157 ? O ILE A 157 AD 1 2 N LYS A 133 ? N LYS A 133 O VAL A 44 ? O VAL A 44 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE IPA A 1167' AC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE IPA A 1168' AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE IPA A 1169' AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE IPA A 1170' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ALA A 98 ? ALA A 98 . ? 1_555 ? 2 AC1 4 GLY A 154 ? GLY A 154 . ? 1_555 ? 3 AC1 4 HOH F . ? HOH A 2121 . ? 1_555 ? 4 AC1 4 HOH F . ? HOH A 2193 . ? 1_555 ? 5 AC2 2 THR A 27 ? THR A 27 . ? 1_555 ? 6 AC2 2 ARG A 29 ? ARG A 29 . ? 1_555 ? 7 AC3 5 VAL A 20 ? VAL A 20 . ? 3_565 ? 8 AC3 5 VAL A 20 ? VAL A 20 . ? 8_565 ? 9 AC3 5 GLY A 21 ? GLY A 21 . ? 3_565 ? 10 AC3 5 ASP A 22 ? ASP A 22 . ? 3_565 ? 11 AC3 5 HOH F . ? HOH A 2021 . ? 8_565 ? 12 AC4 4 ALA A 96 ? ALA A 96 . ? 11_555 ? 13 AC4 4 LEU A 138 ? LEU A 138 . ? 1_555 ? 14 AC4 4 PRO A 141 ? PRO A 141 . ? 1_555 ? 15 AC4 4 HOH F . ? HOH A 2194 . ? 1_555 ? # _database_PDB_matrix.entry_id 2BM3 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2BM3 _atom_sites.fract_transf_matrix[1][1] 0.012551 _atom_sites.fract_transf_matrix[1][2] 0.007246 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014492 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009828 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 ASP 4 4 ? ? ? A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 MET 51 51 51 MET MET A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 TYR 99 99 99 TYR TYR A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 TYR 101 101 101 TYR TYR A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 TYR 105 105 105 TYR TYR A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 ILE 117 117 117 ILE ILE A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 PHE 122 122 122 PHE PHE A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 GLN 126 126 126 GLN GLN A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 LYS 133 133 133 LYS LYS A . n A 1 134 PHE 134 134 134 PHE PHE A . n A 1 135 GLN 135 135 135 GLN GLN A . n A 1 136 ASP 136 136 136 ASP ASP A . n A 1 137 THR 137 137 137 THR THR A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 SER 139 139 139 SER SER A . n A 1 140 MET 140 140 140 MET MET A . n A 1 141 PRO 141 141 141 PRO PRO A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 ILE 144 144 144 ILE ILE A . n A 1 145 SER 145 145 145 SER SER A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 THR 147 147 147 THR THR A . n A 1 148 GLN 148 148 148 GLN GLN A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 PHE 150 150 150 PHE PHE A . n A 1 151 ASP 151 151 151 ASP ASP A . n A 1 152 TRP 152 152 152 TRP TRP A . n A 1 153 ASP 153 153 153 ASP ASP A . n A 1 154 GLY 154 154 154 GLY GLY A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 VAL 156 156 156 VAL VAL A . n A 1 157 ILE 157 157 157 ILE