data_2BW2
# 
_entry.id   2BW2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.392 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2BW2         pdb_00002bw2 10.2210/pdb2bw2/pdb 
PDBE  EBI-24766    ?            ?                   
WWPDB D_1290024766 ?            ?                   
BMRB  6731         ?            10.13018/BMR6731    
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-09-15 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-05-09 
5 'Structure model' 1 4 2024-05-15 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Database references'       
5 5 'Structure model' 'Data collection'           
6 5 'Structure model' 'Database references'       
7 5 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' citation              
2 4 'Structure model' citation_author       
3 4 'Structure model' pdbx_nmr_spectrometer 
4 5 'Structure model' chem_comp_atom        
5 5 'Structure model' chem_comp_bond        
6 5 'Structure model' database_2            
7 5 'Structure model' pdbx_database_status  
8 5 'Structure model' pdbx_nmr_software     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_citation.journal_abbrev'             
2  4 'Structure model' '_citation.page_last'                  
3  4 'Structure model' '_citation.pdbx_database_id_DOI'       
4  4 'Structure model' '_citation.title'                      
5  4 'Structure model' '_citation_author.name'                
6  4 'Structure model' '_pdbx_nmr_spectrometer.model'         
7  5 'Structure model' '_database_2.pdbx_DOI'                 
8  5 'Structure model' '_database_2.pdbx_database_accession'  
9  5 'Structure model' '_pdbx_database_status.status_code_mr' 
10 5 'Structure model' '_pdbx_nmr_software.name'              
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2BW2 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2005-07-08 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
_pdbx_database_related.db_id          6731 
_pdbx_database_related.details        . 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.content_type   unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Patterson, H.M.' 1  
'Brannigan, J.A.' 2  
'Cutting, S.M.'   3  
'Wilson, K.S.'    4  
'Wilkinson, A.J.' 5  
'Ab, E.'          6  
'Diercks, T.'     7  
'Folkers, G.E.'   8  
'de Jong, R.N.'   9  
'Truffault, V.'   10 
'Kaptein, R.'     11 
# 
_citation.id                        primary 
_citation.title                     
'The structure of bypass of forespore C, an intercompartmental signaling factor during sporulation in Bacillus.' 
_citation.journal_abbrev            'J. Biol. Chem.' 
_citation.journal_volume            280 
_citation.page_first                36214 
_citation.page_last                 36220 
_citation.year                      2005 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16049010 
_citation.pdbx_database_id_DOI      10.1074/jbc.M506910200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Patterson, H.M.' 1  ? 
primary 'Brannigan, J.A.' 2  ? 
primary 'Cutting, S.M.'   3  ? 
primary 'Wilson, K.S.'    4  ? 
primary 'Wilkinson, A.J.' 5  ? 
primary 'Ab, E.'          6  ? 
primary 'Diercks, T.'     7  ? 
primary 'de Jong, R.N.'   8  ? 
primary 'Truffault, V.'   9  ? 
primary 'Folkers, G.E.'   10 ? 
primary 'Kaptein, R.'     11 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'BYPASS OF FORESPORE C' 
_entity.formula_weight             16195.253 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;AEVEHYEPLQVHVQLEKVYLDGDVSIEHKHEKVFSMDDFWAAYAGWTLVEQKKGYVLFRKQMDDISPLSKVNGYIGVSDN
GVISTFHGRPEPASEPIQSFFQIDLERLESHMQKNLLKGIPFRTKAEFEDVIEHMKTYSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;AEVEHYEPLQVHVQLEKVYLDGDVSIEHKHEKVFSMDDFWAAYAGWTLVEQKKGYVLFRKQMDDISPLSKVNGYIGVSDN
GVISTFHGRPEPASEPIQSFFQIDLERLESHMQKNLLKGIPFRTKAEFEDVIEHMKTYSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   GLU n 
1 3   VAL n 
1 4   GLU n 
1 5   HIS n 
1 6   TYR n 
1 7   GLU n 
1 8   PRO n 
1 9   LEU n 
1 10  GLN n 
1 11  VAL n 
1 12  HIS n 
1 13  VAL n 
1 14  GLN n 
1 15  LEU n 
1 16  GLU n 
1 17  LYS n 
1 18  VAL n 
1 19  TYR n 
1 20  LEU n 
1 21  ASP n 
1 22  GLY n 
1 23  ASP n 
1 24  VAL n 
1 25  SER n 
1 26  ILE n 
1 27  GLU n 
1 28  HIS n 
1 29  LYS n 
1 30  HIS n 
1 31  GLU n 
1 32  LYS n 
1 33  VAL n 
1 34  PHE n 
1 35  SER n 
1 36  MET n 
1 37  ASP n 
1 38  ASP n 
1 39  PHE n 
1 40  TRP n 
1 41  ALA n 
1 42  ALA n 
1 43  TYR n 
1 44  ALA n 
1 45  GLY n 
1 46  TRP n 
1 47  THR n 
1 48  LEU n 
1 49  VAL n 
1 50  GLU n 
1 51  GLN n 
1 52  LYS n 
1 53  LYS n 
1 54  GLY n 
1 55  TYR n 
1 56  VAL n 
1 57  LEU n 
1 58  PHE n 
1 59  ARG n 
1 60  LYS n 
1 61  GLN n 
1 62  MET n 
1 63  ASP n 
1 64  ASP n 
1 65  ILE n 
1 66  SER n 
1 67  PRO n 
1 68  LEU n 
1 69  SER n 
1 70  LYS n 
1 71  VAL n 
1 72  ASN n 
1 73  GLY n 
1 74  TYR n 
1 75  ILE n 
1 76  GLY n 
1 77  VAL n 
1 78  SER n 
1 79  ASP n 
1 80  ASN n 
1 81  GLY n 
1 82  VAL n 
1 83  ILE n 
1 84  SER n 
1 85  THR n 
1 86  PHE n 
1 87  HIS n 
1 88  GLY n 
1 89  ARG n 
1 90  PRO n 
1 91  GLU n 
1 92  PRO n 
1 93  ALA n 
1 94  SER n 
1 95  GLU n 
1 96  PRO n 
1 97  ILE n 
1 98  GLN n 
1 99  SER n 
1 100 PHE n 
1 101 PHE n 
1 102 GLN n 
1 103 ILE n 
1 104 ASP n 
1 105 LEU n 
1 106 GLU n 
1 107 ARG n 
1 108 LEU n 
1 109 GLU n 
1 110 SER n 
1 111 HIS n 
1 112 MET n 
1 113 GLN n 
1 114 LYS n 
1 115 ASN n 
1 116 LEU n 
1 117 LEU n 
1 118 LYS n 
1 119 GLY n 
1 120 ILE n 
1 121 PRO n 
1 122 PHE n 
1 123 ARG n 
1 124 THR n 
1 125 LYS n 
1 126 ALA n 
1 127 GLU n 
1 128 PHE n 
1 129 GLU n 
1 130 ASP n 
1 131 VAL n 
1 132 ILE n 
1 133 GLU n 
1 134 HIS n 
1 135 MET n 
1 136 LYS n 
1 137 THR n 
1 138 TYR n 
1 139 SER n 
1 140 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    IG20 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'BACILLUS SUBTILIS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1423 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   NCIMB11621 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   1   ALA ALA A . n 
A 1 2   GLU 2   2   2   GLU GLU A . n 
A 1 3   VAL 3   3   3   VAL VAL A . n 
A 1 4   GLU 4   4   4   GLU GLU A . n 
A 1 5   HIS 5   5   5   HIS HIS A . n 
A 1 6   TYR 6   6   6   TYR TYR A . n 
A 1 7   GLU 7   7   7   GLU GLU A . n 
A 1 8   PRO 8   8   8   PRO PRO A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  GLN 10  10  10  GLN GLN A . n 
A 1 11  VAL 11  11  11  VAL VAL A . n 
