data_2C60 # _entry.id 2C60 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2C60 pdb_00002c60 10.2210/pdb2c60/pdb PDBE EBI-26261 ? ? WWPDB D_1290026261 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-29 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-01-24 5 'Structure model' 1 4 2018-02-28 6 'Structure model' 1 5 2019-05-08 7 'Structure model' 1 6 2024-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Source and taxonomy' 5 6 'Structure model' 'Data collection' 6 6 'Structure model' 'Derived calculations' 7 6 'Structure model' 'Experimental preparation' 8 7 'Structure model' 'Data collection' 9 7 'Structure model' 'Database references' 10 7 'Structure model' 'Derived calculations' 11 7 'Structure model' Other 12 7 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' citation_author 2 5 'Structure model' entity_src_gen 3 6 'Structure model' exptl_crystal_grow 4 6 'Structure model' pdbx_seq_map_depositor_info 5 6 'Structure model' struct_conn 6 7 'Structure model' chem_comp_atom 7 7 'Structure model' chem_comp_bond 8 7 'Structure model' database_2 9 7 'Structure model' pdbx_database_status 10 7 'Structure model' pdbx_entry_details 11 7 'Structure model' pdbx_modification_feature 12 7 'Structure model' pdbx_struct_conn_angle 13 7 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation_author.name' 2 5 'Structure model' '_entity_src_gen.pdbx_host_org_cell_line' 3 5 'Structure model' '_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id' 4 5 'Structure model' '_entity_src_gen.pdbx_host_org_scientific_name' 5 5 'Structure model' '_entity_src_gen.pdbx_host_org_strain' 6 5 'Structure model' '_entity_src_gen.pdbx_host_org_variant' 7 6 'Structure model' '_exptl_crystal_grow.method' 8 6 'Structure model' '_pdbx_seq_map_depositor_info.one_letter_code_mod' 9 6 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 10 7 'Structure model' '_database_2.pdbx_DOI' 11 7 'Structure model' '_database_2.pdbx_database_accession' 12 7 'Structure model' '_pdbx_database_status.status_code_sf' 13 7 'Structure model' '_pdbx_entry_details.has_protein_modification' 14 7 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 15 7 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 16 7 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 17 7 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 18 7 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 19 7 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 20 7 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 21 7 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 22 7 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 23 7 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 24 7 'Structure model' '_pdbx_struct_conn_angle.value' 25 7 'Structure model' '_struct_conn.pdbx_dist_value' 26 7 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 27 7 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 28 7 'Structure model' '_struct_conn.ptnr1_label_asym_id' 29 7 'Structure model' '_struct_conn.ptnr1_label_atom_id' 30 7 'Structure model' '_struct_conn.ptnr1_label_comp_id' 31 7 'Structure model' '_struct_conn.ptnr1_label_seq_id' 32 7 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 33 7 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 34 7 'Structure model' '_struct_conn.ptnr2_label_asym_id' 35 7 'Structure model' '_struct_conn.ptnr2_label_atom_id' 36 7 'Structure model' '_struct_conn.ptnr2_label_comp_id' 37 7 'Structure model' '_struct_conn.ptnr2_label_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2C60 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2005-11-04 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Debreczeni, J.E.' 1 ? 'Salah, E.' 2 ? 'Papagrigoriou, E.' 3 ? 'Burgess, N.' 4 ? 'von Delft, F.' 5 ? 'Gileadi, O.' 6 ? 'Sundstrom, M.' 7 ? 'Edwards, A.' 8 ? 'Arrowsmith, C.' 9 ? 