data_2BW2 # _entry.id 2BW2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2BW2 pdb_00002bw2 10.2210/pdb2bw2/pdb PDBE EBI-24766 ? ? WWPDB D_1290024766 ? ? BMRB 6731 ? 10.13018/BMR6731 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-09-15 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-05-09 5 'Structure model' 1 4 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' 7 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' citation 2 4 'Structure model' citation_author 3 4 'Structure model' pdbx_nmr_spectrometer 4 5 'Structure model' chem_comp_atom 5 5 'Structure model' chem_comp_bond 6 5 'Structure model' database_2 7 5 'Structure model' pdbx_database_status 8 5 'Structure model' pdbx_nmr_software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation.journal_abbrev' 2 4 'Structure model' '_citation.page_last' 3 4 'Structure model' '_citation.pdbx_database_id_DOI' 4 4 'Structure model' '_citation.title' 5 4 'Structure model' '_citation_author.name' 6 4 'Structure model' '_pdbx_nmr_spectrometer.model' 7 5 'Structure model' '_database_2.pdbx_DOI' 8 5 'Structure model' '_database_2.pdbx_database_accession' 9 5 'Structure model' '_pdbx_database_status.status_code_mr' 10 5 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2BW2 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2005-07-08 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_id 6731 _pdbx_database_related.details . _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Patterson, H.M.' 1 'Brannigan, J.A.' 2 'Cutting, S.M.' 3 'Wilson, K.S.' 4 'Wilkinson, A.J.' 5 'Ab, E.' 6 'Diercks, T.' 7 'Folkers, G.E.' 8 'de Jong, R.N.' 9 'Truffault, V.' 10 'Kaptein, R.' 11 # _citation.id primary _citation.title 'The structure of bypass of forespore C, an intercompartmental signaling factor during sporulation in Bacillus.' _citation.journal_abbrev 'J. Biol. Chem.' _citation.journal_volume 280 _citation.page_first 36214 _citation.page_last 36220 _citation.year 2005 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16049010 _citation.pdbx_database_id_DOI 10.1074/jbc.M506910200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Patterson, H.M.' 1 ? primary 'Brannigan, J.A.' 2 ? primary 'Cutting, S.M.' 3 ? primary 'Wilson, K.S.' 4 ? primary 'Wilkinson, A.J.' 5 ? primary 'Ab, E.' 6 ? primary 'Diercks, T.' 7 ? primary 'de Jong, R.N.' 8 ? primary 'Truffault, V.' 9 ? primary 'Folkers, G.E.' 10 ? primary 'Kaptein, R.' 11 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'BYPASS OF FORESPORE C' _entity.formula_weight 16195.253 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AEVEHYEPLQVHVQLEKVYLDGDVSIEHKHEKVFSMDDFWAAYAGWTLVEQKKGYVLFRKQMDDISPLSKVNGYIGVSDN GVISTFHGRPEPASEPIQSFFQIDLERLESHMQKNLLKGIPFRTKAEFEDVIEHMKTYSG ; _entity_poly.pdbx_seq_one_letter_code_can ;AEVEHYEPLQVHVQLEKVYLDGDVSIEHKHEKVFSMDDFWAAYAGWTLVEQKKGYVLFRKQMDDISPLSKVNGYIGVSDN GVISTFHGRPEPASEPIQSFFQIDLERLESHMQKNLLKGIPFRTKAEFEDVIEHMKTYSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLU n 1 3 VAL n 1 4 GLU n 1 5 HIS n 1 6 TYR n 1 7 GLU n 1 8 PRO n 1 9 LEU n 1 10 GLN n 1 11 VAL n 1 12 HIS n 1 13 VAL n 1 14 GLN n 1 15 LEU n 1 16 GLU n 1 17 LYS n 1 18 VAL n 1 19 TYR n 1 20 LEU n 1 21 ASP n 1 22 GLY n 1 23 ASP n 1 24 VAL n 1 25 SER n 1 26 ILE n 1 27 GLU n 1 28 HIS n 1 29 LYS n 1 30 HIS n 1 31 GLU n 1 32 LYS n 1 33 VAL n 1 34 PHE n 1 35 SER n 1 36 MET n 1 37 ASP n 1 38 ASP n 1 39 PHE n 1 40 TRP n 1 41 ALA n 1 42 ALA n 1 43 TYR n 1 44 ALA n 1 45 GLY n 1 46 TRP n 1 47 THR n 1 48 LEU n 1 49 VAL n 1 50 GLU n 1 51 GLN n 1 52 LYS n 1 53 LYS n 1 54 GLY n 1 55 TYR n 1 56 VAL n 1 57 LEU n 1 58 PHE n 1 59 ARG n 1 60 LYS n 1 61 GLN n 1 62 MET n 1 63 ASP n 1 64 ASP n 1 65 ILE n 1 66 SER n 1 67 PRO n 1 68 LEU n 1 69 SER n 1 70 LYS n 1 71 VAL n 1 72 ASN n 1 73 GLY n 1 74 TYR n 1 75 ILE n 1 76 GLY n 1 77 VAL n 1 78 SER n 1 79 ASP n 1 80 ASN n 1 81 GLY n 1 82 VAL n 1 83 ILE n 1 84 SER n 1 85 THR n 1 86 PHE n 1 87 HIS n 1 88 GLY n 1 89 ARG n 1 90 PRO n 1 91 GLU n 1 92 PRO n 1 93 ALA n 1 94 SER n 1 95 GLU n 1 96 PRO n 1 97 ILE n 1 98 GLN n 1 99 SER n 1 100 PHE n 1 101 PHE n 1 102 GLN n 1 103 ILE n 1 104 ASP n 1 105 LEU n 1 106 GLU n 1 107 ARG n 1 108 LEU n 1 109 GLU n 1 110 SER n 1 111 HIS n 1 112 MET n 1 113 GLN n 1 114 LYS n 1 115 ASN n 1 116 LEU n 1 117 LEU n 1 118 LYS n 1 119 GLY n 1 120 ILE n 1 121 PRO n 1 122 PHE n 1 123 ARG n 1 124 THR n 1 125 LYS n 1 126 ALA n 1 127 GLU n 1 128 PHE n 1 129 GLU n 1 130 ASP n 1 131 VAL n 1 132 ILE n 1 133 GLU n 1 134 HIS n 1 135 MET n 1 136 LYS n 1 137 THR n 1 138 TYR n 1 139 SER n 1 140 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain IG20 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'BACILLUS SUBTILIS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1423 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description NCIMB11621 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 HIS 12 12 12 HIS HIS A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 MET 36 36 36 MET MET A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 TRP 40 40 40 TRP TRP A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 TRP 46 46 46 TRP TRP A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 MET 62 62 62 MET MET A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 PHE 101 101 101 PHE PHE A . n A 1 102 GLN 102 102 102 GLN GLN A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 HIS 111 111 111 HIS HIS A . n A 1 112 MET 112 112 112 MET MET A . n A 1 113 GLN 113 113 113 GLN GLN A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 PRO 121 121 121 PRO PRO A . n A 1 122 PHE 122 122 122 PHE PHE A . n A 1 123 ARG 123 123 123 ARG ARG A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 ASP 130 130 130 ASP ASP A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 HIS 134 134 134 HIS HIS A . n A 1 135 MET 135 135 135 MET MET A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 THR 137 137 137 THR THR A . n A 1 138 TYR 138 138 138 TYR TYR A . n A 1 139 