A 1 12  HIS 12  12  12  HIS HIS A . n 
A 1 13  VAL 13  13  13  VAL VAL A . n 
A 1 14  GLN 14  14  14  GLN GLN A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  GLU 16  16  16  GLU GLU A . n 
A 1 17  LYS 17  17  17  LYS LYS A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  TYR 19  19  19  TYR TYR A . n 
A 1 20  LEU 20  20  20  LEU LEU A . n 
A 1 21  ASP 21  21  21  ASP ASP A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  ASP 23  23  23  ASP ASP A . n 
A 1 24  VAL 24  24  24  VAL VAL A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  ILE 26  26  26  ILE ILE A . n 
A 1 27  GLU 27  27  27  GLU GLU A . n 
A 1 28  HIS 28  28  28  HIS HIS A . n 
A 1 29  LYS 29  29  29  LYS LYS A . n 
A 1 30  HIS 30  30  30  HIS HIS A . n 
A 1 31  GLU 31  31  31  GLU GLU A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  VAL 33  33  33  VAL VAL A . n 
A 1 34  PHE 34  34  34  PHE PHE A . n 
A 1 35  SER 35  35  35  SER SER A . n 
A 1 36  MET 36  36  36  MET MET A . n 
A 1 37  ASP 37  37  37  ASP ASP A . n 
A 1 38  ASP 38  38  38  ASP ASP A . n 
A 1 39  PHE 39  39  39  PHE PHE A . n 
A 1 40  TRP 40  40  40  TRP TRP A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  ALA 42  42  42  ALA ALA A . n 
A 1 43  TYR 43  43  43  TYR TYR A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  GLY 45  45  45  GLY GLY A . n 
A 1 46  TRP 46  46  46  TRP TRP A . n 
A 1 47  THR 47  47  47  THR THR A . n 
A 1 48  LEU 48  48  48  LEU LEU A . n 
A 1 49  VAL 49  49  49  VAL VAL A . n 
A 1 50  GLU 50  50  50  GLU GLU A . n 
A 1 51  GLN 51  51  51  GLN GLN A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  GLY 54  54  54  GLY GLY A . n 
A 1 55  TYR 55  55  55  TYR TYR A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  LEU 57  57  57  LEU LEU A . n 
A 1 58  PHE 58  58  58  PHE PHE A . n 
A 1 59  ARG 59  59  59  ARG ARG A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  GLN 61  61  61  GLN GLN A . n 
A 1 62  MET 62  62  62  MET MET A . n 
A 1 63  ASP 63  63  63  ASP ASP A . n 
A 1 64  ASP 64  64  64  ASP ASP A . n 
A 1 65  ILE 65  65  65  ILE ILE A . n 
A 1 66  SER 66  66  66  SER SER A . n 
A 1 67  PRO 67  67  67  PRO PRO A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  SER 69  69  69  SER SER A . n 
A 1 70  LYS 70  70  70  LYS LYS A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASN 72  72  72  ASN ASN A . n 
A 1 73  GLY 73  73  73  GLY GLY A . n 
A 1 74  TYR 74  74  74  TYR TYR A . n 
A 1 75  ILE 75  75  75  ILE ILE A . n 
A 1 76  GLY 76  76  76  GLY GLY A . n 
A 1 77  VAL 77  77  77  VAL VAL A . n 
A 1 78  SER 78  78  78  SER SER A . n 
A 1 79  ASP 79  79  79  ASP ASP A . n 
A 1 80  ASN 80  80  80  ASN ASN A . n 
A 1 81  GLY 81  81  81  GLY GLY A . n 
A 1 82  VAL 82  82  82  VAL VAL A . n 
A 1 83  ILE 83  83  83  ILE ILE A . n 
A 1 84  SER 84  84  84  SER SER A . n 
A 1 85  THR 85  85  85  THR THR A . n 
A 1 86  PHE 86  86  86  PHE PHE A . n 
A 1 87  HIS 87  87  87  HIS HIS A . n 
A 1 88  GLY 88  88  88  GLY GLY A . n 
A 1 89  ARG 89  89  89  ARG ARG A . n 
A 1 90  PRO 90  90  90  PRO PRO A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  PRO 92  92  92  PRO PRO A . n 
A 1 93  ALA 93  93  93  ALA ALA A . n 
A 1 94  SER 94  94  94  SER SER A . n 
A 1 95  GLU 95  95  95  GLU GLU A . n 
A 1 96  PRO 96  96  96  PRO PRO A . n 
A 1 97  ILE 97  97  97  ILE ILE A . n 
A 1 98  GLN 98  98  98  GLN GLN A . n 
A 1 99  SER 99  99  99  SER SER A . n 
A 1 100 PHE 100 100 100 PHE PHE A . n 
A 1 101 PHE 101 101 101 PHE PHE A . n 
A 1 102 GLN 102 102 102 GLN GLN A . n 
A 1 103 ILE 103 103 103 ILE ILE A . n 
A 1 104 ASP 104 104 104 ASP ASP A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 GLU 106 106 106 GLU GLU A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 GLU 109 109 109 GLU GLU A . n 
A 1 110 SER 110 110 110 SER SER A . n 
A 1 111 HIS 111 111 111 HIS HIS A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 GLN 113 113 113 GLN GLN A . n 
A 1 114 LYS 114 114 114 LYS LYS A . n 
A 1 115 ASN 115 115 115 ASN ASN A . n 
A 1 116 LEU 116 116 116 LEU LEU A . n 
A 1 117 LEU 117 117 117 LEU LEU A . n 
A 1 118 LYS 118 118 118 LYS LYS A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 ILE 120 120 120 ILE ILE A . n 
A 1 121 PRO 121 121 121 PRO PRO A . n 
A 1 122 PHE 122 122 122 PHE PHE A . n 
A 1 123 ARG 123 123 123 ARG ARG A . n 
A 1 124 THR 124 124 124 THR THR A . n 
A 1 125 LYS 125 125 125 LYS LYS A . n 
A 1 126 ALA 126 126 126 ALA ALA A . n 
A 1 127 GLU 127 127 127 GLU GLU A . n 
A 1 128 PHE 128 128 128 PHE PHE A . n 
A 1 129 GLU 129 129 129 GLU GLU A . n 
A 1 130 ASP 130 130 130 ASP ASP A . n 
A 1 131 VAL 131 131 131 VAL VAL A . n 
A 1 132 ILE 132 132 132 ILE ILE A . n 
A 1 133 GLU 133 133 133 GLU GLU A . n 
A 1 134 HIS 134 134 134 HIS HIS A . n 
A 1 135 MET 135 135 135 MET MET A . n 
A 1 136 LYS 136 136 136 LYS LYS A . n 
A 1 137 THR 137 137 137 THR THR A . n 
A 1 138 TYR 138 138 138 TYR TYR A . n 
A 1 139 SER 139 139 139 SER SER A . n 
A 1 140 GLY 140 140 140 GLY GLY A . n 
# 
_cell.entry_id           2BW2 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2BW2 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_exptl.entry_id          2BW2 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_database_PDB_matrix.entry_id          2BW2 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  2BW2 
_struct.title                     'BofC from Bacillus subtilis' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2BW2 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'SPORULATION, SIGNALING PROTEIN, BOFC, SIGMAK CHECKPOINT' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    BOFC_BACSU 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          O05391 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2BW2 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 140 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O05391 
_struct_ref_seq.db_align_beg                  31 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  170 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       140 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 MET A 36  ? TYR A 43  ? MET A 36  TYR A 43  1 ? 8  
HELX_P HELX_P2 2 PRO A 67  ? VAL A 71  ? PRO A 67  VAL A 71  5 ? 5  
HELX_P HELX_P3 3 GLU A 109 ? GLY A 119 ? GLU A 109 GLY A 119 1 ? 11 
HELX_P HELX_P4 4 THR A 124 ? SER A 139 ? THR A 124 SER A 139 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 4 ? 