'Weigelt, J.' 10 ? 'Knapp, S.' 11 ? # _citation.id primary _citation.title 'Crystal Structure of Human Mitogen-Activated Protein Kinase Kinase Kinase 3 Isoform 2 Fox Domain at 1.25 A Resolution' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Debreczeni, J.E.' 1 ? primary 'Salah, E.' 2 ? primary 'Papagrigoriou, E.' 3 ? primary 'Burgess, N.' 4 ? primary 'von Delft, F.' 5 ? primary 'Gileadi, O.' 6 ? primary 'Sundstrom, M.' 7 ? primary 'Edwards, A.' 8 ? primary 'Arrowsmith, C.' 9 ? primary 'Weigelt, J.' 10 ? primary 'Knapp, S.' 11 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'HUMAN MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 3 ISOFORM 2' 13144.145 1 2.7.1.37 ? 'PHOX DOMAIN, RESIDUES 37-124' ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 4 water nat water 18.015 128 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'MAPK/ERK KINASE KINASE 3, MEK KINASE 3, MEKK 3' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)HHHHHHSSGVDLGTENLYFQS(MSE)GHSNRQSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHY (MSE)NNELSILLKNQDDLDKAIDILDRSSS(MSE)KSLRILLLSQD ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHSSGVDLGTENLYFQSMGHSNRQSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSIL LKNQDDLDKAIDILDRSSSMKSLRILLLSQD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 GLYCEROL GOL 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 SER n 1 9 SER n 1 10 GLY n 1 11 VAL n 1 12 ASP n 1 13 LEU n 1 14 GLY n 1 15 THR n 1 16 GLU n 1 17 ASN n 1 18 LEU n 1 19 TYR n 1 20 PHE n 1 21 GLN n 1 22 SER n 1 23 MSE n 1 24 GLY n 1 25 HIS n 1 26 SER n 1 27 ASN n 1 28 ARG n 1 29 GLN n 1 30 SER n 1 31 ASP n 1 32 VAL n 1 33 ARG n 1 34 ILE n 1 35 LYS n 1 36 PHE n 1 37 GLU n 1 38 HIS n 1 39 ASN n 1 40 GLY n 1 41 GLU n 1 42 ARG n 1 43 ARG n 1 44 ILE n 1 45 ILE n 1 46 ALA n 1 47 PHE n 1 48 SER n 1 49 ARG n 1 50 PRO n 1 51 VAL n 1 52 LYS n 1 53 TYR n 1 54 GLU n 1 55 ASP n 1 56 VAL n 1 57 GLU n 1 58 HIS n 1 59 LYS n 1 60 VAL n 1 61 THR n 1 62 THR n 1 63 VAL n 1 64 PHE n 1 65 GLY n 1 66 GLN n 1 67 PRO n 1 68 LEU n 1 69 ASP n 1 70 LEU n 1 71 HIS n 1 72 TYR n 1 73 MSE n 1 74 ASN n 1 75 ASN n 1 76 GLU n 1 77 LEU n 1 78 SER n 1 79 ILE n 1 80 LEU n 1 81 LEU n 1 82 LYS n 1 83 ASN n 1 84 GLN n 1 85 ASP n 1 86 ASP n 1 87 LEU n 1 88 ASP n 1 89 LYS n 1 90 ALA n 1 91 ILE n 1 92 ASP n 1 93 ILE n 1 94 LEU n 1 95 ASP n 1 96 ARG n 1 97 SER n 1 98 SER n 1 99 SER n 1 100 MSE n 1 101 LYS n 1 102 SER n 1 103 LEU n 1 104 ARG n 1 105 ILE n 1 106 LEU n 1 107 LEU n 1 108 LEU n 1 109 SER n 1 110 GLN n 1 111 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant R3 _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector PNIC28-BSA4 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 -23 ? ? ? A . n A 1 2 HIS 2 -22 ? ? ? A . n A 1 3 HIS 3 -21 ? ? ? A . n A 1 4 HIS 4 -20 ? ? ? A . n A 1 5 HIS 5 -19 ? ? ? A . n A 1 6 HIS 6 -18 ? ? ? A . n A 1 7 HIS 7 -17 ? ? ? A . n A 1 8 SER 8 -16 ? ? ? A . n A 1 9 SER 9 -15 ? ? ? A . n A 1 10 GLY 10 -14 ? ? ? A . n A 1 11 VAL 11 -13 ? ? ? A . n A 1 12 ASP 12 -12 ? ? ? A . n A 1 13 LEU 13 -11 ? ? ? A . n A 1 14 GLY 14 -10 -10 GLY GLY A . n A 1 15 THR 15 -9 -9 THR THR A . n A 1 16 GLU 16 -8 -8 GLU GLU A . n A 1 17 ASN 17 -7 -7 ASN ASN A . n A 1 18 LEU 18 -6 -6 LEU LEU A . n A 1 19 TYR 19 -5 ? ? ? A . n A 1 20 PHE 20 -4 ? ? ? A . n A 1 21 GLN 21 -3 ? ? ? A . n A 1 22 SER 22 -2 ? ? ? A . n A 1 23 MSE 23 -1 ? ? ? A . n A 1 24 GLY 24 37 ? ? ? A . n A 1 25 HIS 25 38 ? ? ? A . n A 1 26 SER 26 39 ? ? ? A . n A 1 27 ASN 27 40 ? ? ? A . n A 1 28 ARG 28 41 ? ? ? A . n A 1 29 GLN 29 42 ? ? ? A . n A 1 30 SER 30 43 43 SER SER A . n A 1 31 ASP 31 44 44 ASP ASP A . n A 1 32 VAL 32 45 45 VAL VAL A . n A 1 33 ARG 33 46 46 ARG ARG A . n A 1 34 ILE 34 47 47 ILE ILE A . n A 1 35 LYS 35 48 48 LYS LYS A . n A 1 36 PHE 36 49 49 PHE PHE A . n A 1 37 GLU 37 50 50 GLU GLU A . n A 1 38 