SER 139 139 139 SER SER A . n A 1 140 GLY 140 140 140 GLY GLY A . n # _cell.entry_id 2BW2 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2BW2 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 2BW2 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2BW2 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2BW2 _struct.title 'BofC from Bacillus subtilis' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2BW2 _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'SPORULATION, SIGNALING PROTEIN, BOFC, SIGMAK CHECKPOINT' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BOFC_BACSU _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession O05391 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2BW2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 140 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O05391 _struct_ref_seq.db_align_beg 31 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 170 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 140 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 MET A 36 ? TYR A 43 ? MET A 36 TYR A 43 1 ? 8 HELX_P HELX_P2 2 PRO A 67 ? VAL A 71 ? PRO A 67 VAL A 71 5 ? 5 HELX_P HELX_P3 3 GLU A 109 ? GLY A 119 ? GLU A 109 GLY A 119 1 ? 11 HELX_P HELX_P4 4 THR A 124 ? SER A 139 ? THR A 124 SER A 139 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 4 ? AB ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? parallel AA 3 4 ? anti-parallel AB 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 VAL A 24 ? SER A 35 ? VAL A 24 SER A 35 AA 2 GLU A 4 ? VAL A 18 ? GLU A 4 VAL A 18 AA 3 TYR A 55 ? GLN A 61 ? TYR A 55 GLN A 61 AA 4 THR A 47 ? LYS A 52 ? THR A 47 LYS A 52 AB 1 ILE A 75 ? SER A 78 ? ILE A 75 SER A 78 AB 2 VAL A 82 ? THR A 85 ? VAL A 82 THR A 85 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 O PHE A 34 ? O PHE A 34 N HIS A 5 ? N HIS A 5 AA 2 3 N GLN A 14 ? N GLN A 14 O VAL A 56 ? O VAL A 56 AA 3 4 N ARG A 59 ? N ARG A 59 O THR A 47 ? O THR A 47 AB 1 2 O SER A 78 ? O SER A 78 N VAL A 82 ? N VAL A 82 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 A GLU 31 ? ? HH A TYR 43 ? ? 1.59 2 3 OE1 A GLU 2 ? ? HZ2 A LYS 53 ? ? 1.56 3 4 HG1 A THR 124 ? ? OE1 A GLU 127 ? ? 1.59 4 8 OE1 A GLU 31 ? ? HH A TYR 43 ? ? 1.57 5 8 OE2 A GLU 4 ? ? HG A SER 35 ? ? 1.58 6 10 OE2 A GLU 31 ? ? HH A TYR 43 ? ? 1.58 7 11 OE2 A GLU 31 ? ? HH A TYR 43 ? ? 1.58 8 13 OE1 A GLU 31 ? ? HH A TYR 43 ? ? 1.60 9 14 HZ1 A LYS 125 ? ? OE2 A GLU 129 ? ? 1.58 10 17 OE1 A GLU 31 ? ? HH A TYR 43 ? ? 1.60 11 21 OD2 A ASP 64 ? ? HZ1 A LYS 125 ? ? 1.60 12 23 OE1 A GLU 4 ? ? HZ2 A LYS 53 ? ? 1.56 13 23 OE2 A GLU 31 ? ? HH A TYR 43 ? ? 1.57 14 24 OE2 A GLU 31 ? ? HH A TYR 43 ? ? 1.58 15 25 HZ1 A LYS 125 ? ? OE2 A GLU 129 ? ? 