data_2BRD # _entry.id 2BRD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2BRD WWPDB D_1000177875 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2BRD _pdbx_database_status.recvd_initial_deposition_date 1995-12-27 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site ? _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Henderson, R.' 1 'Grigorieff, N.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Electron-crystallographic refinement of the structure of bacteriorhodopsin.' J.Mol.Biol. 259 393 421 1996 JMOBAK UK 0022-2836 0070 ? 8676377 10.1006/jmbi.1996.0328 1 'Analysis of High-Resolution Electron Diffraction Patterns from Purple Membrane Labelled with Heavy-Atoms' J.Mol.Biol. 213 539 ? 1990 JMOBAK UK 0022-2836 0070 ? ? ? 2 'Model for the Structure of Bacteriorhodopsin Based on High-Resolution Electron Cryo-Microscopy' J.Mol.Biol. 213 899 ? 1990 JMOBAK UK 0022-2836 0070 ? ? ? 3 'Three-Dimensional Model of Purple Membrane Obtained by Electron Microscopy' Nature 257 28 ? 1975 NATUAS UK 0028-0836 0006 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Grigorieff, N.' 1 primary 'Ceska, T.A.' 2 primary 'Downing, K.H.' 3 primary 'Baldwin, J.M.' 4 primary 'Henderson, R.' 5 1 'Ceska, T.A.' 6 1 'Henderson, R.' 7 2 'Henderson, R.' 8 2 'Baldwin, J.M.' 9 2 'Ceska, T.A.' 10 2 'Zemlin, F.' 11 2 'Beckmann, E.' 12 2 'Downing, K.H.' 13 3 'Henderson, R.' 14 3 'Unwin, P.N.' 15 # _cell.entry_id 2BRD _cell.length_a 62.450 _cell.length_b 62.450 _cell.length_c 100.900 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 3 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2BRD _symmetry.space_group_name_H-M 'P 3' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 143 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man BACTERIORHODOPSIN 26797.381 1 ? ? ? ? 2 non-polymer syn 'PHOSPHORIC ACID 2,3-BIS-(3,7,11,15-TETRAMETHYL-HEXADECYLOXY)-PROPYL ESTER 2-HYDROXO-3-PHOSPHONOOXY-PROPYL ESTER' 887.195 10 ? ? ? ? 3 non-polymer syn RETINAL 284.436 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(PCA)AQITGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTLVPAIAFTMYLSMLLGYGLTMVPFGGEQN PIYWARYADWLFTTPLLLLDLALLVDADQGTILALVGADGIMIGTGLVGALTKVYSYRFVWWAISTAAMLYILYVLFFGF TSKAESMRPEVASTFKVLRNVTVVLWSAYPVVWLIGSEGAGIVPLNIETLLFMVLDVSAKVGFGLILLRSRAIFGEAEAP EPSAGDGAAATS ; _entity_poly.pdbx_seq_one_letter_code_can ;EAQITGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTLVPAIAFTMYLSMLLGYGLTMVPFGGEQNPIYW ARYADWLFTTPLLLLDLALLVDADQGTILALVGADGIMIGTGLVGALTKVYSYRFVWWAISTAAMLYILYVLFFGFTSKA ESMRPEVASTFKVLRNVTVVLWSAYPVVWLIGSEGAGIVPLNIETLLFMVLDVSAKVGFGLILLRSRAIFGEAEAPEPSA GDGAAATS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PCA n 1 2 ALA n 1 3 GLN n 1 4 ILE n 1 5 THR n 1 6 GLY n 1 7 ARG n 1 8 PRO n 1 9 GLU n 1 10 TRP n 1 11 ILE n 1 12 TRP n 1 13 LEU n 1 14 ALA n 1 15 LEU n 1 16 GLY n 1 17 THR n 1 18 ALA n 1 19 LEU n 1 20 MET n 1 21 GLY n 1 22 LEU n 1 23 GLY n 1 24 THR n 1 25 LEU n 1 26 TYR n 1 27 PHE n 1 28 LEU n 1 29 VAL n 1 30 LYS n 1 31 GLY n 1 32 MET n 1 33 GLY n 1 34 VAL n 1 35 SER n 1 36 ASP n 1 37 PRO n 1 38 ASP n 1 39 ALA n 1 40 LYS n 1 41 LYS n 1 42 PHE n 1 43 TYR n 1 44 ALA n 1 45 ILE n 1 46 THR n 1 47 THR n 1 48 LEU n 1 49 VAL n 1 50 PRO n 1 51 ALA n 1 52 ILE n 1 53 ALA n 1 54 PHE n 1 55 THR n 1 56 MET n 1 57 TYR n 1 58 LEU n 1 59 SER n 1 60 MET n 1 61 LEU n 1 62 LEU n 1 63 GLY n 1 64 TYR n 1 65 GLY n 1 66 LEU n 1 67 THR n 1 68 MET n 1 69 VAL n 1 70 PRO n 1 71 PHE n 1 72 GLY n 1 73 GLY n 1 74 GLU n 1 75 GLN n 1 76 ASN n 1 77 PRO n 1 78 ILE n 1 79 TYR n 1 80 TRP n 1 81 ALA n 1 82 ARG n 1 83 TYR n 1 84 ALA n 1 85 ASP n 1 86 TRP n 1 87 LEU n 1 88 PHE n 1 89 THR n 1 90 THR n 1 91 PRO n 1 92 LEU n 1 93 LEU n 1 94 LEU n 1 95 LEU n 1 96 ASP n 