AB ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? parallel      
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 VAL A 24 ? SER A 35 ? VAL A 24 SER A 35 
AA 2 GLU A 4  ? VAL A 18 ? GLU A 4  VAL A 18 
AA 3 TYR A 55 ? GLN A 61 ? TYR A 55 GLN A 61 
AA 4 THR A 47 ? LYS A 52 ? THR A 47 LYS A 52 
AB 1 ILE A 75 ? SER A 78 ? ILE A 75 SER A 78 
AB 2 VAL A 82 ? THR A 85 ? VAL A 82 THR A 85 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 O PHE A 34 ? O PHE A 34 N HIS A 5  ? N HIS A 5  
AA 2 3 N GLN A 14 ? N GLN A 14 O VAL A 56 ? O VAL A 56 
AA 3 4 N ARG A 59 ? N ARG A 59 O THR A 47 ? O THR A 47 
AB 1 2 O SER A 78 ? O SER A 78 N VAL A 82 ? N VAL A 82 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1  OE2 A GLU 31  ? ? HH  A TYR 43  ? ? 1.59 
2  3  OE1 A GLU 2   ? ? HZ2 A LYS 53  ? ? 1.56 
3  4  HG1 A THR 124 ? ? OE1 A GLU 127 ? ? 1.59 
4  8  OE1 A GLU 31  ? ? HH  A TYR 43  ? ? 1.57 
5  8  OE2 A GLU 4   ? ? HG  A SER 35  ? ? 1.58 
6  10 OE2 A GLU 31  ? ? HH  A TYR 43  ? ? 1.58 
7  11 OE2 A GLU 31  ? ? HH  A TYR 43  ? ? 1.58 
8  13 OE1 A GLU 31  ? ? HH  A TYR 43  ? ? 1.60 
9  14 HZ1 A LYS 125 ? ? OE2 A GLU 129 ? ? 1.58 
10 17 OE1 A GLU 31  ? ? HH  A TYR 43  ? ? 1.60 
11 21 OD2 A ASP 64  ? ? HZ1 A LYS 125 ? ? 1.60 
12 23 OE1 A GLU 4   ? ? HZ2 A LYS 53  ? ? 1.56 
13 23 OE2 A GLU 31  ? ? HH  A TYR 43  ? ? 1.57 
14 24 OE2 A GLU 31  ? ? HH  A TYR 43  ? ? 1.58 
15 25 HZ1 A LYS 125 ? ? OE2 A GLU 129 ? ? 1.58 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              12 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             VAL 
_pdbx_validate_rmsd_angle.auth_seq_id_1              56 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             VAL 
_pdbx_validate_rmsd_angle.auth_seq_id_2              56 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CG2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             VAL 
_pdbx_validate_rmsd_angle.auth_seq_id_3              56 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                122.21 
_pdbx_validate_rmsd_angle.angle_target_value         110.90 
_pdbx_validate_rmsd_angle.angle_deviation            11.31 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  SER A 66  ? ? 102.95  153.59  
2   1  ASN A 72  ? ? -92.61  -84.38  
3   1  ILE A 83  ? ? -80.96  37.16   
4   1  PHE A 122 ? ? -172.98 147.31  
5   1  SER A 139 ? ? 55.40   17.03   
6   2  SER A 66  ? ? 160.31  161.13  
7   2  ASN A 72  ? ? -157.91 37.50   
8   2  ILE A 83  ? ? -80.62  36.89   
9   2  PHE A 100 ? ? -89.81  -74.29  
10  2  SER A 110 ? ? 174.31  -64.41  
11  2  TYR A 138 ? ? -93.24  -61.65  
12  3  GLU A 4   ? ? -61.20  98.91   
13  3  HIS A 5   ? ? -106.04 -164.03 
14  3  LYS A 53  ? ? 39.13   -76.64  
15  3  ILE A 83  ? ? -80.25  36.26   
16  3  PHE A 100 ? ? -69.63  -71.91  
17  3  GLU A 109 ? ? -65.61  -72.80  
18  3  SER A 110 ? ? -162.46 -64.09  
19  3  PHE A 122 ? ? -174.41 143.40  
20  4  ASP A 64  ? ? -119.86 -91.42  
21  4  ASN A 72  ? ? -98.79  -81.51  
22  4  TYR A 74  ? ? -160.05 107.91  
23  4  ILE A 83  ? ? -81.02  38.79   
24  4  PRO A 90  ? ? -64.91  99.49   
25  4  GLN A 98  ? ? -160.07 -168.73 
26  4  PHE A 100 ? ? -83.46  -70.85  
27  5  HIS A 5   ? ? 68.99   -163.39 
28  5  LYS A 53  ? ? -67.01  94.98   
29  5  ASN A 72  ? ? -79.27  -72.60  
30  5  ILE A 83  ? ? -80.42  36.28   
31  5  GLN A 98  ? ? -162.52 -160.67 
32  5  PHE A 100 ? ? -108.74 -73.16  
33  5  GLU A 109 ? ? -64.41  -73.16  
34  5  SER A 110 ? ? -162.92 -80.97  
35  5  PHE A 122 ? ? -175.07 141.38  
36  5  SER A 139 ? ? 49.86   17.13   
37  6  PRO A 8   ? ? -73.70  -168.97 
38  6  SER A 66  ? ? 141.98  145.55  
39  6  ASN A 72  ? ? -151.58 75.56   
40  6  ILE A 83  ? ? -81.43  37.92   
41  7  HIS A 5   ? ? 76.28   -171.12 
42  7  LYS A 53  ? ? -68.14  98.77   
43  7  ASN A 72  ? ? -85.79  -73.91  
44  7  ILE A 83  ? ? -81.68  36.49   
45  7  PHE A 100 ? ? -97.11  -91.71  
46  7  GLU A 109 ? ? -59.86  -75.26  
47  7  SER A 110 ? ? -172.81 -69.12  
48  7  PHE A 122 ? ? -178.65 139.34  