ILE A . n A 1 158 THR 158 158 158 THR THR A . n A 1 159 GLY 159 159 159 GLY GLY A . n A 1 160 TYR 160 160 160 TYR TYR A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 VAL 162 162 162 VAL VAL A . n A 1 163 ILE 163 163 163 ILE ILE A . n A 1 164 GLN 164 164 164 GLN GLN A . n A 1 165 PRO 165 165 165 PRO PRO A . n A 1 166 ASP 166 166 166 ASP ASP A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 IPA 1 1167 1167 IPA IPA A . C 2 IPA 1 1168 1168 IPA IPA A . D 2 IPA 1 1169 1169 IPA IPA A . E 2 IPA 1 1170 1170 IPA IPA A . F 3 HOH 1 2001 2001 HOH HOH A . F 3 HOH 2 2002 2002 HOH HOH A . F 3 HOH 3 2003 2003 HOH HOH A . F 3 HOH 4 2004 2004 HOH HOH A . F 3 HOH 5 2005 2005 HOH HOH A . F 3 HOH 6 2006 2006 HOH HOH A . F 3 HOH 7 2007 2007 HOH HOH A . F 3 HOH 8 2008 2008 HOH HOH A . F 3 HOH 9 2009 2009 HOH HOH A . F 3 HOH 10 2010 2010 HOH HOH A . F 3 HOH 11 2011 2011 HOH HOH A . F 3 HOH 12 2012 2012 HOH HOH A . F 3 HOH 13 2013 2013 HOH HOH A . F 3 HOH 14 2014 2014 HOH HOH A . F 3 HOH 15 2015 2015 HOH HOH A . F 3 HOH 16 2016 2016 HOH HOH A . F 3 HOH 17 2017 2017 HOH HOH A . F 3 HOH 18 2018 2018 HOH HOH A . F 3 HOH 19 2019 2019 HOH HOH A . F 3 HOH 20 2020 2020 HOH HOH A . F 3 HOH 21 2021 2021 HOH HOH A . F 3 HOH 22 2022 2022 HOH HOH A . F 3 HOH 23 2023 2023 HOH HOH A . F 3 HOH 24 2024 2024 HOH HOH A . F 3 HOH 25 2025 2025 HOH HOH A . F 3 HOH 26 2026 2026 HOH HOH A . F 3 HOH 27 2027 2027 HOH HOH A . F 3 HOH 28 2028 2028 HOH HOH A . F 3 HOH 29 2029 2029 HOH HOH A . F 3 HOH 30 2030 2030 HOH HOH A . F 3 HOH 31 2031 2031 HOH HOH A . F 3 HOH 32 2032 2032 HOH HOH A . F 3 HOH 33 2033 2033 HOH HOH A . F 3 HOH 34 2034 2034 HOH HOH A . F 3 HOH 35 2035 2035 HOH HOH A . F 3 HOH 36 2036 2036 HOH HOH A . F 3 HOH 37 2037 2037 HOH HOH A . F 3 HOH 38 2038 2038 HOH HOH A . F 3 HOH 39 2039 2039 HOH HOH A . F 3 HOH 40 2040 2040 HOH HOH A . F 3 HOH 41 2041 2041 HOH HOH A . F 3 HOH 42 2042 2042 HOH HOH A . F 3 HOH 43 2043 2043 HOH HOH A . F 3 HOH 44 2044 2044 HOH HOH A . F 3 HOH 45 2045 2045 HOH HOH A . F 3 HOH 46 2046 2046 HOH HOH A . F 3 HOH 47 2047 2047 HOH HOH A . F 3 HOH 48 2048 2048 HOH HOH A . F 3 HOH 49 2049 2049 HOH HOH A . F 3 HOH 50 2050 2050 HOH HOH A . F 3 HOH 51 2051 2051 HOH HOH A . F 3 HOH 52 2052 2052 HOH HOH A . F 3 HOH 53 2053 2053 HOH HOH A . F 3 HOH 54 2054 2054 HOH HOH A . F 3 HOH 55 2055 2055 HOH HOH A . F 3 HOH 56 2056 2056 HOH HOH A . F 3 HOH 57 2057 2057 HOH HOH A . F 3 HOH 58 2058 2058 HOH HOH A . F 3 HOH 59 2059 2059 HOH HOH A . F 3 HOH 60 2060 2060 HOH HOH A . F 3 HOH 61 2061 2061 HOH HOH A . F 3 HOH 62 2062 2062 HOH HOH A . F 3 HOH 63 2063 2063 HOH HOH A . F 3 HOH 64 2064 2064 HOH HOH A . F 3 HOH 65 2065 2065 HOH HOH A . F 3 HOH 66 2066 2066 HOH HOH A . F 3 HOH 67 2067 2067 HOH HOH A . F 3 HOH 68 2068 2068 HOH HOH A . F 3 HOH 69 2069 2069 HOH HOH A . F 3 HOH 70 2070 2070 HOH HOH A . F 3 HOH 71 2071 2071 HOH HOH A . F 3 HOH 72 2072 2072 HOH HOH A . F 3 