data_2CGQ # _entry.id 2CGQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.312 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2CGQ PDBE EBI-28093 WWPDB D_1290028093 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2CGQ _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2006-03-09 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ma, Q.' 1 'Wilmanns, M.' 2 # _citation.id primary _citation.title 'The Structure of a Putative Acyl Carrier Protein (Rv0033) from Mycobacterium Tuberculosis' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ma, Q.' 1 ? primary 'Wilmanns, M.' 2 ? # _cell.entry_id 2CGQ _cell.length_a 45.222 _cell.length_b 45.222 _cell.length_c 78.152 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2CGQ _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ACYL CARRIER PROTEIN ACPA' 12755.297 1 ? ? ? ? 2 water nat water 18.015 64 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ACP, ACYL CARRIER PROTEIN' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKHHHHHHPMSDYDIPTTENLYFQGAMEEAINATIQRILRTDRGITANQVLVDDLGFDSLKLFQLITELEDEFDIAISFR DAQNIKTVGDVYTSVAVWFPETAKPAPLGKGTA ; _entity_poly.pdbx_seq_one_letter_code_can ;MKHHHHHHPMSDYDIPTTENLYFQGAMEEAINATIQRILRTDRGITANQVLVDDLGFDSLKLFQLITELEDEFDIAISFR DAQNIKTVGDVYTSVAVWFPETAKPAPLGKGTA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 PRO n 1 10 MET n 1 11 SER n 1 12 ASP n 1 13 TYR n 1 14 ASP n 1 15 ILE n 1 16 PRO n 1 17 THR n 1 18 THR n 1 19 GLU n 1 20 ASN n 1 21 LEU n 1 22 TYR n 1 23 PHE n 1 24 GLN n 1 25 GLY n 1 26 ALA n 1 27 MET n 1 28 GLU n 1 29 GLU n 1 30 ALA n 1 31 ILE n 1 32 ASN n 1 33 ALA n 1 34 THR n 1 35 ILE n 1 36 GLN n 1 37 ARG n 1 38 ILE n 1 39 LEU n 1 40 ARG n 1 41 THR n 1 42 ASP n 1 43 ARG n 1 44 GLY n 1 45 ILE n 1 46 THR n 1 47 ALA n 1 48 ASN n 1 49 GLN n 1 50 VAL n 1 51 LEU n 1 52 VAL n 1 53 ASP n 1 54 ASP n 1 55 LEU n 1 56 GLY n 1 57 PHE n 1 58 ASP n 1 59 SER n 1 60 LEU n 1 61 LYS n 1 62 LEU n 1 63 PHE n 1 64 GLN n 1 65 LEU n 1 66 ILE n 1 67 THR n 1 68 GLU n 1 69 LEU n 1 70 GLU n 1 71 ASP n 1 72 GLU n 1 73 PHE n 1 74 ASP n 1 75 ILE n 1 76 ALA n 1 77 ILE n 1 78 SER n 1 79 PHE n 1 80 ARG n 1 81 ASP n 1 82 ALA n 1 83 GLN n 1 84 ASN n 1 85 ILE n 1 86 LYS n 1 87 THR n 1 88 VAL n 1 89 GLY n 1 90 ASP n 1 91 VAL n 1 92 TYR n 1 93 THR n 1 94 SER n 1 95 VAL n 1 96 ALA n 1 97 VAL n 1 98 TRP n 1 99 PHE n 1 100 PRO n 1 101 GLU n 1 102 THR n 1 103 ALA n 1 104 LYS n 1 105 PRO n 1 106 ALA n 1 107 PRO n 1 108 LEU n 1 109 GLY n 1 110 LYS n 1 111 GLY n 1 112 THR n 1 113 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain H37RV _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'MYCOBACTERIUM TUBERCULOSIS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83332 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant 'Rosetta pLySS' _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PETM11 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 PDB 2CGQ 1 ? ? 2CGQ ? 2 UNP P71603_MYCTU 1 ? ? P71603 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2CGQ A 1 ? 26 ? 2CGQ -25 ? 0 ? -25 0 2 2 2CGQ A 27 ? 113 ? P71603 1 ? 87 ? 1 87 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2CGQ _struct_ref_seq_dif.mon_id GLU _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 28 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P71603 _struct_ref_seq_dif.db_mon_id LYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 2 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 2 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2CGQ _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.8 _exptl_crystal.density_percent_sol 31.5 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.50 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '0.1M BIS-TRIS PH6.5, 0.2M NACL, 25%(W/V)PEG3350, pH 6.50' # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2005-09-23 _diffrn_detector.details MIRROR # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'FOCUSSING SILICON CRYSTAL' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.8075 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'EMBL/DESY, HAMBURG BEAMLINE X13' _diffrn_source.pdbx_synchrotron_site 'EMBL/DESY, HAMBURG' _diffrn_source.pdbx_synchrotron_beamline X13 _diffrn_source.pdbx_wavelength 0.8075 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2CGQ _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 39.160 _reflns.d_resolution_high 1.830 _reflns.number_obs 8555 _reflns.number_all ? _reflns.percent_possible_obs 98.8 _reflns.pdbx_Rmerge_I_obs 0.03000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 35.7400 