HIS 38 51 51 HIS HIS A . n A 1 39 ASN 39 52 52 ASN ASN A . n A 1 40 GLY 40 53 53 GLY GLY A . n A 1 41 GLU 41 54 54 GLU GLU A . n A 1 42 ARG 42 55 55 ARG ARG A . n A 1 43 ARG 43 56 56 ARG ARG A . n A 1 44 ILE 44 57 57 ILE ILE A . n A 1 45 ILE 45 58 58 ILE ILE A . n A 1 46 ALA 46 59 59 ALA ALA A . n A 1 47 PHE 47 60 60 PHE PHE A . n A 1 48 SER 48 61 61 SER SER A . n A 1 49 ARG 49 62 62 ARG ARG A . n A 1 50 PRO 50 63 63 PRO PRO A . n A 1 51 VAL 51 64 64 VAL VAL A . n A 1 52 LYS 52 65 65 LYS LYS A . n A 1 53 TYR 53 66 66 TYR TYR A . n A 1 54 GLU 54 67 67 GLU GLU A . n A 1 55 ASP 55 68 68 ASP ASP A . n A 1 56 VAL 56 69 69 VAL VAL A . n A 1 57 GLU 57 70 70 GLU GLU A . n A 1 58 HIS 58 71 71 HIS HIS A . n A 1 59 LYS 59 72 72 LYS LYS A . n A 1 60 VAL 60 73 73 VAL VAL A . n A 1 61 THR 61 74 74 THR THR A . n A 1 62 THR 62 75 75 THR THR A . n A 1 63 VAL 63 76 76 VAL VAL A . n A 1 64 PHE 64 77 77 PHE PHE A . n A 1 65 GLY 65 78 78 GLY GLY A . n A 1 66 GLN 66 79 79 GLN GLN A . n A 1 67 PRO 67 80 80 PRO PRO A . n A 1 68 LEU 68 81 81 LEU LEU A . n A 1 69 ASP 69 82 82 ASP ASP A . n A 1 70 LEU 70 83 83 LEU LEU A . n A 1 71 HIS 71 84 84 HIS HIS A . n A 1 72 TYR 72 85 85 TYR TYR A . n A 1 73 MSE 73 86 86 MSE MSE A . n A 1 74 ASN 74 87 87 ASN ASN A . n A 1 75 ASN 75 88 88 ASN ASN A . n A 1 76 GLU 76 89 89 GLU GLU A . n A 1 77 LEU 77 90 90 LEU LEU A . n A 1 78 SER 78 91 91 SER SER A . n A 1 79 ILE 79 92 92 ILE ILE A . n A 1 80 LEU 80 93 93 LEU LEU A . n A 1 81 LEU 81 94 94 LEU LEU A . n A 1 82 LYS 82 95 95 LYS LYS A . n A 1 83 ASN 83 96 96 ASN ASN A . n A 1 84 GLN 84 97 97 GLN GLN A . n A 1 85 ASP 85 98 98 ASP ASP A . n A 1 86 ASP 86 99 99 ASP ASP A . n A 1 87 LEU 87 100 100 LEU LEU A . n A 1 88 ASP 88 101 101 ASP ASP A . n A 1 89 LYS 89 102 102 LYS LYS A . n A 1 90 ALA 90 103 103 ALA ALA A . n A 1 91 ILE 91 104 104 ILE ILE A . n A 1 92 ASP 92 105 105 ASP ASP A . n A 1 93 ILE 93 106 106 ILE ILE A . n A 1 94 LEU 94 107 107 LEU LEU A . n A 1 95 ASP 95 108 108 ASP ASP A . n A 1 96 ARG 96 109 109 ARG ARG A . n A 1 97 SER 97 110 110 SER SER A . n A 1 98 SER 98 111 111 SER SER A . n A 1 99 SER 99 112 112 SER SER A . n A 1 100 MSE 100 113 113 MSE MSE A . n A 1 101 LYS 101 114 114 LYS LYS A . n A 1 102 SER 102 115 115 SER SER A . n A 1 103 LEU 103 116 116 LEU LEU A . n A 1 104 ARG 104 117 117 ARG ARG A . n A 1 105 ILE 105 118 118 ILE ILE A . n A 1 106 LEU 106 119 119 LEU LEU A . n A 1 107 LEU 107 120 120 LEU LEU A . n A 1 108 LEU 108 121 121 LEU LEU A . n A 1 109 SER 109 122 122 SER SER A . n A 1 110 GLN 110 123 ? ? ? A . n A 1 111 ASP 111 124 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 1123 1123 CA CA A . C 3 GOL 1 1124 1124 GOL GOL A . D 4 HOH 1 2001 2001 HOH HOH A . D 4 HOH 2 2002 2002 HOH HOH A . D 4 HOH 3 2003 2003 HOH HOH A . D 4 HOH 4 2004 2004 HOH HOH A . D 4 HOH 5 2005 2005 HOH HOH A . D 4 HOH 6 2006 2006 HOH HOH A . D 4 HOH 7 2007 2007 HOH HOH A . D 4 HOH 8 2008 2008 HOH HOH A . D 4 HOH 9 2009 2009 HOH HOH A . D 4 HOH 10 2010 2010 HOH HOH A . D 4 HOH 11 2011 2011 HOH HOH A . D 4 HOH 12 2012 2012 HOH HOH A . D 4 HOH 13 2013 2013 HOH HOH A . D 4 HOH 14 2014 2014 HOH HOH A . D 4 HOH 15 2015 2015 HOH HOH A . D 4 HOH 16 2016 2016 HOH HOH A . D 4 HOH 17 2017 2017 HOH HOH A . D 4 HOH 18 2018 2018 HOH HOH A . D 4 HOH 19 2019 2019 HOH HOH A . D 4 HOH 20 2020 2020 HOH HOH A . D 4 HOH 21 2021 2021 HOH HOH A . D 4 HOH 22 2022 2022 HOH HOH A . D 4 HOH 23 2023 2023 HOH HOH A . D 4 HOH 24 2024 2024 HOH HOH A . D 4 HOH 25 2025 2025 HOH HOH A . D 4 HOH 26 2026 2026 HOH HOH A . D 4 HOH 27 2027 2027 HOH HOH A . D 4 HOH 28 2028 2028 HOH HOH A . D 4 HOH 29 2029 2029 HOH HOH A . D 4 HOH 30 2030 2030 HOH HOH A . D 4 HOH 31 2031 2031 HOH HOH A . D 4 HOH 32 2032 2032 HOH HOH A . D 4 HOH 33 2033 2033 HOH HOH A . D 4 HOH 34 2034 2034 HOH HOH A . D 4 HOH 35 2035 2035 HOH HOH A . D 4 HOH 36 2036 2036 HOH HOH