data_2BVB # _entry.id 2BVB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.344 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2BVB PDBE EBI-24620 WWPDB D_1290024620 BMRB 6376 # _pdbx_database_related.db_id 6376 _pdbx_database_related.details . _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2BVB _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2005-06-23 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Saouros, S.' 1 'Edwards-Jones, B.' 2 'Reiss, M.' 3 'Sawmynaden, K.' 4 'Cota, E.' 5 'Simpson, P.' 6 'Dowse, T.J.' 7 'Jakle, U.' 8 'Ramboarina, S.' 9 'Shivarattan, T.' 10 'Matthews, S.' 11 'Soldati-Favre, D.' 12 # _citation.id primary _citation.title ;A Novel Galectin-Like Domain from Toxoplasma Gondll Micronemal Protein 1 Assists the Folding, Assembly,and Transport of a Cell-Adhesion Complex. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 280 _citation.page_first 38583 _citation.page_last ? _citation.year 2005 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16166092 _citation.pdbx_database_id_DOI 10.1074/JBC.C500365200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Saouros, S.' 1 ? primary 'Edwards-Jones, B.' 2 ? primary 'Reiss, M.' 3 ? primary 'Sawmynaden, K.' 4 ? primary 'Cota, E.' 5 ? primary 'Simpson, P.' 6 ? primary 'Dowse, T.J.' 7 ? primary 'Jakle, U.' 8 ? primary 'Ramboarina, S.' 9 ? primary 'Shivarattan, T.' 10 ? primary 'Matthews, S.' 11 ? primary 'Soldati-Favre, D.' 12 ? # _cell.entry_id 2BVB _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2BVB _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'MICRONEMAL PROTEIN 1' _entity.formula_weight 14030.571 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'C-TERMINAL DOMAIN RESIDUES 320-456' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;KTEIHGDSTKATLEEGQQLTLTFISTKLDVAVGSCHSLVANFLDGFLKFQTGSNSAFDVVEVEEPAGPAVLTIGLGHKGR LAVVLDYTRLNAALGSAAYVVEDSGCSSSEEVSFQGVGSGATLVVTTLGESPTAVSA ; _entity_poly.pdbx_seq_one_letter_code_can ;KTEIHGDSTKATLEEGQQLTLTFISTKLDVAVGSCHSLVANFLDGFLKFQTGSNSAFDVVEVEEPAGPAVLTIGLGHKGR LAVVLDYTRLNAALGSAAYVVEDSGCSSSEEVSFQGVGSGATLVVTTLGESPTAVSA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 THR n 1 3 GLU n 1 4 ILE n 1 5 HIS n 1 6 GLY n 1 7 ASP n 1 8 SER n 1 9 THR n 1 10 LYS n 1 11 ALA n 1 12 THR n 1 13 LEU n 1 14 GLU n 1 15 GLU n 1 16 GLY n 1 17 GLN n 1 18 GLN n 1 19 LEU n 1 20 THR n 1 21 LEU n 1 22 THR n 1 23 PHE n 1 24 ILE n 1 25 SER n 1 26 THR n 1 27 LYS n 1 28 LEU n 1 29 ASP n 1 30 VAL n 1 31 ALA n 1 32 VAL n 1 33 GLY n 1 34 SER n 1 35 CYS n 1 36 HIS n 1 37 SER n 1 38 LEU n 1 39 VAL n 1 40 ALA n 1 41 ASN n 1 42 PHE n 1 43 LEU n 1 44 ASP n 1 45 GLY n 1 46 PHE n 1 47 LEU n 1 48 LYS n 1 49 PHE n 1 50 GLN n 1 51 THR n 1 52 GLY n 1 53 SER n 1 54 ASN n 1 55 SER n 1 56 ALA n 1 57 PHE n 1 58 ASP n 1 59 VAL n 1 60 VAL n 1 61 GLU n 1 62 VAL n 1 63 GLU n 1 64 GLU n 1 65 PRO n 1 66 ALA n 1 67 GLY n 1 68 PRO n 1 69 ALA n 1 70 VAL n 1 71 LEU n 1 72 THR n 1 73 ILE n 1 74 GLY n 1 75 LEU n 1 76 GLY n 1 77 HIS n 1 78 LYS n 1 79 GLY n 1 80 ARG n 1 81 LEU n 1 82 ALA n 1 83 VAL n 1 84 VAL n 1 85 LEU n 1 86 ASP n 1 87 TYR n 1 88 THR n 1 89 ARG n 1 90 LEU n 1 91 ASN n 1 92 ALA n 1 93 ALA n 1 94 LEU n 1 95 GLY n 1 96 SER n 1 97 ALA n 1 98 ALA n 1 99 TYR n 1 100 VAL n 1 101 VAL n 1 102 GLU n 1 103 ASP n 1 104 SER n 1 105 GLY n 1 106 CYS n 1 107 SER n 1 108 SER n 1 109 SER n 1 110 GLU n 1 111 GLU n 1 112 VAL n 1 113 SER n 1 114 PHE n 1 115 GLN n 1 116 GLY n 1 117 VAL n 1 118 GLY n 1 119 SER n 1 120 GLY n 1 121 ALA n 1 122 THR n 1 123 LEU n 1 124 VAL n 1 125 VAL n 1 126 THR n 1 127 THR n 1 128 LEU n 1 129 GLY n 1 130 GLU n 1 131 SER n 1 132 PRO n 1 133 THR n 1 134 ALA n 1 135 VAL n 1 136 SER n 1 137 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'TOXOPLASMA GONDII' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5811 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O00834_TOXGO _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession O00834 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2BVB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 137 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O00834 _struct_ref_seq.db_align_beg 320 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 456 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 137 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310.0 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH ? _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? _pdbx_nmr_exptl_sample_conditions.pH_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K _pdbx_nmr_exptl_sample_conditions.label ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 OTHER Bruker 500 ? 