49  7  SER A 139 ? ? 55.05   7.89    
50  8  LYS A 53  ? ? -68.84  97.80   
51  8  SER A 66  ? ? 79.78   156.07  
52  8  ASN A 72  ? ? -152.93 26.26   
53  8  ILE A 83  ? ? -81.30  36.02   
54  8  PHE A 100 ? ? -94.01  -73.30  
55  8  SER A 110 ? ? 33.72   -79.04  
56  8  PRO A 121 ? ? -69.09  19.35   
57  8  PHE A 122 ? ? 68.29   163.15  
58  8  SER A 139 ? ? 50.51   16.84   
59  9  VAL A 3   ? ? 61.93   -175.86 
60  9  SER A 66  ? ? 88.01   158.43  
61  9  ILE A 83  ? ? -80.17  38.80   
62  9  PHE A 100 ? ? -78.66  -71.61  
63  9  GLU A 109 ? ? -53.42  -72.62  
64  9  SER A 110 ? ? -160.22 -74.41  
65  9  PRO A 121 ? ? -67.01  10.20   
66  9  PHE A 122 ? ? -171.45 147.84  
67  9  TYR A 138 ? ? -95.31  -61.41  
68  9  SER A 139 ? ? 51.01   19.49   
69  10 LYS A 53  ? ? -63.97  98.36   
70  10 ILE A 83  ? ? -82.18  36.54   
71  10 PHE A 100 ? ? -102.09 -73.29  
72  10 GLU A 109 ? ? -66.85  -87.27  
73  10 SER A 110 ? ? -157.60 -78.47  
74  10 PRO A 121 ? ? -70.21  27.75   
75  10 PHE A 122 ? ? 64.37   169.92  
76  10 SER A 139 ? ? 55.65   14.70   
77  11 PRO A 8   ? ? -53.00  173.45  
78  11 ASN A 72  ? ? -132.61 -78.42  
79  11 ILE A 83  ? ? -82.42  35.30   
80  11 PHE A 100 ? ? -103.16 -65.05  
81  11 GLU A 109 ? ? -54.66  -75.47  
82  11 SER A 110 ? ? -159.29 -86.40  
83  11 ILE A 120 ? ? 78.30   150.08  
84  11 PRO A 121 ? ? -76.45  27.00   
85  11 PHE A 122 ? ? 68.88   -168.32 
86  11 SER A 139 ? ? 53.98   11.46   
87  12 ASP A 63  ? ? -82.37  48.51   
88  12 SER A 66  ? ? 145.71  149.20  
89  12 ASN A 72  ? ? -102.18 -79.54  
90  12 ILE A 83  ? ? -82.04  36.56   
91  12 PRO A 90  ? ? -67.38  99.22   
92  12 GLN A 98  ? ? -163.67 -168.15 
93  12 SER A 110 ? ? 155.94  -61.54  
94  12 PHE A 122 ? ? -174.61 143.66  
95  12 SER A 139 ? ? 50.55   19.60   
96  13 LYS A 53  ? ? -61.16  98.13   
97  13 ILE A 83  ? ? -82.07  37.79   
98  13 PHE A 100 ? ? -83.50  -70.18  
99  13 SER A 110 ? ? 72.84   -163.30 
100 13 TYR A 138 ? ? -95.36  -62.68  
101 13 SER A 139 ? ? 51.68   18.55   
102 14 GLU A 2   ? ? 69.67   -172.41 
103 14 LYS A 53  ? ? 53.19   -80.65  
104 14 SER A 66  ? ? 167.12  167.85  
105 14 ASN A 72  ? ? -106.15 -79.89  
106 14 ILE A 83  ? ? -81.29  37.48   
107 14 GLN A 98  ? ? -168.08 -167.74 
108 14 SER A 110 ? ? 32.44   -87.28  
109 15 GLU A 2   ? ? 66.40   162.33  
110 15 ASN A 72  ? ? -120.65 -75.63  
111 15 ILE A 83  ? ? -82.48  35.51   
112 15 GLU A 109 ? ? -57.70  -74.29  
113 15 SER A 110 ? ? -170.24 -75.27  
114 15 SER A 139 ? ? -69.06  25.65   
115 16 VAL A 3   ? ? 55.36   115.97  
116 16 HIS A 5   ? ? 68.09   -164.87 
117 16 LYS A 53  ? ? 57.79   -79.21  
118 16 ILE A 83  ? ? -80.41  38.35   
119 16 PRO A 90  ? ? -58.13  98.34   
120 16 PHE A 100 ? ? -78.46  -75.82  
121 16 SER A 110 ? ? -167.68 -78.84  
122 16 SER A 139 ? ? 51.46   15.90   
123 17 HIS A 5   ? ? -129.97 -169.33 
124 17 ALA A 44  ? ? -64.42  86.23   
125 17 LYS A 53  ? ? 53.43   -79.59  
126 17 MET A 62  ? ? -150.42 79.65   
127 17 ASP A 64  ? ? -94.44  -101.49 
128 17 ASN A 72  ? ? -168.78 37.57   
129 17 ILE A 83  ? ? -80.72  39.35   
130 17 SER A 110 ? ? -158.41 -83.26  
131 17 PRO A 121 ? ? -71.60  40.22   
132 17 PHE A 122 ? ? 77.32   137.75  
133 17 TYR A 138 ? ? -96.32  -66.62  
134 18 LYS A 53  ? ? 43.47   -81.33  
135 18 ASN A 72  ? ? -153.25 73.23   
136 18 ILE A 83  ? ? -81.47  38.35   
137 18 PHE A 100 ? ? -92.56  -82.27  
138 18 GLU A 109 ? ? -63.79  -75.61  
139 18 SER A 110 ? ? -163.90 -76.81  
140 19 VAL A 3   ? ? 69.71   -179.21 
141 19 MET A 62  ? ? -152.73 82.78   
142 19 ASP A 63  ? ? 179.60  -165.57 
143 19 ASP A 64  ? ? -107.10 -100.99 
144 19 ASN A 72  ? ? -93.76  -65.04  
145 19 ILE A 83  ? ? -82.23  35.75   
146 19 PHE A 100 ? ? -93.42  -71.58  
147 19 SER A 110 ? ? -166.08 -71.21  
148 19 SER A 139 ? ? 47.21   27.35   
149 20 LYS A 53  ? ? 38.85   -85.67  
150 20 ASP A 63  ? ? 66.04   -82.72  
151 20 ASP A 64  ? ? -176.34 -101.22 
152 20 ASN A 72  ? ? -85.85  -72.09  
153 20 ILE A 83  ? ? -80.21  36.33   
154 20 PHE A 100 ? ? -101.30 -75.82  