HOH 73 2073 2073 HOH HOH A . F 3 HOH 74 2074 2074 HOH HOH A . F 3 HOH 75 2075 2075 HOH HOH A . F 3 HOH 76 2076 2076 HOH HOH A . F 3 HOH 77 2077 2077 HOH HOH A . F 3 HOH 78 2078 2078 HOH HOH A . F 3 HOH 79 2079 2079 HOH HOH A . F 3 HOH 80 2080 2080 HOH HOH A . F 3 HOH 81 2081 2081 HOH HOH A . F 3 HOH 82 2082 2082 HOH HOH A . F 3 HOH 83 2083 2083 HOH HOH A . F 3 HOH 84 2084 2084 HOH HOH A . F 3 HOH 85 2085 2085 HOH HOH A . F 3 HOH 86 2086 2086 HOH HOH A . F 3 HOH 87 2087 2087 HOH HOH A . F 3 HOH 88 2088 2088 HOH HOH A . F 3 HOH 89 2089 2089 HOH HOH A . F 3 HOH 90 2090 2090 HOH HOH A . F 3 HOH 91 2091 2091 HOH HOH A . F 3 HOH 92 2092 2092 HOH HOH A . F 3 HOH 93 2093 2093 HOH HOH A . F 3 HOH 94 2094 2094 HOH HOH A . F 3 HOH 95 2095 2095 HOH HOH A . F 3 HOH 96 2096 2096 HOH HOH A . F 3 HOH 97 2097 2097 HOH HOH A . F 3 HOH 98 2098 2098 HOH HOH A . F 3 HOH 99 2099 2099 HOH HOH A . F 3 HOH 100 2100 2100 HOH HOH A . F 3 HOH 101 2101 2101 HOH HOH A . F 3 HOH 102 2102 2102 HOH HOH A . F 3 HOH 103 2103 2103 HOH HOH A . F 3 HOH 104 2104 2104 HOH HOH A . F 3 HOH 105 2105 2105 HOH HOH A . F 3 HOH 106 2106 2106 HOH HOH A . F 3 HOH 107 2107 2107 HOH HOH A . F 3 HOH 108 2108 2108 HOH HOH A . F 3 HOH 109 2109 2109 HOH HOH A . F 3 HOH 110 2110 2110 HOH HOH A . F 3 HOH 111 2111 2111 HOH HOH A . F 3 HOH 112 2112 2112 HOH HOH A . F 3 HOH 113 2113 2113 HOH HOH A . F 3 HOH 114 2114 2114 HOH HOH A . F 3 HOH 115 2115 2115 HOH HOH A . F 3 HOH 116 2116 2116 HOH HOH A . F 3 HOH 117 2117 2117 HOH HOH A . F 3 HOH 118 2118 2118 HOH HOH A . F 3 HOH 119 2119 2119 HOH HOH A . F 3 HOH 120 2120 2120 HOH HOH A . F 3 HOH 121 2121 2121 HOH HOH A . F 3 HOH 122 2122 2122 HOH HOH A . F 3 HOH 123 2123 2123 HOH HOH A . F 3 HOH 124 2124 2124 HOH HOH A . F 3 HOH 125 2125 2125 HOH HOH A . F 3 HOH 126 2126 2126 HOH HOH A . F 3 HOH 127 2127 2127 HOH HOH A . F 3 HOH 128 2128 2128 HOH HOH A . F 3 HOH 129 2129 2129 HOH HOH A . F 3 HOH 130 2130 2130 HOH HOH A . F 3 HOH 131 2131 2131 HOH HOH A . F 3 HOH 132 2132 2132 HOH HOH A . F 3 HOH 133 2133 2133 HOH HOH A . F 3 HOH 134 2134 2134 HOH HOH A . F 3 HOH 135 2135 2135 HOH HOH A . F 3 HOH 136 2136 2136 HOH HOH A . F 3 HOH 137 2137 2137 HOH HOH A . F 3 HOH 138 2138 2138 HOH HOH A . F 3 HOH 139 2139 2139 HOH HOH A . F 3 HOH 140 2140 2140 HOH HOH A . F 3 HOH 141 2141 2141 HOH HOH A . F 3 HOH 142 2142 2142 HOH HOH A . F 3 HOH 143 2143 2143 HOH HOH A . F 3 HOH 144 2144 2144 HOH HOH A . F 3 HOH 145 2145 2145 HOH HOH A . F 3 HOH 146 2146 2146 HOH HOH A . F 3 HOH 147 2147 2147 HOH HOH A . F 3 HOH 148 2148 2148 HOH HOH A . F 3 HOH 149 2149 2149 HOH HOH A . F 3 HOH 150 2150 2150 HOH HOH A . F 3 HOH 151 2151 2151 HOH HOH A . F 3 HOH 152 2152 2152 HOH HOH A . F 3 HOH 153 2153 2153 HOH HOH A . F 3 HOH 154 2154 2154 HOH HOH A . F 3 HOH 155 2155 2155 HOH HOH A . F 3 HOH 156 2156 2156 HOH HOH A . F 3 HOH 157 2157 2157 HOH HOH A . F 3 HOH 158 2158 2158 HOH HOH A . F 3 