A . D 4 HOH 37 2037 2037 HOH HOH A . D 4 HOH 38 2038 2038 HOH HOH A . D 4 HOH 39 2039 2039 HOH HOH A . D 4 HOH 40 2040 2040 HOH HOH A . D 4 HOH 41 2041 2041 HOH HOH A . D 4 HOH 42 2042 2042 HOH HOH A . D 4 HOH 43 2043 2043 HOH HOH A . D 4 HOH 44 2044 2044 HOH HOH A . D 4 HOH 45 2045 2045 HOH HOH A . D 4 HOH 46 2046 2046 HOH HOH A . D 4 HOH 47 2047 2047 HOH HOH A . D 4 HOH 48 2048 2048 HOH HOH A . D 4 HOH 49 2049 2049 HOH HOH A . D 4 HOH 50 2050 2050 HOH HOH A . D 4 HOH 51 2051 2051 HOH HOH A . D 4 HOH 52 2052 2052 HOH HOH A . D 4 HOH 53 2053 2053 HOH HOH A . D 4 HOH 54 2054 2054 HOH HOH A . D 4 HOH 55 2055 2055 HOH HOH A . D 4 HOH 56 2056 2056 HOH HOH A . D 4 HOH 57 2057 2057 HOH HOH A . D 4 HOH 58 2058 2058 HOH HOH A . D 4 HOH 59 2059 2059 HOH HOH A . D 4 HOH 60 2060 2060 HOH HOH A . D 4 HOH 61 2061 2061 HOH HOH A . D 4 HOH 62 2062 2062 HOH HOH A . D 4 HOH 63 2063 2063 HOH HOH A . D 4 HOH 64 2064 2064 HOH HOH A . D 4 HOH 65 2065 2065 HOH HOH A . D 4 HOH 66 2066 2066 HOH HOH A . D 4 HOH 67 2067 2067 HOH HOH A . D 4 HOH 68 2068 2068 HOH HOH A . D 4 HOH 69 2069 2069 HOH HOH A . D 4 HOH 70 2070 2070 HOH HOH A . D 4 HOH 71 2071 2071 HOH HOH A . D 4 HOH 72 2072 2072 HOH HOH A . D 4 HOH 73 2073 2073 HOH HOH A . D 4 HOH 74 2074 2074 HOH HOH A . D 4 HOH 75 2075 2075 HOH HOH A . D 4 HOH 76 2076 2076 HOH HOH A . D 4 HOH 77 2077 2077 HOH HOH A . D 4 HOH 78 2078 2078 HOH HOH A . D 4 HOH 79 2079 2079 HOH HOH A . D 4 HOH 80 2080 2080 HOH HOH A . D 4 HOH 81 2081 2081 HOH HOH A . D 4 HOH 82 2082 2082 HOH HOH A . D 4 HOH 83 2083 2083 HOH HOH A . D 4 HOH 84 2084 2084 HOH HOH A . D 4 HOH 85 2085 2085 HOH HOH A . D 4 HOH 86 2086 2086 HOH HOH A . D 4 HOH 87 2087 2087 HOH HOH A . D 4 HOH 88 2088 2088 HOH HOH A . D 4 HOH 89 2089 2089 HOH HOH A . D 4 HOH 90 2090 2090 HOH HOH A . D 4 HOH 91 2091 2091 HOH HOH A . D 4 HOH 92 2092 2092 HOH HOH A . D 4 HOH 93 2093 2093 HOH HOH A . D 4 HOH 94 2094 2094 HOH HOH A . D 4 HOH 95 2095 2095 HOH HOH A . D 4 HOH 96 2096 2096 HOH HOH A . D 4 HOH 97 2097 2097 HOH HOH A . D 4 HOH 98 2098 2098 HOH HOH A . D 4 HOH 99 2099 2099 HOH HOH A . D 4 HOH 100 2100 2100 HOH HOH A . D 4 HOH 101 2101 2101 HOH HOH A . D 4 HOH 102 2102 2102 HOH HOH A . D 4 HOH 103 2103 2103 HOH HOH A . D 4 HOH 104 2104 2104 HOH HOH A . D 4 HOH 105 2105 2105 HOH HOH A . D 4 HOH 106 2106 2106 HOH HOH A . D 4 HOH 107 2107 2107 HOH HOH A . D 4 HOH 108 2108 2108 HOH HOH A . D 4 HOH 109 2109 2109 HOH HOH A . D 4 HOH 110 2110 2110 HOH HOH A . D 4 HOH 111 2111 2111 HOH HOH A . D 4 HOH 112 2112 2112 HOH HOH A . D 4 HOH 113 2113 2113 HOH HOH A . D 4 HOH 114 2114 2114 HOH HOH A . D 4 HOH 115 2115 2115 HOH HOH A . D 4 HOH 116 2116 2116 HOH HOH A . D 4 HOH 117 2117 2117 HOH HOH A . D 4 HOH 118 2118 2118 HOH HOH A . D 4 HOH 119 2119 2119 HOH HOH A . D 4 HOH 120 2120 2120 HOH HOH A . D 4 HOH 121 2121 2121 HOH HOH A . D 4 HOH 122 2122 2122 HOH HOH A . D 4 HOH 123 2123 2123 HOH HOH A . D 4 HOH 124 2124 2124 HOH HOH A . D 4 HOH 125 2125 2125 HOH HOH A . D 4 HOH 126 2126 2126 HOH HOH A . D 4 HOH 127 2127 2127 HOH HOH A . D 4 HOH 128 2128 2128 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU -8 ? CG ? A GLU 16 CG 2 1 Y 1 A GLU -8 ? CD ? A GLU 16 CD 3 1 Y 1 A GLU -8 ? OE1 ? A GLU 16 OE1 4 1 Y 1 A GLU -8 ? OE2 ? A GLU 16 OE2 5 1 Y 1 A ASN -7 ? CG ? A ASN 17 CG 6 1 Y 1 A ASN -7 ? OD1 ? A ASN 17 OD1 7 1 Y 1 A ASN -7 ? ND2 ? A ASN 17 ND2 8 1 Y 1 A GLU 54 ? CG ? A GLU 41 CG 9 1 Y 1 A GLU 54 ? CD ? A GLU 41 CD 10 1 Y 1 A GLU 54 ? OE1 ? A GLU 41 OE1 11 1 Y 1 A GLU 54 ? OE2 ? A GLU 41 OE2 12 1 Y 1 A LYS 65 ? CE ? A LYS 52 CE 13 1 Y 1 A LYS 65 ? NZ ? A LYS 52 NZ 14 1 Y 1 A LYS 102 ? CE ? A LYS 89 CE 15 1 Y 1 A LYS 102 ? NZ ? A LYS 89 NZ # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal XDS 'data reduction' . ? 1 XDS 'data scaling' . ? 2 SHELXD phasing . ? 3 SHELXE phasing . ? 4 REFMAC refinement 5.2.0005 ? 