155 20 SER A 110 ? ? 87.70   -78.97  
156 20 TYR A 138 ? ? -93.65  -63.81  
157 20 SER A 139 ? ? 46.97   29.05   
158 21 ASN A 72  ? ? -96.90  -77.96  
159 21 ILE A 83  ? ? -80.84  36.57   
160 21 PRO A 90  ? ? -69.07  91.27   
161 21 PHE A 100 ? ? -101.51 -80.25  
162 21 GLU A 109 ? ? -63.74  -80.54  
163 21 SER A 110 ? ? -155.17 -85.73  
164 21 PHE A 122 ? ? -175.90 147.24  
165 21 TYR A 138 ? ? -93.23  -61.50  
166 22 ASP A 63  ? ? 67.74   89.09   
167 22 ASP A 64  ? ? 173.33  171.71  
168 22 ASN A 72  ? ? -83.11  -71.36  
169 22 ILE A 83  ? ? -81.94  36.52   
170 22 GLU A 109 ? ? -70.87  -84.51  
171 22 SER A 110 ? ? -154.43 -76.01  
172 22 PHE A 122 ? ? -175.07 147.03  
173 22 TYR A 138 ? ? -93.65  -62.27  
174 22 SER A 139 ? ? 52.08   19.42   
175 23 HIS A 5   ? ? 60.20   -167.84 
176 23 ILE A 83  ? ? -80.68  38.18   
177 23 PHE A 100 ? ? -78.80  -72.79  
178 23 PRO A 121 ? ? -67.72  23.96   
179 23 PHE A 122 ? ? 63.96   171.32  
180 23 TYR A 138 ? ? -90.99  -74.50  
181 23 SER A 139 ? ? 42.52   25.32   
182 24 LYS A 53  ? ? -58.71  104.10  
183 24 ASP A 64  ? ? 177.07  168.76  
184 24 ASN A 72  ? ? -89.47  -75.07  
185 24 ILE A 83  ? ? -82.09  39.00   
186 24 SER A 110 ? ? 43.71   -88.60  
187 24 SER A 139 ? ? 47.33   23.20   
188 25 VAL A 3   ? ? 59.90   158.99  
189 25 HIS A 5   ? ? -100.33 -160.02 
190 25 ALA A 44  ? ? -68.47  75.89   
191 25 LYS A 53  ? ? 56.39   -85.06  
192 25 ASP A 63  ? ? -84.14  49.52   
193 25 SER A 66  ? ? 68.99   160.73  
194 25 ASN A 72  ? ? -100.88 -76.39  
195 25 ILE A 83  ? ? -82.30  38.20   
196 25 GLU A 109 ? ? -53.36  -75.17  
197 25 SER A 110 ? ? -161.24 -73.33  
198 25 PHE A 122 ? ? 179.55  146.55  
199 25 TYR A 138 ? ? -92.00  -61.27  
200 25 SER A 139 ? ? 53.49   17.80   
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 2  ARG A 123 ? ? 0.086 'SIDE CHAIN' 
2 5  ARG A 123 ? ? 0.075 'SIDE CHAIN' 
3 11 ARG A 107 ? ? 0.071 'SIDE CHAIN' 
4 12 ARG A 107 ? ? 0.072 'SIDE CHAIN' 
5 16 ARG A 107 ? ? 0.074 'SIDE CHAIN' 
6 19 ARG A 107 ? ? 0.084 'SIDE CHAIN' 
7 20 ARG A 123 ? ? 0.119 'SIDE CHAIN' 
# 
_pdbx_entry_details.entry_id                 2BW2 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         
;THE PROTEIN PRECURSOR FOR BOFC HAS 170 RESIDUES. THE NMR
STRUCTURE IS FOR MATURE BOFC, WITH THE N-TERMINAL 30
RESIDUE TRANSLOCATION SEQUENCE CLEAVED. THE NMR STRUCTURE
REFERS TO RESIDUE NUMBERS FOR THE MATURE PROTEIN, IE
RESIDUES A1-G140 (NOT A31-G170)
;
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
_pdbx_nmr_ensemble.entry_id                             2BW2 
_pdbx_nmr_ensemble.conformers_calculated_total_number   100 
_pdbx_nmr_ensemble.conformers_submitted_total_number    25 
_pdbx_nmr_ensemble.conformer_selection_criteria         ENERGY 
# 
_pdbx_nmr_representative.entry_id             2BW2 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   ? 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '95% WATER/5% D20' 
_pdbx_nmr_sample_details.solvent_system   ? 
_pdbx_nmr_sample_details.label            ? 
_pdbx_nmr_sample_details.type             ? 
_pdbx_nmr_sample_details.details          ? 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            298.0 
_pdbx_nmr_exptl_sample_conditions.pressure_units         ? 
_pdbx_nmr_exptl_sample_conditions.pressure               ? 
_pdbx_nmr_exptl_sample_conditions.pH                     6.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         20 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   mM 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
_pdbx_nmr_exptl_sample_conditions.label                  ? 
# 
_pdbx_nmr_details.entry_id   2BW2 
_pdbx_nmr_details.text       'THE STRUCTURE WAS DETERMINED USING TRIPLE-RESONANCE NMR SPECTROSCOPY ON 13C, 15N-LABELED BOFC.' 
# 
_pdbx_nmr_refine.entry_id           2BW2 
_pdbx_nmr_refine.method             'CANDID AND CNS' 
_pdbx_nmr_refine.details            'REFINEMENT DETAILS CAN BE FOUND IN THE JRNL CITATION ABOVE.' 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           CNS    ? 