1 97 LEU n 1 98 ALA n 1 99 LEU n 1 100 LEU n 1 101 VAL n 1 102 ASP n 1 103 ALA n 1 104 ASP n 1 105 GLN n 1 106 GLY n 1 107 THR n 1 108 ILE n 1 109 LEU n 1 110 ALA n 1 111 LEU n 1 112 VAL n 1 113 GLY n 1 114 ALA n 1 115 ASP n 1 116 GLY n 1 117 ILE n 1 118 MET n 1 119 ILE n 1 120 GLY n 1 121 THR n 1 122 GLY n 1 123 LEU n 1 124 VAL n 1 125 GLY n 1 126 ALA n 1 127 LEU n 1 128 THR n 1 129 LYS n 1 130 VAL n 1 131 TYR n 1 132 SER n 1 133 TYR n 1 134 ARG n 1 135 PHE n 1 136 VAL n 1 137 TRP n 1 138 TRP n 1 139 ALA n 1 140 ILE n 1 141 SER n 1 142 THR n 1 143 ALA n 1 144 ALA n 1 145 MET n 1 146 LEU n 1 147 TYR n 1 148 ILE n 1 149 LEU n 1 150 TYR n 1 151 VAL n 1 152 LEU n 1 153 PHE n 1 154 PHE n 1 155 GLY n 1 156 PHE n 1 157 THR n 1 158 SER n 1 159 LYS n 1 160 ALA n 1 161 GLU n 1 162 SER n 1 163 MET n 1 164 ARG n 1 165 PRO n 1 166 GLU n 1 167 VAL n 1 168 ALA n 1 169 SER n 1 170 THR n 1 171 PHE n 1 172 LYS n 1 173 VAL n 1 174 LEU n 1 175 ARG n 1 176 ASN n 1 177 VAL n 1 178 THR n 1 179 VAL n 1 180 VAL n 1 181 LEU n 1 182 TRP n 1 183 SER n 1 184 ALA n 1 185 TYR n 1 186 PRO n 1 187 VAL n 1 188 VAL n 1 189 TRP n 1 190 LEU n 1 191 ILE n 1 192 GLY n 1 193 SER n 1 194 GLU n 1 195 GLY n 1 196 ALA n 1 197 GLY n 1 198 ILE n 1 199 VAL n 1 200 PRO n 1 201 LEU n 1 202 ASN n 1 203 ILE n 1 204 GLU n 1 205 THR n 1 206 LEU n 1 207 LEU n 1 208 PHE n 1 209 MET n 1 210 VAL n 1 211 LEU n 1 212 ASP n 1 213 VAL n 1 214 SER n 1 215 ALA n 1 216 LYS n 1 217 VAL n 1 218 GLY n 1 219 PHE n 1 220 GLY n 1 221 LEU n 1 222 ILE n 1 223 LEU n 1 224 LEU n 1 225 ARG n 1 226 SER n 1 227 ARG n 1 228 ALA n 1 229 ILE n 1 230 PHE n 1 231 GLY n 1 232 GLU n 1 233 ALA n 1 234 GLU n 1 235 ALA n 1 236 PRO n 1 237 GLU n 1 238 PRO n 1 239 SER n 1 240 ALA n 1 241 GLY n 1 242 ASP n 1 243 GLY n 1 244 ALA n 1 245 ALA n 1 246 ALA n 1 247 THR n 1 248 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Halobacterium _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain R1 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Halobacterium salinarum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2242 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BACR_HALN1 _struct_ref.pdbx_db_accession P02945 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 14 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2BRD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 248 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02945 _struct_ref_seq.db_align_beg 14 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 253 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 248 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 DPG non-polymer . 'PHOSPHORIC ACID 2,3-BIS-(3,7,11,15-TETRAMETHYL-HEXADECYLOXY)-PROPYL ESTER 2-HYDROXO-3-PHOSPHONOOXY-PROPYL ESTER' DPHPG 'C46 H96 O11 P2' 887.195 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PCA 'L-peptide linking' n 'PYROGLUTAMIC ACID' ? 'C5 H7 N O3' 129.114 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 RET non-polymer . RETINAL ? 'C20 H28 O' 284.436 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2BRD _exptl.method 'ELECTRON CRYSTALLOGRAPHY' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 4.24 _exptl_crystal.density_percent_sol 70.97 _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector FILM _diffrn_detector.type ? _diffrn_detector.pdbx_collection_date 1986-01-01 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.033 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source ? _diffrn_source.type ? _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 0.033 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 2BRD _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 54.0 _reflns.d_resolution_high 2.8 _reflns.number_obs 6750 _reflns.number_all ? _reflns.percent_possible_obs 62.3 _reflns.pdbx_Rmerge_I_obs 0.1500000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 18. _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _refine.entry_id 2BRD _refine.ls_number_reflns_obs 4743 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 30. _refine.ls_d_res_high 3.5 _refine.ls_percent_reflns_obs 85.4 _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2800000 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 114. _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'ELECTRON CRYSTALLOGRAPHY' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'ELECTRON CRYSTALLOGRAPHY' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1718 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 610 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2328 _refine_hist.d_res_high 3.5 _refine_hist.d_res_low 30. # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function p_bond_d 0.005 0.020 ? ? 'ELECTRON CRYSTALLOGRAPHY' ? p_angle_d 0.020 0.040 ? ? 'ELECTRON CRYSTALLOGRAPHY' ? p_angle_deg ? ? ? ? 'ELECTRON CRYSTALLOGRAPHY' ? p_planar_d 0.022 0.050 ? ? 'ELECTRON CRYSTALLOGRAPHY' ? p_hb_or_metal_coord ? ? ? ? 'ELECTRON CRYSTALLOGRAPHY' ? p_mcbond_it ? ? ? ? 'ELECTRON CRYSTALLOGRAPHY' ? p_mcangle_it ? ? ? ? 'ELECTRON CRYSTALLOGRAPHY' ? p_scbond_it ? ? ? ? 'ELECTRON CRYSTALLOGRAPHY' ? p_scangle_it ? ? ? ? 'ELECTRON CRYSTALLOGRAPHY' ? p_plane_restr 0.005 0.020 ? ? 'ELECTRON CRYSTALLOGRAPHY' ? p_chiral_restr 0.086 0.150 ? ? 'ELECTRON CRYSTALLOGRAPHY' ? p_singtor_nbd 0.185 0.300 ? ? 'ELECTRON CRYSTALLOGRAPHY' ? p_multtor_nbd 0.242 0.300 ? ? 'ELECTRON CRYSTALLOGRAPHY' ? p_xhyhbond_nbd ? ? ? ? 'ELECTRON CRYSTALLOGRAPHY' ? p_xyhbond_nbd 0.127 0.300 ? ? 'ELECTRON CRYSTALLOGRAPHY' ? p_planar_tor 0.865 ? ? ? 'ELECTRON CRYSTALLOGRAPHY' ? p_staggered_tor 20.4 15.0 ? ? 'ELECTRON CRYSTALLOGRAPHY' ? p_orthonormal_tor ? ? ? ? 'ELECTRON CRYSTALLOGRAPHY' ? p_transverse_tor 36.1 20.0 ? ? 'ELECTRON CRYSTALLOGRAPHY' ? p_special_tor ? ? ? ? 'ELECTRON CRYSTALLOGRAPHY' ? # _struct.entry_id 2BRD _struct.title 'CRYSTAL STRUCTURE OF BACTERIORHODOPSIN IN PURPLE MEMBRANE' _struct.pdbx_descriptor ;BACTERIORHODOPSIN, PHOSPHORIC ACID 2,3-BIS-(3,7,11,15-TETRAMETHYL-HEXADECYLOXY)-PROPYL ESTER 2-HYDROXO-3-PHOSPHONOOXY-PROPYL ESTER, RETINAL ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2BRD _struct_keywords.pdbx_keywords PHOTORECEPTOR _struct_keywords.text 'PROTON PUMP, MEMBRANE PROTEIN, RETINAL PROTEIN, TWO-DIMENSIONAL CRYSTAL, PHOTORECEPTOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? I N N 2 ? J N N 2 ? K N N 2 ? L N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 A GLU A 9 ? GLY A 31 ? GLU A 9 GLY A 31 1 ? 23 HELX_P HELX_P2 B ASP A 38 ? LEU A 62 ? ASP A 38 LEU A 62 1 ? 25 HELX_P HELX_P3 C PRO A 77 ? LEU A 100 ? PRO A 77 LEU A 100 1 ? 24 HELX_P HELX_P4 D GLN A 105 ? LEU A 127 ? GLN A 105 LEU A 127 1 ? 23 HELX_P HELX_P5 E ARG A 134 ? THR A 157 ? ARG A 134 THR A 157 1 ? 24 HELX_P HELX_P6 F GLU A 166 ? ILE A 191 ? GLU A 166 ILE A 191 1 ? 26 HELX_P HELX_P7 G ILE A 203 ? SER A 226 ? ILE A 203 SER A 226 1 ? 24 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id L _struct_conn.ptnr1_label_comp_id RET _struct_conn.ptnr1_label_seq_id . _struct_conn.ptnr1_label_atom_id C15 _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id LYS _struct_conn.ptnr2_label_seq_id 216 _struct_conn.ptnr2_label_atom_id NZ _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id RET _struct_conn.ptnr1_auth_seq_id 271 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id LYS _struct_conn.ptnr2_auth_seq_id 216 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.312 _struct_conn.pdbx_value_order ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE DPG A 261' AC2 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE DPG A 262' AC3 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE DPG A 263' AC4 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE DPG A 264' AC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE DPG A 265' AC6 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE DPG A 266' AC7 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE DPG A 267' AC8 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE DPG A 268' AC9 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE DPG A 269' BC1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE DPG A 270' BC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE RET A 271' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 13 TYR A 64 ? TYR A 64 . ? 2_555 ? 2 AC1 13 LEU A 66 ? LEU A 66 . ? 2_555 ? 3 AC1 13 LEU A 66 ? LEU A 66 . ? 1_555 ? 4 AC1 13 MET A 68 ? MET A 68 . ? 1_555 ? 5 AC1 13 PRO A 70 ? PRO A 70 . ? 1_555 ? 6 AC1 13 TRP A 80 ? TRP A 80 . ? 1_555 ? 7 AC1 13 LEU A 87 ? LEU A 87 . ? 1_555 ? 8 AC1 13 PHE A 88 ? PHE A 88 . ? 2_555 ? 9 AC1 13 PHE A 88 ? PHE A 88 . ? 1_555 ? 10 AC1 13 VAL A 124 ? VAL A 124 . ? 1_555 ? 11 AC1 13 LYS A 129 ? LYS A 129 . ? 1_555 ? 12 AC1 13 DPG G . ? DPG A 266 . ? 2_555 ? 13 AC1 13 DPG G . ? DPG A 266 . ? 1_555 ? 14 AC2 12 SER A 183 ? SER A 183 . ? 2_655 ? 15 AC2 12 VAL A 187 ? VAL A 187 . ? 1_555 ? 16 AC2 12 ILE A 191 ? ILE A 191 . ? 1_555 ? 17 AC2 12 ILE A 191 ? ILE A 191 . ? 2_655 ? 18 AC2 12 ALA A 196 ? ALA A 196 . ? 2_655 ? 19 AC2 12 ILE A 198 ? ILE A 198 . ? 1_555 ? 20 AC2 12 ILE A 198 ? ILE A 198 . ? 2_655 ? 21 AC2 12 LEU A 207 ? LEU A 207 . ? 1_555 ? 22 AC2 12 DPG D . ? DPG A 263 . ? 1_555 ? 23 AC2 12 DPG H . ? DPG A 267 . ? 3_665 ? 24 AC2 12 DPG H . ? DPG A 267 . ? 1_555 ? 25 AC2 12 DPG I . ? DPG A 268 . ? 1_555 ? 26 AC3 11 TRP A 12 ? TRP A 12 . ? 1_555 ? 27 AC3 11 PHE A 135 ? PHE A 135 . ? 2_655 ? 28 AC3 11 TRP A 138 ? TRP A 138 . ? 2_655 ? 29 AC3 11 ALA A 196 ? ALA A 196 . ? 2_655 ? 30 AC3 11 ILE A 203 ? ILE A 203 . ? 1_555 ? 31 AC3 11 LEU A 206 ? LEU A 206 . ? 1_555 ? 32 AC3 11 VAL A 210 ? VAL A 210 . ? 1_555 ? 33 AC3 11 DPG C . ? DPG A 262 . ? 1_555 ? 34 AC3 11 DPG E . ? DPG A 264 . ? 1_555 ? 35 AC3 11 DPG F . ? DPG A 265 . ? 1_555 ? 36 AC3 11 DPG I . ? DPG A 268 . ? 1_555 ? 37 AC4 8 ALA A 18 ? ALA A 18 . ? 3_655 ? 38 AC4 8 PHE A 54 ? PHE A 54 . ? 3_655 ? 39 AC4 8 LEU A 58 ? LEU A 58 . ? 3_655 ? 40 AC4 8 LEU A 61 ? LEU A 61 . ? 3_655 ? 41 AC4 8 VAL A 136 ? VAL A 136 . ? 2_655 ? 42 AC4 8 DPG D . ? DPG A 263 . ? 1_555 ? 43 AC4 8 DPG F . ? DPG A 265 . ? 1_555 ? 44 AC4 8 DPG K . ? DPG A 270 . ? 3_655 ? 45 AC5 5 ILE A 11 ? ILE A 11 . ? 1_555 ? 46 AC5 5 LEU A 15 ? LEU A 15 . ? 1_555 ? 47 AC5 5 ALA A 18 ? ALA A 18 . ? 1_555 ? 48 AC5 5 DPG D . ? DPG A 263 . ? 1_555 ? 49 AC5 5 DPG E . ? DPG A 264 . ? 1_555 ? 50 AC6 15 ILE A 52 ? ILE A 52 . ? 2_555 ? 51 AC6 15 PHE A 88 ? PHE A 88 . ? 1_555 ? 52 AC6 15 PHE A 88 ? PHE A 88 . ? 2_555 ? 53 AC6 15 LEU A 92 ? LEU A 92 . ? 2_555 ? 54 AC6 15 LEU A 95 ? LEU A 95 . ? 1_555 ? 55 AC6 15 LEU A 99 ? LEU A 99 . ? 2_555 ? 56 AC6 15 ALA A 103 ? ALA A 103 . ? 2_555 ? 57 AC6 15 GLN A 105 ? GLN A 105 . ? 1_555 ? 58 AC6 15 GLN A 105 ? GLN A 105 . ? 3_555 ? 59 AC6 15 ILE A 108 ? ILE A 108 . ? 1_555 ? 60 AC6 15 LEU A 109 ? LEU A 109 . ? 3_555 ? 61 AC6 15 GLY A 116 ? GLY A 116 . ? 1_555 ? 62 AC6 15 ILE A 117 ? ILE A 117 . ? 1_555 ? 63 AC6 15 DPG B . ? DPG A 261 . ? 3_555 ? 64 AC6 15 DPG B . ? DPG A 261 . ? 1_555 ? 65 AC7 10 PHE A 156 ? PHE A 156 . ? 1_555 ? 66 AC7 10 LYS A 172 ? LYS A 172 . ? 1_555 ? 67 AC7 10 ARG A 175 ? ARG A 175 . ? 1_555 ? 68 AC7 10 ASN A 176 ? ASN A 176 . ? 1_555 ? 69 AC7 10 VAL A 180 ? VAL A 180 . ? 