5 # _cell.entry_id 2C60 _cell.length_a 82.800 _cell.length_b 42.300 _cell.length_c 30.600 _cell.angle_alpha 90.00 _cell.angle_beta 106.60 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2C60 _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 # _exptl.entry_id 2C60 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.1 _exptl_crystal.density_percent_sol 42.1 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '150 NANOLITRE SITTING DROPS, 0.2 KSCN, 20% PEG3350, 10% ETHYLENE GLYCOL' # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2005-10-22 _diffrn_detector.details MIRRORS # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator SI111 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9718 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SLS BEAMLINE X10SA' _diffrn_source.pdbx_synchrotron_site SLS _diffrn_source.pdbx_synchrotron_beamline X10SA _diffrn_source.pdbx_wavelength 0.9718 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2C60 _reflns.observed_criterion_sigma_I 3.000 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 29.320 _reflns.d_resolution_high 1.250 _reflns.number_obs 26421 _reflns.number_all ? _reflns.percent_possible_obs 93.8 _reflns.pdbx_Rmerge_I_obs 0.07000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 15.8100 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 5.780 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.25 _reflns_shell.d_res_low 1.35 _reflns_shell.percent_possible_all 88.1 _reflns_shell.Rmerge_I_obs 0.26000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 5.250 _reflns_shell.pdbx_redundancy 2.90 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2C60 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 25085 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 39.72 _refine.ls_d_res_high 1.25 _refine.ls_percent_reflns_obs 93.8 _refine.ls_R_factor_obs 0.166 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.165 _refine.ls_R_factor_R_free 0.182 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.100 _refine.ls_number_reflns_R_free 1336 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.969 _refine.correlation_coeff_Fo_to_Fc_free 0.967 _refine.B_iso_mean 15.02 _refine.aniso_B[1][1] -0.19000 _refine.aniso_B[2][2] 0.33000 _refine.aniso_B[3][3] 0.16000 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] 0.53000 _refine.aniso_B[2][3] 0.00000 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.047 _refine.pdbx_overall_ESU_R_Free 0.043 _refine.overall_SU_ML 0.032 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 1.719 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 676 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 7 _refine_hist.number_atoms_solvent 128 _refine_hist.number_atoms_total 811 _refine_hist.d_res_high 1.25 _refine_hist.d_res_low 39.72 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.014 0.022 ? 722 'X-RAY DIFFRACTION' ? r_bond_other_d 0.002 0.020 ? 701 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.455 1.987 ? 969 'X-RAY DIFFRACTION' ? r_angle_other_deg 0.749 3.000 ? 1626 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.312 5.000 ? 83 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 30.656 23.714 ? 35 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 10.767 15.000 ? 148 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 18.505 15.000 ? 7 'X-RAY DIFFRACTION' ? r_chiral_restr 0.080 0.200 ? 117 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.005 0.020 ? 753 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.001 0.020 ? 138 'X-RAY DIFFRACTION' ? r_nbd_refined 0.235 0.200 ? 115 'X-RAY DIFFRACTION' ? r_nbd_other 0.191 0.200 ? 681 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.171 0.200 ? 343 'X-RAY DIFFRACTION' ? r_nbtor_other 0.085 0.200 ? 453 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.123 0.200 ? 