'BRUNGER,ADAMS,CLORE,DELANO,GROS, GROSSE- KUNSTLEVE,JIANG,KUSZEWSKI,NILGES, PANNU,READ, RICE,SIMONSON,WARREN' 1 
'structure solution' Sparky ? ? 2 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
GLN N    N N N 74  
GLN CA   C N S 75  
GLN C    C N N 76  
GLN O    O N N 77  
GLN CB   C N N 78  
GLN CG   C N N 79  
GLN CD   C N N 80  
GLN OE1  O N N 81  
GLN NE2  N N N 82  
GLN OXT  O N N 83  
GLN H    H N N 84  
GLN H2   H N N 85  
GLN HA   H N N 86  
GLN HB2  H N N 87  
GLN HB3  H N N 88  
GLN HG2  H N N 89  
GLN HG3  H N N 90  
GLN HE21 H N N 91  
GLN HE22 H N N 92  
GLN HXT  H N N 93  
GLU N    N N N 94  
GLU CA   C N S 95  
GLU C    C N N 96  
GLU O    O N N 97  
GLU CB   C N N 98  
GLU CG   C N N 99  
GLU CD   C N N 100 
GLU OE1  O N N 101 
GLU OE2  O N N 102 
GLU OXT  O N N 103 
GLU H    H N N 104 
GLU H2   H N N 105 
GLU HA   H N N 106 
GLU HB2  H N N 107 
GLU HB3  H N N 108 
GLU HG2  H N N 109 
GLU HG3  H N N 110 
GLU HE2  H N N 111 
GLU HXT  H N N 112 
GLY N    N N N 113 
GLY CA   C N N 114 
GLY C    C N N 115 
GLY O    O N N 116 
GLY OXT  O N N 117 
GLY H    H N N 118 
GLY H2   H N N 119 
GLY HA2  H N N 120 
GLY HA3  H N N 121 
GLY HXT  H N N 122 
HIS N    N N N 123 
HIS CA   C N S 124 
HIS C    C N N 125 
HIS O    O N N 126 
HIS CB   C N N 127 
HIS CG   C Y N 128 
HIS ND1  N Y N 129 
HIS CD2  C Y N 130 
HIS CE1  C Y N 131 
HIS NE2  N Y N 132 
HIS OXT  O N N 133 
HIS H    H N N 134 
HIS H2   H N N 135 
HIS HA   H N N 136 
HIS HB2  H N N 137 
HIS HB3  H N N 138 
HIS HD1  H N N 139 
HIS HD2  H N N 140 
HIS HE1  H N N 141 
HIS HE2  H N N 142 
HIS HXT  H N N 143 
ILE N    N N N 144 
ILE CA   C N S 145 
ILE C    C N N 146 
ILE O    O N N 147 
ILE CB   C N S 148 
ILE CG1  C N N 149 
ILE CG2  C N N 150 
ILE CD1  C N N 151 
ILE OXT  O N N 152 
ILE H    H N N 153 
ILE H2   H N N 154 
ILE HA   H N N 155 
ILE HB   H N N 156 
ILE HG12 H N N 157 
ILE HG13 H N N 158 
ILE HG21 H N N 159 
ILE HG22 H N N 160 
ILE HG23 H N N 161 
ILE HD11 H N N 162 
ILE HD12 H N N 163 
ILE HD13 H N N 164 
ILE HXT  H N N 165 
LEU N    N N N 166 
LEU CA   C N S 167 
LEU C    C N N 168 
LEU O    O N N 169 
LEU CB   C N N 170 
LEU CG   C N N 171 
LEU CD1  C N N 172 
LEU CD2  C N N 173 
LEU OXT  O N N 174 
LEU H    H N N 175 
LEU H2   H N N 176 
LEU HA   H N N 177 
LEU HB2  H N N 178 
LEU HB3  H N N 179 
LEU HG   H N N 180 
LEU HD11 H N N 181 
LEU HD12 H N N 182 
LEU HD13 H N N 183 
LEU HD21 H N N 184 
LEU HD22 H N N 185 
LEU HD23 H N N 186 
LEU HXT  H N N 187 
LYS N    N N N 188 
LYS CA   C N S 189 
LYS C    C N N 190 
LYS O    O N N 191 
LYS CB   C N N 192 
LYS CG   C N N 193 
LYS CD   C N N 194 
LYS CE   C N N 195 
LYS NZ   N N N 196 
LYS OXT  O N N 197 
LYS H    H N N 198 
LYS H2   H N N 199 
LYS HA   H N N 200 
LYS HB2  H N N 201 
LYS HB3  H N N 202 
LYS HG2  H N N 203 
LYS HG3  H N N 204 
LYS HD2  H N N 205 
LYS HD3  H N N 206 
LYS HE2  H N N 207 
LYS HE3  H N N 208 
LYS HZ1  H N N 209 
LYS HZ2  H N N 210 
LYS HZ3  H N N 211 
LYS HXT  H N N 212 
MET N    N N N 213 
MET CA   C N S 214 
MET C    C N N 215 
MET O    O N N 216 
MET CB   C N N 217 
MET CG   C N N 218 
MET SD   S N N 219 
MET CE   C N N 220 
MET OXT  O N N 221 
MET H    H N N 222 
MET H2   H N N 223 
MET HA   H N N 224 
MET HB2  H N N 225 
MET HB3  H N N 226 
MET HG2  H N N 227 
MET HG3  H N N 228 
MET HE1  H N N 229 
MET HE2  H N N 230 
MET HE3  H N N 231 
MET HXT  H N N 232 
PHE N    N N N 233 
PHE CA   C N S 234 
PHE C    C N N 235 
PHE O    O N N 236 
PHE CB   C N N 237 
PHE CG   C Y N 238 
PHE CD1  C Y N 239 
PHE CD2  C Y N 240 
PHE CE1  C Y N 241 
PHE CE2  C Y N 242 
PHE CZ   C Y N 243 
PHE OXT  O N N 244 
PHE H    H N N 245 
PHE H2   H N N 246 
PHE HA   H N N 247 
PHE HB2  H N N 248 
PHE HB3  H N N 249 
PHE HD1  H N N 250 
PHE HD2  H N N 251 
PHE HE1  H N N 252 
PHE HE2  H N N 253 
PHE HZ   H N N 254 
PHE HXT  H N N 255 
PRO N    N N N 256 
PRO CA   C N S 257 
PRO C    C N N 258 
PRO O    O N N 259 
PRO CB   C N N 260 
PRO CG   C N N 261 
PRO CD   C N N 262 
PRO OXT  O N N 263 
PRO H    H N N 264 
PRO HA   H N N 265 
PRO HB2  H N N 266 
PRO HB3  H N N 267 
PRO HG2  H N N 268 
PRO HG3  H N N 269 
PRO HD2  H N N 270 
PRO HD3  H N N 271 
PRO HXT  H N N 272 
SER N    N N N 273 
SER CA   C N S 274 
SER C    C N N 275 
SER O    O N N 276 
SER CB   C N N 277 
SER OG   O N N 278 
SER OXT  O N N 279 
SER H    H N N 280 
SER H2   H N N 281 
SER HA   H N N 282 
SER HB2  H N N 283 
SER HB3  H N N 284 
SER HG   H N N 285 
SER HXT  H N N 286 
THR N    N N N 287 
THR CA   C N S 288 
THR C    C N N 289 
THR O    O N N 290 
THR CB   C N R 291 
THR OG1  O N N 292 
THR CG2  C N N 293 
THR OXT  O N N 294 
THR H    H N N 295 
THR H2   H N N 296 
THR HA   H N N 297 
THR HB   H N N 298 
THR HG1  H N N 299 
THR HG21 H N N 300 
THR HG22 H N N 301 
THR HG23 H N N 302 
THR HXT  H N N 303 