1_555 ? 70 AC7 10 ALA A 184 ? ALA A 184 . ? 1_555 ? 71 AC7 10 VAL A 187 ? VAL A 187 . ? 1_555 ? 72 AC7 10 DPG C . ? DPG A 262 . ? 1_555 ? 73 AC7 10 DPG C . ? DPG A 262 . ? 2_655 ? 74 AC7 10 DPG I . ? DPG A 268 . ? 1_555 ? 75 AC8 18 TRP A 138 ? TRP A 138 . ? 2_655 ? 76 AC8 18 THR A 142 ? THR A 142 . ? 2_655 ? 77 AC8 18 MET A 145 ? MET A 145 . ? 2_655 ? 78 AC8 18 LEU A 149 ? LEU A 149 . ? 2_655 ? 79 AC8 18 TYR A 150 ? TYR A 150 . ? 2_655 ? 80 AC8 18 PHE A 153 ? PHE A 153 . ? 2_655 ? 81 AC8 18 THR A 157 ? THR A 157 . ? 2_655 ? 82 AC8 18 SER A 169 ? SER A 169 . ? 1_555 ? 83 AC8 18 LYS A 172 ? LYS A 172 . ? 1_555 ? 84 AC8 18 VAL A 173 ? VAL A 173 . ? 1_555 ? 85 AC8 18 VAL A 179 ? VAL A 179 . ? 2_655 ? 86 AC8 18 PRO A 186 ? PRO A 186 . ? 2_655 ? 87 AC8 18 VAL A 210 ? VAL A 210 . ? 1_555 ? 88 AC8 18 SER A 214 ? SER A 214 . ? 1_555 ? 89 AC8 18 ARG A 225 ? ARG A 225 . ? 1_555 ? 90 AC8 18 DPG C . ? DPG A 262 . ? 1_555 ? 91 AC8 18 DPG D . ? DPG A 263 . ? 1_555 ? 92 AC8 18 DPG H . ? DPG A 267 . ? 1_555 ? 93 AC9 10 LEU A 28 ? LEU A 28 . ? 1_555 ? 94 AC9 10 MET A 32 ? MET A 32 . ? 1_555 ? 95 AC9 10 GLY A 33 ? GLY A 33 . ? 1_555 ? 96 AC9 10 LYS A 40 ? LYS A 40 . ? 1_555 ? 97 AC9 10 THR A 47 ? THR A 47 . ? 1_555 ? 98 AC9 10 ALA A 51 ? ALA A 51 . ? 1_555 ? 99 AC9 10 TYR A 147 ? TYR A 147 . ? 3_555 ? 100 AC9 10 PHE A 154 ? PHE A 154 . ? 3_555 ? 101 AC9 10 LEU A 221 ? LEU A 221 . ? 2_545 ? 102 AC9 10 DPG K . ? DPG A 270 . ? 3_655 ? 103 BC1 10 LEU A 22 ? LEU A 22 . ? 1_555 ? 104 BC1 10 TYR A 26 ? TYR A 26 . ? 2_545 ? 105 BC1 10 VAL A 29 ? VAL A 29 . ? 1_555 ? 106 BC1 10 VAL A 29 ? VAL A 29 . ? 2_545 ? 107 BC1 10 LYS A 30 ? LYS A 30 . ? 2_545 ? 108 BC1 10 GLY A 33 ? GLY A 33 . ? 2_545 ? 109 BC1 10 LEU A 224 ? LEU A 224 . ? 2_545 ? 110 BC1 10 ARG A 227 ? ARG A 227 . ? 2_545 ? 111 BC1 10 DPG E . ? DPG A 264 . ? 2_545 ? 112 BC1 10 DPG J . ? DPG A 269 . ? 2_545 ? 113 BC2 11 TRP A 86 ? TRP A 86 . ? 1_555 ? 114 BC2 11 THR A 89 ? THR A 89 . ? 1_555 ? 115 BC2 11 THR A 90 ? THR A 90 . ? 1_555 ? 116 BC2 11 MET A 118 ? MET A 118 . ? 1_555 ? 117 BC2 11 TRP A 138 ? TRP A 138 . ? 1_555 ? 118 BC2 11 SER A 141 ? SER A 141 . ? 1_555 ? 119 BC2 11 TRP A 182 ? TRP A 182 . ? 1_555 ? 120 BC2 11 TYR A 185 ? TYR A 185 . ? 1_555 ? 121 BC2 11 TRP A 189 ? TRP A 189 . ? 1_555 ? 122 BC2 11 ASP A 212 ? ASP A 212 . ? 1_555 ? 123 BC2 11 LYS A 216 ? LYS A 216 . ? 1_555 ? # _database_PDB_matrix.entry_id 2BRD _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2BRD _atom_sites.fract_transf_matrix[1][1] 0.016013 _atom_sites.fract_transf_matrix[1][2] 0.009245 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018490 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009911 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PCA 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 GLN 3 3 ? ? ? A . n A 1 4 ILE 4 4 ? ? ? A . n A 1 5 THR 5 5 ? ? ? A . n A 1 6 GLY 6 6 ? ? ? A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 TRP 10 10 10 TRP TRP A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 TRP 12 12 12 TRP TRP A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 MET 20 20 20 MET MET A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 MET 32 32 32 MET MET A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 MET 68 68 68 MET MET A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 TRP 80 80 80 TRP TRP A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 TRP 86 86 86 TRP TRP A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 ILE 117 117 117 ILE ILE A . n A 1 118 MET 118 118 118 MET MET A . n A 1 119 ILE 119 119 119 ILE ILE A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 THR 128 128 128 THR THR A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 TYR 131 