1.58 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 12 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 VAL _pdbx_validate_rmsd_angle.auth_seq_id_1 56 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 VAL _pdbx_validate_rmsd_angle.auth_seq_id_2 56 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CG2 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 VAL _pdbx_validate_rmsd_angle.auth_seq_id_3 56 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 122.21 _pdbx_validate_rmsd_angle.angle_target_value 110.90 _pdbx_validate_rmsd_angle.angle_deviation 11.31 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 66 ? ? 102.95 153.59 2 1 ASN A 72 ? ? -92.61 -84.38 3 1 ILE A 83 ? ? -80.96 37.16 4 1 PHE A 122 ? ? -172.98 147.31 5 1 SER A 139 ? ? 55.40 17.03 6 2 SER A 66 ? ? 160.31 161.13 7 2 ASN A 72 ? ? -157.91 37.50 8 2 ILE A 83 ? ? -80.62 36.89 9 2 PHE A 100 ? ? -89.81 -74.29 10 2 SER A 110 ? ? 174.31 -64.41 11 2 TYR A 138 ? ? -93.24 -61.65 12 3 GLU A 4 ? ? -61.20 98.91 13 3 HIS A 5 ? ? -106.04 -164.03 14 3 LYS A 53 ? ? 39.13 -76.64 15 3 ILE A 83 ? ? -80.25 36.26 16 3 PHE A 100 ? ? -69.63 -71.91 17 3 GLU A 109 ? ? -65.61 -72.80 18 3 SER A 110 ? ? -162.46 -64.09 19 3 PHE A 122 ? ? -174.41 143.40 20 4 ASP A 64 ? ? -119.86 -91.42 21 4 ASN A 72 ? ? -98.79 -81.51 22 4 TYR A 74 ? ? -160.05 107.91 23 4 ILE A 83 ? ? -81.02 38.79 24 4 PRO A 90 ? ? -64.91 99.49 25 4 GLN A 98 ? ? -160.07 -168.73 26 4 PHE A 100 ? ? -83.46 -70.85 27 5 HIS A 5 ? ? 68.99 -163.39 28 5 LYS A 53 ? ? -67.01 94.98 29 5 ASN A 72 ? ? -79.27 -72.60 30 5 ILE A 83 ? ? -80.42 36.28 31 5 GLN A 98 ? ? -162.52 -160.67 32 5 PHE A 100 ? ? -108.74 -73.16 33 5 GLU A 109 ? ? -64.41 -73.16 34 5 SER A 110 ? ? -162.92 -80.97 35 5 PHE A 122 ? ? -175.07 141.38 36 5 SER A 139 ? ? 49.86 17.13 37 6 PRO A 8 ? ? -73.70 -168.97 38 6 SER A 66 ? ? 141.98 145.55 39 6 ASN A 72 ? ? -151.58 75.56 40 6 ILE A 83 ? ? -81.43 37.92 41 7 HIS A 5 ? ? 76.28 -171.12 42 7 LYS A 53 ? ? -68.14 98.77 43 7 ASN A 72 ? ? -85.79 -73.91 44 7 ILE A 83 ? ? -81.68 36.49 45 7 PHE A 100 ? ? -97.11 -91.71 46 7 GLU A 109 ? ? -59.86 -75.26 47 7 SER A 110 ? ? -172.81 -69.12 48 7 PHE A 122 ? ? -178.65 139.34 49 7 SER A 139 ? ? 55.05 7.89 50 8 LYS A 53 ? ? -68.84 97.80 51 8 SER A 66 ? ? 79.78 156.07 52 8 ASN A 72 ? ? -152.93 26.26 53 8 ILE A 83 ? ? -81.30 36.02 54 8 PHE A 100 ? ? -94.01 -73.30 55 8 SER A 110 ? ? 33.72 -79.04 56 8 PRO A 121 ? ? -69.09 19.35 57 8 PHE A 122 ? ? 68.29 163.15 58 8 SER A 139 ? ? 50.51 16.84 59 9 VAL A 3 ? ? 61.93 -175.86 60 9 SER A 66 ? ? 88.01 158.43 61 9 ILE A 83 ? ? -80.17 38.80 62 9 PHE A 100 ? ? -78.66 -71.61 63 9 GLU A 109 ? ? -53.42 -72.62 64 9 SER A 110 ? ? -160.22 -74.41 65 9 PRO A 121 ? ? -67.01 10.20 66 9 PHE A 122 ? ? -171.45 147.84 67 9 TYR A 138 ? ? -95.31 -61.41 68 9 SER A 139 ? ? 51.01 19.49 69 10 LYS A 53 ? ? -63.97 98.36 70 10 ILE A 83 ? ? -82.18 36.54 71 10 PHE A 100 ? ? -102.09 -73.29 72 10 GLU A 109 ? ? -66.85 -87.27 73 10 SER A 110 ? ? -157.60 -78.47 74 10 PRO A 121 ? ? -70.21 27.75 75 10 PHE A 122 ? ? 64.37 169.92 76 10 SER A 139 ? ? 55.65 14.70 77 11 PRO A 8 ? ? -53.00 173.45 78 11 ASN A 72 ? ? -132.61 -78.42 79 11 ILE A 83 ? ? -82.42 35.30 80 11 PHE A 100 ? ? -103.16 -65.05 81 11 GLU A 109 ? ? -54.66 -75.47 82 11 SER A 110 ? ? -159.29 -86.40 83 11 ILE A 120 ? ? 