TRP N    N N N 304 
TRP CA   C N S 305 
TRP C    C N N 306 
TRP O    O N N 307 
TRP CB   C N N 308 
TRP CG   C Y N 309 
TRP CD1  C Y N 310 
TRP CD2  C Y N 311 
TRP NE1  N Y N 312 
TRP CE2  C Y N 313 
TRP CE3  C Y N 314 
TRP CZ2  C Y N 315 
TRP CZ3  C Y N 316 
TRP CH2  C Y N 317 
TRP OXT  O N N 318 
TRP H    H N N 319 
TRP H2   H N N 320 
TRP HA   H N N 321 
TRP HB2  H N N 322 
TRP HB3  H N N 323 
TRP HD1  H N N 324 
TRP HE1  H N N 325 
TRP HE3  H N N 326 
TRP HZ2  H N N 327 
TRP HZ3  H N N 328 
TRP HH2  H N N 329 
TRP HXT  H N N 330 
TYR N    N N N 331 
TYR CA   C N S 332 
TYR C    C N N 333 
TYR O    O N N 334 
TYR CB   C N N 335 
TYR CG   C Y N 336 
TYR CD1  C Y N 337 
TYR CD2  C Y N 338 
TYR CE1  C Y N 339 
TYR CE2  C Y N 340 
TYR CZ   C Y N 341 
TYR OH   O N N 342 
TYR OXT  O N N 343 
TYR H    H N N 344 
TYR H2   H N N 345 
TYR HA   H N N 346 
TYR HB2  H N N 347 
TYR HB3  H N N 348 
TYR HD1  H N N 349 
TYR HD2  H N N 350 
TYR HE1  H N N 351 
TYR HE2  H N N 352 
TYR HH   H N N 353 
TYR HXT  H N N 354 
VAL N    N N N 355 
VAL CA   C N S 356 
VAL C    C N N 357 
VAL O    O N N 358 
VAL CB   C N N 359 
VAL CG1  C N N 360 
VAL CG2  C N N 361 
VAL OXT  O N N 362 
VAL H    H N N 363 
VAL H2   H N N 364 
VAL HA   H N N 365 
VAL HB   H N N 366 
VAL HG11 H N N 367 
VAL HG12 H N N 368 
VAL HG13 H N N 369 
VAL HG21 H N N 370 
VAL HG22 H N N 371 
VAL HG23 H N N 372 
VAL HXT  H N N 373 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
GLN N   CA   sing N N 70  
GLN N   H    sing N N 71  
GLN N   H2   sing N N 72  
GLN CA  C    sing N N 73  
GLN CA  CB   sing N N 74  
GLN CA  HA   sing N N 75  
GLN C   O    doub N N 76  
GLN C   OXT  sing N N 77  
GLN CB  CG   sing N N 78  
GLN CB  HB2  sing N N 79  
GLN CB  HB3  sing N N 80  
GLN CG  CD   sing N N 81  
GLN CG  HG2  sing N N 82  
GLN CG  HG3  sing N N 83  
GLN CD  OE1  doub N N 84  
GLN CD  NE2  sing N N 85  
GLN NE2 HE21 sing N N 86  
GLN NE2 HE22 sing N N 87  
GLN OXT HXT  sing N N 88  
GLU N   CA   sing N N 89  
GLU N   H    sing N N 90  
GLU N   H2   sing N N 91  
GLU CA  C    sing N N 92  
GLU CA  CB   sing N N 93  
GLU CA  HA   sing N N 94  
GLU C   O    doub N N 95  
GLU C   OXT  sing N N 96  
GLU CB  CG   sing N N 97  
GLU CB  HB2  sing N N 98  
GLU CB  HB3  sing N N 99  
GLU CG  CD   sing N N 100 
GLU CG  HG2  sing N N 101 
GLU CG  HG3  sing N N 102 
GLU CD  OE1  doub N N 103 
GLU CD  OE2  sing N N 104 
GLU OE2 HE2  sing N N 105 
GLU OXT HXT  sing N N 106 
GLY N   CA   sing N N 107 
GLY N   H    sing N N 108 
GLY N   H2   sing N N 109 
GLY CA  C    sing N N 110 
GLY CA  HA2  sing N N 111 
GLY CA  HA3  sing N N 112 
GLY C   O    doub N N 113 
GLY C   OXT  sing N N 114 
GLY OXT HXT  sing N N 115 
HIS N   CA   sing N N 116 
HIS N   H    sing N N 117 
HIS N   H2   sing N N 118 
HIS CA  C    sing N N 119 
HIS CA  CB   sing N N 120 
HIS CA  HA   sing N N 121 
HIS C   O    doub N N 122 
HIS C   OXT  sing N N 123 
HIS CB  CG   sing N N 124 
HIS CB  HB2  sing N N 125 
HIS CB  HB3  sing N N 126 
HIS CG  ND1  sing Y N 127 
HIS CG  CD2  doub Y N 128 
HIS ND1 CE1  doub Y N 129 
HIS ND1 HD1  sing N N 130 
HIS CD2 NE2  sing Y N 131 
HIS CD2 HD2  sing N N 132 
HIS CE1 NE2  sing Y N 133 
HIS CE1 HE1  sing N N 134 
HIS NE2 HE2  sing N N 135 
HIS OXT HXT  sing N N 136 
ILE N   CA   sing N N 137 
ILE N   H    sing N N 138 
ILE N   H2   sing N N 139 
ILE CA  C    sing N N 140 
ILE CA  CB   sing N N 141 
ILE CA  HA   sing N N 142 
ILE C   O    doub N N 143 
ILE C   OXT  sing N N 144 
ILE CB  CG1  sing N N 145 
ILE CB  CG2  sing N N 146 
ILE CB  HB   sing N N 147 
ILE CG1 CD1  sing N N 148 
ILE CG1 HG12 sing N N 149 
ILE CG1 HG13 sing N N 150 
ILE CG2 HG21 sing N N 151 
ILE CG2 HG22 sing N N 152 
ILE CG2 HG23 sing N N 153 
ILE CD1 HD11 sing N N 154 
ILE CD1 HD12 sing N N 155 
ILE CD1 HD13 sing N N 156 
ILE OXT HXT  sing N N 157 
LEU N   CA   sing N N 158 
LEU N   H    sing N N 159 
LEU N   H2   sing N N 160 
LEU CA  C    sing N N 161 
LEU CA  CB   sing N N 162 
LEU CA  HA   sing N N 163 
LEU C   O    doub N N 164 
LEU C   OXT  sing N N 165 
LEU CB  CG   sing N N 166 
LEU CB  HB2  sing N N 167 
LEU CB  HB3  sing N N 168 
LEU CG  CD1  sing N N 169 
LEU CG  CD2  sing N N 170 
LEU CG  HG   sing N N 171 
LEU CD1 HD11 sing N N 172 
LEU CD1 HD12 sing N N 173 
LEU CD1 HD13 sing N N 174 
LEU CD2 HD21 sing N N 175 
LEU CD2 HD22 sing N N 176 
LEU CD2 HD23 sing N N 177 
LEU OXT HXT  sing N N 178 
LYS N   CA   sing N N 179 
LYS N   H    sing N N 180 
LYS N   H2   sing N N 181 
LYS CA  C    sing N N 182 
LYS CA  CB   sing N N 183 
LYS CA  HA   sing N N 184 
LYS C   O    doub N N 185 
LYS C   OXT  sing N N 186 
LYS CB  CG   sing N N 187 
LYS CB  HB2  sing N N 188 
LYS CB  HB3  sing N N 189 
LYS CG  CD   sing N N 190 
LYS CG  HG2  sing N N 191 
LYS CG  HG3  sing N N 192 
LYS CD  CE   sing N N 193 