131 131 TYR TYR A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 TYR 133 133 133 TYR TYR A . n A 1 134 ARG 134 134 134 ARG ARG A . n A 1 135 PHE 135 135 135 PHE PHE A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 TRP 137 137 137 TRP TRP A . n A 1 138 TRP 138 138 138 TRP TRP A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 THR 142 142 142 THR THR A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 MET 145 145 145 MET MET A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 TYR 147 147 147 TYR TYR A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 TYR 150 150 150 TYR TYR A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 PHE 153 153 153 PHE PHE A . n A 1 154 PHE 154 154 154 PHE PHE A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 PHE 156 156 156 PHE PHE A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 LYS 159 159 159 LYS LYS A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 SER 162 162 162 SER SER A . n A 1 163 MET 163 163 163 MET MET A . n A 1 164 ARG 164 164 164 ARG ARG A . n A 1 165 PRO 165 165 165 PRO PRO A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 VAL 167 167 167 VAL VAL A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 THR 170 170 170 THR THR A . n A 1 171 PHE 171 171 171 PHE PHE A . n A 1 172 LYS 172 172 172 LYS LYS A . n A 1 173 VAL 173 173 173 VAL VAL A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 ARG 175 175 175 ARG ARG A . n A 1 176 ASN 176 176 176 ASN ASN A . n A 1 177 VAL 177 177 177 VAL VAL A . n A 1 178 THR 178 178 178 THR THR A . n A 1 179 VAL 179 179 179 VAL VAL A . n A 1 180 VAL 180 180 180 VAL VAL A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 TRP 182 182 182 TRP TRP A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 ALA 184 184 184 ALA ALA A . n A 1 185 TYR 185 185 185 TYR TYR A . n A 1 186 PRO 186 186 186 PRO PRO A . n A 1 187 VAL 187 187 187 VAL VAL A . n A 1 188 VAL 188 188 188 VAL VAL A . n A 1 189 TRP 189 189 189 TRP TRP A . n A 1 190 LEU 190 190 190 LEU LEU A . n A 1 191 ILE 191 191 191 ILE ILE A . n A 1 192 GLY 192 192 192 GLY GLY A . n A 1 193 SER 193 193 193 SER SER A . n A 1 194 GLU 194 194 194 GLU GLU A . n A 1 195 GLY 195 195 195 GLY GLY A . n A 1 196 ALA 196 196 196 ALA ALA A . n A 1 197 GLY 197 197 197 GLY GLY A . n A 1 198 ILE 198 198 198 ILE ILE A . n A 1 199 VAL 199 199 199 VAL VAL A . n A 1 200 PRO 200 200 200 PRO PRO A . n A 1 201 LEU 201 201 201 LEU LEU A . n A 1 202 ASN 202 202 202 ASN ASN A . n A 1 203 ILE 203 203 203 ILE ILE A . n A 1 204 GLU 204 204 204 GLU GLU A . n A 1 205 THR 205 205 205 THR THR A . n A 1 206 LEU 206 206 206 LEU LEU A . n A 1 207 LEU 207 207 207 LEU LEU A . n A 1 208 PHE 208 208 208 PHE PHE A . n A 1 209 MET 209 209 209 MET MET A . n A 1 210 VAL 210 210 210 VAL VAL A . n A 1 211 LEU 211 211 211 LEU LEU A . n A 1 212 ASP 212 212 212 ASP ASP A . n A 1 213 VAL 213 213 213 VAL VAL A . n A 1 214 SER 214 214 214 SER SER A . n A 1 215 ALA 215 215 215 ALA ALA A . n A 1 216 LYS 216 216 216 LYS LYS A . n A 1 217 VAL 217 217 217 VAL VAL A . n A 1 218 GLY 218 218 218 GLY GLY A . n A 1 219 PHE 219 219 219 PHE PHE A . n A 1 220 GLY 220 220 220 GLY GLY A . n A 1 221 LEU 221 221 221 LEU LEU A . n A 1 222 ILE 222 222 222 ILE ILE A . n A 1 223 LEU 223 223 223 LEU LEU A . n A 1 224 LEU 224 224 224 LEU LEU A . n A 1 225 ARG 225 225 225 ARG ARG A . n A 1 226 SER 226 226 226 SER SER A . n A 1 227 ARG 227 227 227 ARG ARG A . n A 1 228 ALA 228 228 228 ALA ALA A . n A 1 229 ILE 229 229 ? ? ? A . n A 1 230 PHE 230 230 ? ? ? A . n A 1 231 GLY 231 231 ? ? ? A . n A 1 232 GLU 232 232 ? ? ? A . n A 1 233 ALA 233 233 ? ? ? A . n A 1 234 GLU 234 234 ? ? ? A . n A 1 235 ALA 235 235 ? ? ? A . n A 1 236 PRO 236 236 ? ? ? A . n A 1 