78.30 150.08 84 11 PRO A 121 ? ? -76.45 27.00 85 11 PHE A 122 ? ? 68.88 -168.32 86 11 SER A 139 ? ? 53.98 11.46 87 12 ASP A 63 ? ? -82.37 48.51 88 12 SER A 66 ? ? 145.71 149.20 89 12 ASN A 72 ? ? -102.18 -79.54 90 12 ILE A 83 ? ? -82.04 36.56 91 12 PRO A 90 ? ? -67.38 99.22 92 12 GLN A 98 ? ? -163.67 -168.15 93 12 SER A 110 ? ? 155.94 -61.54 94 12 PHE A 122 ? ? -174.61 143.66 95 12 SER A 139 ? ? 50.55 19.60 96 13 LYS A 53 ? ? -61.16 98.13 97 13 ILE A 83 ? ? -82.07 37.79 98 13 PHE A 100 ? ? -83.50 -70.18 99 13 SER A 110 ? ? 72.84 -163.30 100 13 TYR A 138 ? ? -95.36 -62.68 101 13 SER A 139 ? ? 51.68 18.55 102 14 GLU A 2 ? ? 69.67 -172.41 103 14 LYS A 53 ? ? 53.19 -80.65 104 14 SER A 66 ? ? 167.12 167.85 105 14 ASN A 72 ? ? -106.15 -79.89 106 14 ILE A 83 ? ? -81.29 37.48 107 14 GLN A 98 ? ? -168.08 -167.74 108 14 SER A 110 ? ? 32.44 -87.28 109 15 GLU A 2 ? ? 66.40 162.33 110 15 ASN A 72 ? ? -120.65 -75.63 111 15 ILE A 83 ? ? -82.48 35.51 112 15 GLU A 109 ? ? -57.70 -74.29 113 15 SER A 110 ? ? -170.24 -75.27 114 15 SER A 139 ? ? -69.06 25.65 115 16 VAL A 3 ? ? 55.36 115.97 116 16 HIS A 5 ? ? 68.09 -164.87 117 16 LYS A 53 ? ? 57.79 -79.21 118 16 ILE A 83 ? ? -80.41 38.35 119 16 PRO A 90 ? ? -58.13 98.34 120 16 PHE A 100 ? ? -78.46 -75.82 121 16 SER A 110 ? ? -167.68 -78.84 122 16 SER A 139 ? ? 51.46 15.90 123 17 HIS A 5 ? ? -129.97 -169.33 124 17 ALA A 44 ? ? -64.42 86.23 125 17 LYS A 53 ? ? 53.43 -79.59 126 17 MET A 62 ? ? -150.42 79.65 127 17 ASP A 64 ? ? -94.44 -101.49 128 17 ASN A 72 ? ? -168.78 37.57 129 17 ILE A 83 ? ? -80.72 39.35 130 17 SER A 110 ? ? -158.41 -83.26 131 17 PRO A 121 ? ? -71.60 40.22 132 17 PHE A 122 ? ? 77.32 137.75 133 17 TYR A 138 ? ? -96.32 -66.62 134 18 LYS A 53 ? ? 43.47 -81.33 135 18 ASN A 72 ? ? -153.25 73.23 136 18 ILE A 83 ? ? -81.47 38.35 137 18 PHE A 100 ? ? -92.56 -82.27 138 18 GLU A 109 ? ? -63.79 -75.61 139 18 SER A 110 ? ? -163.90 -76.81 140 19 VAL A 3 ? ? 69.71 -179.21 141 19 MET A 62 ? ? -152.73 82.78 142 19 ASP A 63 ? ? 179.60 -165.57 143 19 ASP A 64 ? ? -107.10 -100.99 144 19 ASN A 72 ? ? -93.76 -65.04 145 19 ILE A 83 ? ? -82.23 35.75 146 19 PHE A 100 ? ? -93.42 -71.58 147 19 SER A 110 ? ? -166.08 -71.21 148 19 SER A 139 ? ? 47.21 27.35 149 20 LYS A 53 ? ? 38.85 -85.67 150 20 ASP A 63 ? ? 66.04 -82.72 151 20 ASP A 64 ? ? -176.34 -101.22 152 20 ASN A 72 ? ? -85.85 -72.09 153 20 ILE A 83 ? ? -80.21 36.33 154 20 PHE A 100 ? ? -101.30 -75.82 155 20 SER A 110 ? ? 87.70 -78.97 156 20 TYR A 138 ? ? -93.65 -63.81 157 20 SER A 139 ? ? 46.97 29.05 158 21 ASN A 72 ? ? -96.90 -77.96 159 21 ILE A 83 ? ? -80.84 36.57 160 21 PRO A 90 ? ? -69.07 91.27 161 21 PHE A 100 ? ? -101.51 -80.25 162 21 GLU A 109 ? ? -63.74 -80.54 163 21 SER A 110 ? ? -155.17 -85.73 164 21 PHE A 122 ? ? -175.90 147.24 165 21 TYR A 138 ? ? -93.23 -61.50 166 22 ASP A 63 ? ? 67.74 89.09 167 22 ASP A 64 ? ? 