LYS CD  HD2  sing N N 194 
LYS CD  HD3  sing N N 195 
LYS CE  NZ   sing N N 196 
LYS CE  HE2  sing N N 197 
LYS CE  HE3  sing N N 198 
LYS NZ  HZ1  sing N N 199 
LYS NZ  HZ2  sing N N 200 
LYS NZ  HZ3  sing N N 201 
LYS OXT HXT  sing N N 202 
MET N   CA   sing N N 203 
MET N   H    sing N N 204 
MET N   H2   sing N N 205 
MET CA  C    sing N N 206 
MET CA  CB   sing N N 207 
MET CA  HA   sing N N 208 
MET C   O    doub N N 209 
MET C   OXT  sing N N 210 
MET CB  CG   sing N N 211 
MET CB  HB2  sing N N 212 
MET CB  HB3  sing N N 213 
MET CG  SD   sing N N 214 
MET CG  HG2  sing N N 215 
MET CG  HG3  sing N N 216 
MET SD  CE   sing N N 217 
MET CE  HE1  sing N N 218 
MET CE  HE2  sing N N 219 
MET CE  HE3  sing N N 220 
MET OXT HXT  sing N N 221 
PHE N   CA   sing N N 222 
PHE N   H    sing N N 223 
PHE N   H2   sing N N 224 
PHE CA  C    sing N N 225 
PHE CA  CB   sing N N 226 
PHE CA  HA   sing N N 227 
PHE C   O    doub N N 228 
PHE C   OXT  sing N N 229 
PHE CB  CG   sing N N 230 
PHE CB  HB2  sing N N 231 
PHE CB  HB3  sing N N 232 
PHE CG  CD1  doub Y N 233 
PHE CG  CD2  sing Y N 234 
PHE CD1 CE1  sing Y N 235 
PHE CD1 HD1  sing N N 236 
PHE CD2 CE2  doub Y N 237 
PHE CD2 HD2  sing N N 238 
PHE CE1 CZ   doub Y N 239 
PHE CE1 HE1  sing N N 240 
PHE CE2 CZ   sing Y N 241 
PHE CE2 HE2  sing N N 242 
PHE CZ  HZ   sing N N 243 
PHE OXT HXT  sing N N 244 
PRO N   CA   sing N N 245 
PRO N   CD   sing N N 246 
PRO N   H    sing N N 247 
PRO CA  C    sing N N 248 
PRO CA  CB   sing N N 249 
PRO CA  HA   sing N N 250 
PRO C   O    doub N N 251 
PRO C   OXT  sing N N 252 
PRO CB  CG   sing N N 253 
PRO CB  HB2  sing N N 254 
PRO CB  HB3  sing N N 255 
PRO CG  CD   sing N N 256 
PRO CG  HG2  sing N N 257 
PRO CG  HG3  sing N N 258 
PRO CD  HD2  sing N N 259 
PRO CD  HD3  sing N N 260 
PRO OXT HXT  sing N N 261 
SER N   CA   sing N N 262 
SER N   H    sing N N 263 
SER N   H2   sing N N 264 
SER CA  C    sing N N 265 
SER CA  CB   sing N N 266 
SER CA  HA   sing N N 267 
SER C   O    doub N N 268 
SER C   OXT  sing N N 269 
SER CB  OG   sing N N 270 
SER CB  HB2  sing N N 271 
SER CB  HB3  sing N N 272 
SER OG  HG   sing N N 273 
SER OXT HXT  sing N N 274 
THR N   CA   sing N N 275 
THR N   H    sing N N 276 
THR N   H2   sing N N 277 
THR CA  C    sing N N 278 
THR CA  CB   sing N N 279 
THR CA  HA   sing N N 280 
THR C   O    doub N N 281 
THR C   OXT  sing N N 282 
THR CB  OG1  sing N N 283 
THR CB  CG2  sing N N 284 
THR CB  HB   sing N N 285 
THR OG1 HG1  sing N N 286 
THR CG2 HG21 sing N N 287 
THR CG2 HG22 sing N N 288 
THR CG2 HG23 sing N N 289 
THR OXT HXT  sing N N 290 
TRP N   CA   sing N N 291 
TRP N   H    sing N N 292 
TRP N   H2   sing N N 293 
TRP CA  C    sing N N 294 
TRP CA  CB   sing N N 295 
TRP CA  HA   sing N N 296 
TRP C   O    doub N N 297 
TRP C   OXT  sing N N 298 
TRP CB  CG   sing N N 299 
TRP CB  HB2  sing N N 300 
TRP CB  HB3  sing N N 301 
TRP CG  CD1  doub Y N 302 
TRP CG  CD2  sing Y N 303 
TRP CD1 NE1  sing Y N 304 
TRP CD1 HD1  sing N N 305 
TRP CD2 CE2  doub Y N 306 
TRP CD2 CE3  sing Y N 307 
TRP NE1 CE2  sing Y N 308 
TRP NE1 HE1  sing N N 309 
TRP CE2 CZ2  sing Y N 310 
TRP CE3 CZ3  doub Y N 311 
TRP CE3 HE3  sing N N 312 
TRP CZ2 CH2  doub Y N 313 
TRP CZ2 HZ2  sing N N 314 
TRP CZ3 CH2  sing Y N 315 
TRP CZ3 HZ3  sing N N 316 
TRP CH2 HH2  sing N N 317 
TRP OXT HXT  sing N N 318 
TYR N   CA   sing N N 319 
TYR N   H    sing N N 320 
TYR N   H2   sing N N 321 
TYR CA  C    sing N N 322 
TYR CA  CB   sing N N 323 
TYR CA  HA   sing N N 324 
TYR C   O    doub N N 325 
TYR C   OXT  sing N N 326 
TYR CB  CG   sing N N 327 
TYR CB  HB2  sing N N 328 
TYR CB  HB3  sing N N 329 
TYR CG  CD1  doub Y N 330 
TYR CG  CD2  sing Y N 331 
TYR CD1 CE1  sing Y N 332 
TYR CD1 HD1  sing N N 333 
TYR CD2 CE2  doub Y N 334 
TYR CD2 HD2  sing N N 335 
TYR CE1 CZ   doub Y N 336 
TYR CE1 HE1  sing N N 337 
TYR CE2 CZ   sing Y N 338 
TYR CE2 HE2  sing N N 339 
TYR CZ  OH   sing N N 340 
TYR OH  HH   sing N N 341 
TYR OXT HXT  sing N N 342 
VAL N   CA   sing N N 343 
VAL N   H    sing N N 344 
VAL N   H2   sing N N 345 
VAL CA  C    sing N N 346 
VAL CA  CB   sing N N 347 
VAL CA  HA   sing N N 348 
VAL C   O    doub N N 349 
VAL C   OXT  sing N N 350 
VAL CB  CG1  sing N N 351 
VAL CB  CG2  sing N N 352 
VAL CB  HB   sing N N 353 
VAL CG1 HG11 sing N N 354 
VAL CG1 HG12 sing N N 355 
VAL CG1 HG13 sing N N 356 
VAL CG2 HG21 sing N N 357 
VAL CG2 HG22 sing N N 358 
VAL CG2 HG23 sing N N 359 
VAL OXT HXT  sing N N 360 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             DRX 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    700 
_pdbx_nmr_spectrometer.type              ? 
# 
_atom_sites.entry_id                    2BW2 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_