237 GLU 237 237 ? ? ? A . n A 1 238 PRO 238 238 ? ? ? A . n A 1 239 SER 239 239 ? ? ? A . n A 1 240 ALA 240 240 ? ? ? A . n A 1 241 GLY 241 241 ? ? ? A . n A 1 242 ASP 242 242 ? ? ? A . n A 1 243 GLY 243 243 ? ? ? A . n A 1 244 ALA 244 244 ? ? ? A . n A 1 245 ALA 245 245 ? ? ? A . n A 1 246 ALA 246 246 ? ? ? A . n A 1 247 THR 247 247 ? ? ? A . n A 1 248 SER 248 248 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 DPG 1 261 261 DPG DPG A . C 2 DPG 1 262 262 DPG DPG A . D 2 DPG 1 263 263 DPG DPG A . E 2 DPG 1 264 264 DPG DPG A . F 2 DPG 1 265 265 DPG DPG A . G 2 DPG 1 266 266 DPG DPG A . H 2 DPG 1 267 267 DPG DPG A . I 2 DPG 1 268 268 DPG DPG A . J 2 DPG 1 269 269 DPG DPG A . K 2 DPG 1 270 270 DPG DPG A . L 3 RET 1 271 216 RET RET A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 34840 ? 1 MORE -277 ? 1 'SSA (A^2)' 35800 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -y,x-y,z -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x+y,-x,z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1996-06-10 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2012-05-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Experimental preparation' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal PROLSQ refinement . ? 1 PICKYCOR 'data reduction' . ? 2 AN 'data reduction' 'MRC ELECTRON DIFFRACTION PROGRAM' ? 3 # _em_3d_reconstruction.entry_id 2BRD _em_3d_reconstruction.id 1 _em_3d_reconstruction.symmetry_type '2D CRYSTAL' _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.num_particles . _em_3d_reconstruction.algorithm ? _em_3d_reconstruction.details ? _em_3d_reconstruction.num_class_averages ? _em_3d_reconstruction.resolution ? _em_3d_reconstruction.resolution_method ? _em_3d_reconstruction.method ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.magnification_calibration ? # _em_buffer.id 1 _em_buffer.specimen_id 1 _em_buffer.pH . _em_buffer.details ? _em_buffer.name ? # _em_entity_assembly.id 1 _em_entity_assembly.name 'BACTERIORHODOPSIN CRYSTAL' _em_entity_assembly.type COMPLEX _em_entity_assembly.parent_id 0 _em_entity_assembly.synonym ? _em_entity_assembly.details ? _em_entity_assembly.entity_id_list ? _em_entity_assembly.source ? _em_entity_assembly.oligomeric_details ? # _em_image_scans.entry_id 2BRD _em_image_scans.image_recording_id 1 _em_image_scans.id 1 _em_image_scans.scanner_model . _em_image_scans.citation_id ? _em_image_scans.number_digital_images ? _em_image_scans.od_range ? _em_image_scans.quant_bit_size ? _em_image_scans.sampling_size ? _em_image_scans.details ? # loop_ _em_imaging.entry_id _em_imaging.id _em_imaging.specimen_id _em_imaging.accelerating_voltage _em_imaging.electron_source _em_imaging.illumination_mode _em_imaging.mode _em_imaging.microscope_model _em_imaging.calibrated_defocus_max _em_imaging.alignment_procedure _em_imaging.c2_aperture_diameter _em_imaging.calibrated_defocus_min _em_imaging.calibrated_magnification _em_imaging.cryogen _em_imaging.details _em_imaging.nominal_cs _em_imaging.nominal_defocus_max _em_imaging.nominal_defocus_min _em_imaging.nominal_magnification _em_imaging.residual_tilt _em_imaging.specimen_holder_model _em_imaging.recording_temperature_maximum _em_imaging.recording_temperature_minimum _em_imaging.citation_id _em_imaging.date _em_imaging.temperature _em_imaging.tilt_angle_min _em_imaging.tilt_angle_max _em_imaging.astigmatism _em_imaging.detector_distance _em_imaging.electron_beam_tilt_params _em_imaging.specimen_holder_type 2BRD 1 1 120 ? 'FLOOD BEAM' DIFFRACTION 'FEI/PHILIPS EM420' ? ? ? ? ? ? '60 degree tilted specimens' ? ? ? ? ? ? 153 ? ? ? ? ? ? ? ? ? ? 2BRD 2 1 100 ? 'FLOOD BEAM' 'BRIGHT FIELD' 'SIEMENS SULEIKA' ? ? ? ? ? HELIUM '0, 20, 45 degree + random degree tilts' ? ? ? 