83 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.151 0.200 ? 11 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 0.199 0.200 ? 38 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.155 0.200 ? 17 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.847 1.500 ? 450 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 2.428 2.000 ? 703 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 3.351 3.000 ? 306 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it 4.725 4.500 ? 266 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.25 _refine_ls_shell.d_res_low 1.28 _refine_ls_shell.number_reflns_R_work 1516 _refine_ls_shell.R_factor_R_work 0.3250 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.3040 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 93 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _database_PDB_matrix.entry_id 2C60 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2C60 _struct.title 'crystal structure of human mitogen-activated protein kinase kinase kinase 3 isoform 2 phox domain at 1.25 A resolution' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2C60 _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text ;MAP3K3, MAP/ERK KINASE KINASE 3, MAPKKK3, MEKK3, SERINE THREONINE PHOSPHORYLATION, ATP-BINDING, KINASE, MAGNESIUM, METAL-BINDING, NUCLEOTIDE-BINDING, PHOSPHORYLATION, SERINE/THREONINE-PROTEIN KINASE, TRANSFERASE ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 PDB 2C60 1 ? ? 2C60 ? 2 UNP M3K3_HUMAN 1 ? ? Q99759 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2C60 A 1 ? 23 ? 2C60 -23 ? -1 ? -23 -1 2 2 2C60 A 24 ? 111 ? Q99759 37 ? 124 ? 37 124 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 52 ? GLY A 65 ? LYS A 65 GLY A 78 1 ? 14 HELX_P HELX_P2 2 ASN A 83 ? SER A 97 ? ASN A 96 SER A 110 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A TYR 72 C ? ? ? 1_555 A MSE 73 N ? ? A TYR 85 A MSE 86 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale2 covale both ? A MSE 73 C ? ? ? 1_555 A ASN 74 N ? ? A MSE 86 A ASN 87 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale3 covale both ? A SER 99 C ? ? ? 1_555 A MSE 100 N ? ? A SER 112 A MSE 113 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale4 covale both ? A MSE 100 C ? ? ? 1_555 A LYS 101 N ? ? A MSE 113 A LYS 114 1_555 ? ? ? ? ? ? ? 1.325 ? ? metalc1 metalc ? ? A LEU 94 O ? ? ? 1_555 B CA . CA ? ? A LEU 107 A CA 1123 1_555 ? ? ? ? ? ? ? 2.643 ? ? metalc2 metalc ? ? A SER 97 O ? ? ? 1_555 B CA . CA ? ? A SER 110 A CA 1123 1_555 ? ? ? ? ? ? ? 2.599 ? ? metalc3 metalc ? ? A MSE 100 O ? ? ? 1_555 B CA . CA ? ? A MSE 113 A CA 1123 1_555 ? ? ? ? ? ? ? 2.618 ? ? metalc4 metalc ? ? B CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 1123 A HOH 2065 1_555 ? ? ? ? ? ? ? 2.752 ? ? metalc5 metalc ? ? B CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 1123 A HOH 2108 1_555 ? ? ? ? ? ? ? 2.989 ? ? metalc6 metalc ? ? B CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 1123 A HOH 2109 1_555 ? ? ? ? ? ? ? 2.909 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A LEU 94 ? A LEU 107 ? 1_555 CA ? B CA . ? A CA 1123 ? 1_555 O ? A SER 97 ? A SER 110 ? 1_555 78.4 ? 2 O ? A LEU 94 ? A LEU 107 ? 1_555 CA ? B CA . ? A CA 1123 ? 1_555 O ? A MSE 100 ? A MSE 113 ? 1_555 102.9 ? 3 O ? A SER 97 ? A SER 110 ? 1_555 CA ? B CA . ? A CA 1123 ? 1_555 O ? A MSE 100 ? A MSE 113 ? 1_555 94.3 ? 4 O ? A LEU 94 ? A LEU 107 ? 1_555 CA ? B CA . ? A CA 1123 ? 1_555 O ? D HOH . ? A HOH 2065 ? 1_555 156.8 ? 5 O ? A SER 97 ? A SER 110 ? 1_555 CA ? B CA . ? A CA 1123 ? 1_555 O ? D HOH . ? A HOH 2065 ? 1_555 120.9 ? 6 O ? A MSE 100 ? A MSE 113 ? 1_555 CA ? B CA . ? A CA 1123 ? 1_555 O ? D HOH . ? A HOH 2065 ? 1_555 89.3 ? 7 O ? A LEU 94 ? A LEU 107 ? 1_555 CA ? B CA . ? A CA 1123 ? 1_555 O ? D HOH . ? A HOH 2108 ? 1_555 79.2 ? 8 O ? A SER 97 ? A SER 110 ? 