173.33 171.71 168 22 ASN A 72 ? ? -83.11 -71.36 169 22 ILE A 83 ? ? -81.94 36.52 170 22 GLU A 109 ? ? -70.87 -84.51 171 22 SER A 110 ? ? -154.43 -76.01 172 22 PHE A 122 ? ? -175.07 147.03 173 22 TYR A 138 ? ? -93.65 -62.27 174 22 SER A 139 ? ? 52.08 19.42 175 23 HIS A 5 ? ? 60.20 -167.84 176 23 ILE A 83 ? ? -80.68 38.18 177 23 PHE A 100 ? ? -78.80 -72.79 178 23 PRO A 121 ? ? -67.72 23.96 179 23 PHE A 122 ? ? 63.96 171.32 180 23 TYR A 138 ? ? -90.99 -74.50 181 23 SER A 139 ? ? 42.52 25.32 182 24 LYS A 53 ? ? -58.71 104.10 183 24 ASP A 64 ? ? 177.07 168.76 184 24 ASN A 72 ? ? -89.47 -75.07 185 24 ILE A 83 ? ? -82.09 39.00 186 24 SER A 110 ? ? 43.71 -88.60 187 24 SER A 139 ? ? 47.33 23.20 188 25 VAL A 3 ? ? 59.90 158.99 189 25 HIS A 5 ? ? -100.33 -160.02 190 25 ALA A 44 ? ? -68.47 75.89 191 25 LYS A 53 ? ? 56.39 -85.06 192 25 ASP A 63 ? ? -84.14 49.52 193 25 SER A 66 ? ? 68.99 160.73 194 25 ASN A 72 ? ? -100.88 -76.39 195 25 ILE A 83 ? ? -82.30 38.20 196 25 GLU A 109 ? ? -53.36 -75.17 197 25 SER A 110 ? ? -161.24 -73.33 198 25 PHE A 122 ? ? 179.55 146.55 199 25 TYR A 138 ? ? -92.00 -61.27 200 25 SER A 139 ? ? 53.49 17.80 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 2 ARG A 123 ? ? 0.086 'SIDE CHAIN' 2 5 ARG A 123 ? ? 0.075 'SIDE CHAIN' 3 11 ARG A 107 ? ? 0.071 'SIDE CHAIN' 4 12 ARG A 107 ? ? 0.072 'SIDE CHAIN' 5 16 ARG A 107 ? ? 0.074 'SIDE CHAIN' 6 19 ARG A 107 ? ? 0.084 'SIDE CHAIN' 7 20 ARG A 123 ? ? 0.119 'SIDE CHAIN' # _pdbx_entry_details.entry_id 2BW2 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;THE PROTEIN PRECURSOR FOR BOFC HAS 170 RESIDUES. THE NMR STRUCTURE IS FOR MATURE BOFC, WITH THE N-TERMINAL 30 RESIDUE TRANSLOCATION SEQUENCE CLEAVED. THE NMR STRUCTURE REFERS TO RESIDUE NUMBERS FOR THE MATURE PROTEIN, IE RESIDUES A1-G140 (NOT A31-G170) ; _pdbx_entry_details.has_ligand_of_interest ? # _pdbx_nmr_ensemble.entry_id 2BW2 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 25 _pdbx_nmr_ensemble.conformer_selection_criteria ENERGY # _pdbx_nmr_representative.entry_id 2BW2 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '95% WATER/5% D20' _pdbx_nmr_sample_details.solvent_system ? _pdbx_nmr_sample_details.label ? _pdbx_nmr_sample_details.type ? _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298.0 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K _pdbx_nmr_exptl_sample_conditions.label ? # _pdbx_nmr_details.entry_id 2BW2 _pdbx_nmr_details.text 'THE STRUCTURE WAS DETERMINED USING TRIPLE-RESONANCE NMR SPECTROSCOPY ON 13C, 15N-LABELED BOFC.' # _pdbx_nmr_refine.entry_id 2BW2 _pdbx_nmr_refine.method 'CANDID AND CNS' _pdbx_nmr_refine.details 'REFINEMENT DETAILS CAN BE FOUND IN THE JRNL CITATION ABOVE.' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CNS ? 'BRUNGER,ADAMS,CLORE,DELANO,GROS, GROSSE- KUNSTLEVE,JIANG,KUSZEWSKI,NILGES, PANNU,READ, RICE,SIMONSON,WARREN' 1 'structure solution' Sparky ? ? 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2BW2 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_