2 OTHER Bruker 800 ? # _pdbx_nmr_refine.entry_id 2BVB _pdbx_nmr_refine.method ARIA _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2BVB _pdbx_nmr_details.text NONE # _pdbx_nmr_ensemble.entry_id 2BVB _pdbx_nmr_ensemble.conformers_calculated_total_number 10 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2BVB _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CNS ? 'BRUNGER,ADAMS,CLORE,DELANO,GROS, GROSSE- KUNSTLEVE,JIANG,KUSZEWSKI,NILGES, PANNU,READ, RICE,SIMONSON,WARREN' 1 'structure solution' NMRView ? ? 2 # _exptl.entry_id 2BVB _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2BVB _struct.title 'The C-terminal domain from Micronemal Protein 1 (MIC1) from Toxoplasma Gondii' _struct.pdbx_descriptor 'MICRONEMAL PROTEIN 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'MINIMIZED AVERAGE' # _struct_keywords.entry_id 2BVB _struct_keywords.pdbx_keywords ADHESION _struct_keywords.text 'MIC1, MICRONEME, INVASION, ADHESION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 35 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 106 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 35 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 106 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.028 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 6 ? AB ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AA 4 5 ? anti-parallel AA 5 6 ? anti-parallel AB 1 2 ? anti-parallel AB 2 3 ? anti-parallel AB 3 4 ? anti-parallel AB 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 SER A 8 ? LEU A 13 ? SER A 8 LEU A 13 AA 2 GLU A 110 ? GLN A 115 ? GLU A 110 GLN A 115 AA 3 LYS A 27 ? ALA A 31 ? LYS A 27 ALA A 31 AA 4 SER A 37 ? ASN A 41 ? SER A 37 ASN A 41 AA 5 PHE A 46 ? GLN A 50 ? PHE A 46 GLN A 50 AA 6 ASP A 58 ? VAL A 60 ? ASP A 58 VAL A 60 AB 1 LEU A 94 ? VAL A 101 ? LEU A 94 VAL A 101 AB 2 LEU A 81 ? ARG A 89 ? LEU A 81 ARG A 89 AB 3 PRO A 65 ? LEU A 75 ? PRO A 65 LEU A 75 AB 4 GLN A 18 ? ILE A 24 ? GLN A 18 ILE A 24 AB 5 THR A 122 ? THR A 126 ? THR A 122 THR A 126 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N LEU A 13 ? N LEU A 13 O GLU A 110 ? O GLU A 110 AA 2 3 N GLN A 115 ? N GLN A 115 O ASP A 29 ? O ASP A 29 AA 3 4 N VAL A 30 ? N VAL A 30 O LEU A 38 ? O LEU A 38 AA 4 5 N ASN A 41 ? N ASN A 41 O PHE A 46 ? O PHE A 46 AA 5 6 N PHE A 49 ? N PHE A 49 O ASP A 58 ? O ASP A 58 AB 1 2 N VAL A 101 ? N VAL A 101 O LEU A 81 ? O LEU A 81 AB 2 3 O THR A 88 ? O THR A 88 N ALA A 66 ? N ALA A 66 AB 3 4 N ILE A 73 ? N ILE A 73 O LEU A 19 ? O LEU A 19 AB 4 5 N THR A 22 ? N THR A 22 O THR A 122 ? O THR A 122 # _database_PDB_matrix.entry_id 2BVB _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2BVB _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 1 LYS LYS A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 HIS 36 36 36 HIS HIS A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 TYR 87 87 87 TYR TYR A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 TYR 99 99 99 TYR TYR A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 CYS 106 106 106 CYS CYS A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 GLN 115 115 115 GLN GLN A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 THR 126 126 126 THR THR A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 PRO 132 132 132 PRO PRO A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 ALA 137 137 137 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-10-12 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-06-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_nmr_ensemble 2 4 'Structure model' pdbx_nmr_representative 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_nmr_ensemble.conformer_selection_criteria' 2 4 'Structure model' '_pdbx_nmr_ensemble.conformers_calculated_total_number' 3 4 'Structure model' '_pdbx_nmr_software.name' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 7 ? ? -168.04 -32.14 2 1 GLU A 15 ? ? -38.69 139.71 3 1 ILE A 24 ? ? -117.01 79.32 4 1 VAL A 32 ? ? -61.97 97.98 5 1 THR A 51 ? ? -98.43 -74.04 6 1 ASN A 54 ? ? 66.50 138.79 7 1 SER A 55 ? ? 66.38 -79.70 8 1 GLU A 63 ? ? -56.52 172.53 9 1 HIS A 77 ? ? -178.14 -169.35 10 1 SER A 104 ? ? -113.02 -81.44 11 1 CYS A 106 ? ? -90.04 -158.97 12 1 SER A 107 ? ? -172.12 -70.66 13 1 GLU A 110 ? ? -160.99 105.38 14 1 LEU A 128 ? ? 59.75 -79.30 15 1 THR A 133 ? ? -63.71 87.60 16 1 ALA A 134 ? ? 63.20 -4.70 17 1 VAL A 135 ? ? 30.40 37.89 18 1 SER A 136 ? ? -168.33 -18.35 #