1_555 CA ? B CA . ? A CA 1123 ? 1_555 O ? D HOH . ? A HOH 2108 ? 1_555 143.8 ? 9 O ? A MSE 100 ? A MSE 113 ? 1_555 CA ? B CA . ? A CA 1123 ? 1_555 O ? D HOH . ? A HOH 2108 ? 1_555 118.2 ? 10 O ? D HOH . ? A HOH 2065 ? 1_555 CA ? B CA . ? A CA 1123 ? 1_555 O ? D HOH . ? A HOH 2108 ? 1_555 77.7 ? 11 O ? A LEU 94 ? A LEU 107 ? 1_555 CA ? B CA . ? A CA 1123 ? 1_555 O ? D HOH . ? A HOH 2109 ? 1_555 92.4 ? 12 O ? A SER 97 ? A SER 110 ? 1_555 CA ? B CA . ? A CA 1123 ? 1_555 O ? D HOH . ? A HOH 2109 ? 1_555 75.4 ? 13 O ? A MSE 100 ? A MSE 113 ? 1_555 CA ? B CA . ? A CA 1123 ? 1_555 O ? D HOH . ? A HOH 2109 ? 1_555 159.6 ? 14 O ? D HOH . ? A HOH 2065 ? 1_555 CA ? B CA . ? A CA 1123 ? 1_555 O ? D HOH . ? A HOH 2109 ? 1_555 81.4 ? 15 O ? D HOH . ? A HOH 2108 ? 1_555 CA ? B CA . ? A CA 1123 ? 1_555 O ? D HOH . ? A HOH 2109 ? 1_555 77.6 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 73 ? . . . . MSE A 86 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 100 ? . . . . MSE A 113 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ARG _struct_mon_prot_cis.label_seq_id 49 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ARG _struct_mon_prot_cis.auth_seq_id 62 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 50 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 63 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -5.38 # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? parallel AA 3 4 ? anti-parallel AA 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 GLU A 41 ? PHE A 47 ? GLU A 54 PHE A 60 AA 2 VAL A 32 ? HIS A 38 ? VAL A 45 HIS A 51 AA 3 LEU A 103 ? LEU A 108 ? LEU A 116 LEU A 121 AA 4 ASP A 69 ? MSE A 73 ? ASP A 82 MSE A 86 AA 5 SER A 78 ? LEU A 80 ? SER A 91 LEU A 93 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N PHE A 47 ? N PHE A 60 O VAL A 32 ? O VAL A 45 AA 2 3 N LYS A 35 ? N LYS A 48 O LEU A 103 ? O LEU A 116 AA 3 4 N LEU A 108 ? N LEU A 121 O ASP A 69 ? O ASP A 82 AA 4 5 N TYR A 72 ? N TYR A 85 O ILE A 79 ? O ILE A 92 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A1123' AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE GOL A1124' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 LEU A 94 ? LEU A 107 . ? 1_555 ? 2 AC1 6 SER A 97 ? SER A 110 . ? 1_555 ? 3 AC1 6 MSE A 100 ? MSE A 113 . ? 1_555 ? 4 AC1 6 HOH D . ? HOH A 2065 . ? 1_555 ? 5 AC1 6 HOH D . ? HOH A 2108 . ? 1_555 ? 6 AC1 6 HOH D . ? HOH A 2109 . ? 1_555 ? 7 AC2 6 ARG A 43 ? ARG A 56 . ? 1_555 ? 8 AC2 6 ARG A 49 ? ARG A 62 . ? 1_555 ? 9 AC2 6 PRO A 50 ? PRO A 63 . ? 1_555 ? 10 AC2 6 VAL A 51 ? VAL A 64 . ? 1_555 ? 11 AC2 6 VAL A 63 ? VAL A 76 . ? 1_555 ? 12 AC2 6 HOH D . ? HOH A 2101 . ? 1_555 ? # _pdbx_entry_details.entry_id 2C60 _pdbx_entry_details.compound_details 'COMPONENT OF A PROTEIN KINASE SIGNAL TRANSDUCTION CASCADE' _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;THE FIRST 13 RESIDUES (MHHHHHHSSG VDLGTENLYF QSM) BELONG TO THE HIS-TAG, CLONING ARTIFACT ; _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 87 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -118.42 _pdbx_validate_torsion.psi -164.68 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 73 A MSE 86 ? MET SELENOMETHIONINE 2 A MSE 100 A MSE 113 ? MET SELENOMETHIONINE # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE -23 ? A MSE 1 2 1 Y 1 A HIS -22 ? A HIS 2 3 1 Y 1 A HIS -21 ? A HIS 3 4 1 Y 1 A HIS -20 ? A HIS 4 5 1 Y 1 A HIS -19 ? A HIS 5 6 1 Y 1 A HIS -18 ? A HIS 6 7 1 Y 1 A HIS -17 ? A HIS 7 8 1 Y 1 A SER -16 ? A SER 8 9 1 Y 1 A SER -15 ? A SER 9 10 1 Y 1 A GLY -14 ? A GLY 10 11 1 Y 1 A VAL -13 ? A VAL 11 12 1 Y 1 A ASP -12 ? A ASP 12 13 1 Y 1 A LEU -11 ? A LEU 13 14 1 Y 1 A TYR -5 ? A TYR 19 15 1 Y 1 A PHE -4 ? A PHE 20 16 1 Y 1 A GLN -3 ? A GLN 21 17 1 Y 1 A SER -2 ? A SER 22 18 1 Y 1 A MSE -1 ? A MSE 23 19 1 Y 1 A GLY 37 ? A GLY 24 20 1 Y 1 A HIS 38 ? A HIS 25 21 1 Y 1 A SER 39 ? A SER 26 22 1 Y 1 A ASN 40 ? A ASN 27 23 1 Y 1 A ARG 41 ? A ARG 28 24 1 Y 1 A GLN 42 ? A GLN 29 25 1 Y 1 A GLN 123 ? A GLN 110 26 1 Y 1 A ASP 124 ? A ASP 111 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 GOL C1 C N N 124 GOL O1 O N N 125 GOL C2 C N N 126 GOL O2 O N N 127 GOL C3 C N N 128 GOL O3 O N N 129 GOL H11 H N N 130 GOL H12 H N N 131 GOL HO1 H N N 132 GOL H2 H N N 133 GOL HO2 H N N 134 GOL H31 H N N 135 GOL H32 H N N 136 GOL HO3 H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MSE N N N N 231 MSE CA C N S 232 MSE C C N N 233 MSE O O N N 234 MSE OXT O N N 235 MSE CB C N N 236 MSE CG C N N 237 MSE SE SE N N 238 MSE CE C N N 239 MSE H H N N 240 MSE H2 H N N 241 MSE HA H N N 242 MSE HXT H N N 243 MSE HB2 H N N 244 MSE HB3 H N N 245 MSE HG2 H N N 246 MSE HG3 H N N 247 MSE HE1 H N N 248 MSE HE2 H N N 249 MSE HE3 H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TYR N N N N 322 TYR CA C N S 323 TYR C C N N 324 TYR O O N N 325 TYR CB C N N 326 TYR CG C Y N 327 TYR CD1 C Y N 328 TYR CD2 C Y N 329 TYR CE1 C Y N 330 TYR CE2 C Y N 331 TYR CZ C Y N 332 TYR OH O N N 333 TYR OXT O N N 334 TYR H H N N 335 TYR H2 H N N 336 TYR HA H N N 337 TYR HB2 H N N 338 TYR HB3 H N N 339 TYR HD1 H N N 340 TYR HD2 H N N 341 TYR HE1 H N N 342 TYR HE2 H N N 343 TYR HH H N N 344 TYR HXT H N N 345 VAL N N N N 346 VAL CA C N S 347 VAL C C N N 348 VAL O O N N 349 VAL CB C N N 350 VAL CG1 C N N 351 VAL CG2 C N N 352 VAL OXT O N N 353 VAL H H N N 354 VAL H2 H N N 355 VAL HA H N N 356 VAL HB H N N 357 VAL HG11 H N N 358 VAL HG12 H N N 359 VAL HG13 H N N 360 VAL HG21 H N N 361 VAL HG22 H N N 362 VAL HG23 H N N 363 VAL HXT H N N 364 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 GOL C1 O1 sing N N 116 GOL C1 C2 sing N N 117 GOL C1 H11 sing N N 118 GOL C1 H12 sing N N 119 GOL O1 HO1 sing N N 120 GOL C2 O2 sing N N 121 GOL C2 C3 sing N N 122 GOL C2 H2 sing N N 123 GOL O2 HO2 sing N N 124 GOL C3 O3 sing N N 125 GOL C3 H31 sing N N 126 GOL C3 H32 sing N N 127 GOL O3 HO3 sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MSE N CA sing N N 218 MSE N H sing N N 219 MSE N H2 sing N N 220 MSE CA C sing N N 221 MSE CA CB sing N N 222 MSE CA HA sing N N 223 MSE C O doub N N 224 MSE C OXT sing N N 225 MSE OXT HXT sing N N 226 MSE CB CG sing N N 227 MSE CB HB2 sing N N 228 MSE CB HB3 sing N N 229 MSE CG SE sing N N 230 MSE CG HG2 sing N N 231 MSE CG HG3 sing N N 232 MSE SE CE sing N N 233 MSE CE HE1 sing N N 234 MSE CE HE2 sing N N 235 MSE CE HE3 sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TYR N CA sing N N 306 TYR N H sing N N 307 TYR N H2 sing N N 308 TYR CA C sing N N 309 TYR CA CB sing N N 310 TYR CA HA sing N N 311 TYR C O doub N N 312 TYR C OXT sing N N 313 TYR CB CG sing N N 314 TYR CB HB2 sing N N 315 TYR CB HB3 sing N N 316 TYR CG CD1 doub Y N 317 TYR CG CD2 sing Y N 318 TYR CD1 CE1 sing Y N 319 TYR CD1 HD1 sing N N 320 TYR CD2 CE2 doub Y N 321 TYR CD2 HD2 sing N N 322 TYR CE1 CZ doub Y N 323 TYR CE1 HE1 sing N N 324 TYR CE2 CZ sing Y N 325 TYR CE2 HE2 sing N N 326 TYR CZ OH sing N N 327 TYR OH HH sing N N 328 TYR OXT HXT sing N N 329 VAL N CA sing N N 330 VAL N H sing N N 331 VAL N H2 sing N N 332 VAL CA C sing N N 333 VAL CA CB sing N N 334 VAL CA HA sing N N 335 VAL C O doub N N 336 VAL C OXT sing N N 337 VAL CB CG1 sing N N 338 VAL CB CG2 sing N N 339 VAL CB HB sing N N 340 VAL CG1 HG11 sing N N 341 VAL CG1 HG12 sing N N 342 VAL CG1 HG13 sing N N 343 VAL CG2 HG21 sing N N 344 VAL CG2 HG22 sing N N 345 VAL CG2 HG23 sing N N 346 VAL OXT HXT sing N N 347 # _atom_sites.entry_id 2C60 _atom_sites.fract_transf_matrix[1][1] 0.012077 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.003600 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023641 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.034101 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O SE # loop_