HOH 159 2159 2159 HOH HOH A . F 3 HOH 160 2160 2160 HOH HOH A . F 3 HOH 161 2161 2161 HOH HOH A . F 3 HOH 162 2162 2162 HOH HOH A . F 3 HOH 163 2163 2163 HOH HOH A . F 3 HOH 164 2164 2164 HOH HOH A . F 3 HOH 165 2165 2165 HOH HOH A . F 3 HOH 166 2166 2166 HOH HOH A . F 3 HOH 167 2167 2167 HOH HOH A . F 3 HOH 168 2168 2168 HOH HOH A . F 3 HOH 169 2169 2169 HOH HOH A . F 3 HOH 170 2170 2170 HOH HOH A . F 3 HOH 171 2171 2171 HOH HOH A . F 3 HOH 172 2172 2172 HOH HOH A . F 3 HOH 173 2173 2173 HOH HOH A . F 3 HOH 174 2174 2174 HOH HOH A . F 3 HOH 175 2175 2175 HOH HOH A . F 3 HOH 176 2176 2176 HOH HOH A . F 3 HOH 177 2177 2177 HOH HOH A . F 3 HOH 178 2178 2178 HOH HOH A . F 3 HOH 179 2179 2179 HOH HOH A . F 3 HOH 180 2180 2180 HOH HOH A . F 3 HOH 181 2181 2181 HOH HOH A . F 3 HOH 182 2182 2182 HOH HOH A . F 3 HOH 183 2183 2183 HOH HOH A . F 3 HOH 184 2184 2184 HOH HOH A . F 3 HOH 185 2185 2185 HOH HOH A . F 3 HOH 186 2186 2186 HOH HOH A . F 3 HOH 187 2187 2187 HOH HOH A . F 3 HOH 188 2188 2188 HOH HOH A . F 3 HOH 189 2189 2189 HOH HOH A . F 3 HOH 190 2190 2190 HOH HOH A . F 3 HOH 191 2191 2191 HOH HOH A . F 3 HOH 192 2192 2192 HOH HOH A . F 3 HOH 193 2193 2193 HOH HOH A . F 3 HOH 194 2194 2194 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-03-10 2 'Structure model' 1 1 2013-03-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Non-polymer description' 5 2 'Structure model' Other 6 2 'Structure model' 'Structure summary' 7 2 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DENZO 'data reduction' . ? 1 SCALEPACK 'data scaling' . ? 2 SHARP phasing . ? 3 DM phasing . ? 4 REFMAC refinement 5.2.0005 ? 5 # _pdbx_database_remark.id 700 _pdbx_database_remark.text ; SHEET THE SHEET STRUCTURE OF THIS MOLECULE IS BIFURCATED. IN ORDER TO REPRESENT THIS FEATURE IN THE SHEET RECORDS BELOW, TWO SHEETS ARE DEFINED. ; # _pdbx_entry_details.entry_id 2BM3 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;GENE SEQUENCE CORRESPONDING TO RESIDUES 29-191 WAS CLONED. THE FIRST 3 RESIDUES ARE ADDITIONAL TO GENE SEQUENCE FROM THE CLONING INTO EXPRESSION VECTOR. ; # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 5 ? CG ? A LYS 5 CG 2 1 Y 1 A LYS 5 ? CD ? A LYS 5 CD 3 1 Y 1 A LYS 5 ? CE ? A LYS 5 CE 4 1 Y 1 A LYS 5 ? NZ ? A LYS 5 NZ 5 1 Y 1 A LYS 17 ? CD ? A LYS 17 CD 6 1 Y 1 A LYS 17 ? CE ? A LYS 17 CE 7 1 Y 1 A LYS 17 ? NZ ? A LYS 17 NZ 8 1 Y 1 A LYS 34 ? CE ? A LYS 34 CE 9 1 Y 1 A LYS 34 ? NZ ? A LYS 34 NZ 10 1 Y 1 A LYS 48 ? CE ? A LYS 48 CE 11 1 Y 1 A LYS 48 ? NZ ? A LYS 48 NZ 12 1 Y 1 A LYS 59 ? CG ? A LYS 59 CG 13 1 Y 1 A LYS 59 ? CD ? A LYS 59 CD 14 1 Y 1 A LYS 59 ? CE ? A LYS 59 CE 15 1 Y 1 A LYS 59 ? NZ ? A LYS 59 NZ 16 1 Y 1 A LYS 127 ? CE ? A LYS 127 CE 17 1 Y 1 A LYS 127 ? NZ ? A LYS 127 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A ASP 4 ? A ASP 4 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ISOPROPYL ALCOHOL' IPA 3 water HOH #