66000 ? ? 5 ? ? ? ? ? ? ? ? ? ? 2BRD 3 1 100 'FIELD EMISSION GUN' 'SPOT SCAN' 'BRIGHT FIELD' 'JEOL 100B' ? ? ? ? ? NITROGEN ', 20, 45 degree + random degree tilts' ? ? ? 55000 ? ? 158 ? ? ? ? ? ? ? ? ? ? # _em_sample_support.id 1 _em_sample_support.specimen_id 1 _em_sample_support.details ? _em_sample_support.grid_material ? _em_sample_support.grid_mesh_size ? _em_sample_support.grid_type ? _em_sample_support.method ? _em_sample_support.film_material ? # _em_experiment.reconstruction_method CRYSTALLOGRAPHY _em_experiment.entry_id 2BRD _em_experiment.id 1 _em_experiment.aggregation_state '2D ARRAY' _em_experiment.entity_assembly_id 1 # _em_single_particle_entity.entry_id 2BRD _em_single_particle_entity.id 1 _em_single_particle_entity.image_processing_id 1 _em_single_particle_entity.point_symmetry ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A TRP 80 ? ? CB A TRP 80 ? ? CG A TRP 80 ? ? 127.94 113.70 14.24 1.90 N 2 1 CA A TYR 133 ? ? CB A TYR 133 ? ? CG A TYR 133 ? ? 128.00 113.40 14.60 1.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 9 ? ? -26.45 -41.19 2 1 MET A 32 ? ? -10.24 -89.28 3 1 ASP A 36 ? ? -132.17 -62.59 4 1 PRO A 37 ? ? -90.23 -118.09 5 1 THR A 67 ? ? -116.15 73.11 6 1 PHE A 71 ? ? -171.60 92.89 7 1 GLN A 75 ? ? -53.88 176.05 8 1 THR A 89 ? ? -42.50 -72.87 9 1 VAL A 101 ? ? -104.11 -89.22 10 1 TYR A 133 ? ? -173.72 -0.23 11 1 ALA A 160 ? ? 42.32 -141.06 12 1 GLU A 161 ? ? -45.90 107.85 13 1 MET A 163 ? ? -99.74 -117.98 14 1 TYR A 185 ? ? -42.16 -71.49 15 1 SER A 193 ? ? 12.74 -101.25 16 1 PRO A 200 ? ? -48.56 -91.57 17 1 LEU A 201 ? ? -154.37 -56.54 18 1 ASP A 212 ? ? -44.01 -73.64 19 1 ARG A 227 ? ? -64.77 99.21 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ALA 228 ? CA ? A ALA 228 CA 2 1 Y 1 A ALA 228 ? C ? A ALA 228 C 3 1 Y 1 A ALA 228 ? O ? A ALA 228 O 4 1 Y 1 A ALA 228 ? CB ? A ALA 228 CB # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A PCA 1 ? A PCA 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A GLN 3 ? A GLN 3 4 1 Y 1 A ILE 4 ? A ILE 4 5 1 Y 1 A THR 5 ? A THR 5 6 1 Y 1 A GLY 6 ? A GLY 6 7 1 Y 1 A ILE 229 ? A ILE 229 8 1 Y 1 A PHE 230 ? A PHE 230 9 1 Y 1 A GLY 231 ? A GLY 231 10 1 Y 1 A GLU 232 ? A GLU 232 11 1 Y 1 A ALA 233 ? A ALA 233 12 1 Y 1 A GLU 234 ? A GLU 234 13 1 Y 1 A ALA 235 ? A ALA 235 14 1 Y 1 A PRO 236 ? A PRO 236 15 1 Y 1 A GLU 237 ? A GLU 237 16 1 Y 1 A PRO 238 ? A PRO 238 17 1 Y 1 A SER 239 ? A SER 239 18 1 Y 1 A ALA 240 ? A ALA 240 19 1 Y 1 A GLY 241 ? A GLY 241 20 1 Y 1 A ASP 242 ? A ASP 242 21 1 Y 1 A GLY 243 ? A GLY 243 22 1 Y 1 A ALA 244 ? A ALA 244 23 1 Y 1 A ALA 245 ? A ALA 245 24 1 Y 1 A ALA 246 ? A ALA 246 25 1 Y 1 A THR 247 ? A THR 247 26 1 Y 1 A SER 248 ? A SER 248 # _em_image_processing.id 1 _em_image_processing.image_recording_id 1 _em_image_processing.details ? # loop_ _em_image_recording.id _em_image_recording.imaging_id _em_image_recording.film_or_detector_model _em_image_recording.avg_electron_dose_per_image _em_image_recording.average_exposure_time _em_image_recording.details _em_image_recording.num_grids_imaged _em_image_recording.num_diffraction_images _em_image_recording.num_real_images _em_image_recording.detector_mode 2 2 'GENERIC FILM' 20 12 ? ? ? 52 ? 3 3 'GENERIC FILM' 15 ? ? ? ? 20 ? 1 1 'GENERIC FILM' ? ? ? ? 150 ? ? # _em_specimen.experiment_id 1 _em_specimen.id 1 _em_specimen.concentration ? _em_specimen.vitrification_applied YES _em_specimen.staining_applied NO _em_specimen.embedding_applied YES _em_specimen.shadowing_applied NO _em_specimen.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PHOSPHORIC ACID 2,3-BIS-(3,7,11,15-TETRAMETHYL-HEXADECYLOXY)-PROPYL ESTER 2-HYDROXO-3-PHOSPHONOOXY-PROPYL ESTER' DPG 3 RETINAL RET #