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 6.250 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.83 _reflns_shell.d_res_low 1.95 _reflns_shell.percent_possible_all 96.4 _reflns_shell.Rmerge_I_obs 0.20000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 9.190 _reflns_shell.pdbx_redundancy 5.54 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2CGQ _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.ls_number_reflns_obs 7690 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 39.16 _refine.ls_d_res_high 1.83 _refine.ls_percent_reflns_obs 99.9 _refine.ls_R_factor_obs 0.182 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.179 _refine.ls_R_factor_R_free 0.217 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.700 _refine.ls_number_reflns_R_free 829 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.952 _refine.correlation_coeff_Fo_to_Fc_free 0.938 _refine.B_iso_mean 26.72 _refine.aniso_B[1][1] 0.59000 _refine.aniso_B[2][2] 0.59000 _refine.aniso_B[3][3] -0.89000 _refine.aniso_B[1][2] 0.30000 _refine.aniso_B[1][3] 0.00000 _refine.aniso_B[2][3] 0.00000 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' _refine.pdbx_starting_model 'PDB ENTRY 1T8K' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.123 _refine.pdbx_overall_ESU_R_Free 0.121 _refine.overall_SU_ML 0.073 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 4.464 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 589 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 64 _refine_hist.number_atoms_total 653 _refine_hist.d_res_high 1.83 _refine_hist.d_res_low 39.16 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.019 0.022 ? 613 'X-RAY DIFFRACTION' ? r_bond_other_d 0.001 0.020 ? 567 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.533 1.941 ? 833 'X-RAY DIFFRACTION' ? r_angle_other_deg 0.859 3.000 ? 1312 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.286 5.000 ? 75 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 34.454 25.455 ? 33 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 12.242 15.000 ? 109 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 21.039 15.000 ? 4 'X-RAY DIFFRACTION' ? r_chiral_restr 0.088 0.200 ? 101 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.007 0.020 ? 686 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.002 0.020 ? 125 'X-RAY DIFFRACTION' ? r_nbd_refined 0.226 0.200 ? 127 'X-RAY DIFFRACTION' ? r_nbd_other 0.164 0.200 ? 600 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.182 0.200 ? 323 'X-RAY DIFFRACTION' ? r_nbtor_other 0.083 0.200 ? 379 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.221 0.200 ? 52 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.142 0.200 ? 2 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 0.362 0.200 ? 31 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.256 0.200 ? 6 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.230 1.500 ? 489 'X-RAY DIFFRACTION' ? r_mcbond_other 0.322 1.500 ? 155 'X-RAY DIFFRACTION' ? r_mcangle_it 1.459 2.000 ? 610 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 2.625 3.000 ? 272 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it 3.650 4.500 ? 223 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.83 _refine_ls_shell.d_res_low 1.88 _refine_ls_shell.number_reflns_R_work 519 _refine_ls_shell.R_factor_R_work 0.2760 _refine_ls_shell.percent_reflns_obs 98.45 _refine_ls_shell.R_factor_R_free 0.3540 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 54 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 2CGQ _struct.title 'a putative acyl carrier protein(Rv0033) from Mycobacterium tuberculosis' _struct.pdbx_descriptor 'ACYL CARRIER PROTEIN ACPA' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2CGQ _struct_keywords.pdbx_keywords 'PROTEIN TRANSPORT' _struct_keywords.text 'RV0033, ACYL CARRIER PROTEIN, PROTEIN TRANSPORT, PHOSPHOPANTETHEINE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 26 ? ARG A 40 ? ALA A 0 ARG A 14 1 ? 15 HELX_P HELX_P2 2 ASP A 58 ? ASP A 74 ? ASP A 32 ASP A 48 1 ? 17 HELX_P HELX_P3 3 SER A 78 ? ILE A 85 ? SER A 52 ILE A 59 1 ? 8 HELX_P HELX_P4 4 THR A 87 ? VAL A 97 ? THR A 61 VAL A 71 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2CGQ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2CGQ _atom_sites.fract_transf_matrix[1][1] 0.022113 _atom_sites.fract_transf_matrix[1][2] 0.012767 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.025534 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012796 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -25 ? ? ? A . n A 1 2 LYS 2 -24 ? ? ? A . n A 1 3 HIS 3 -23 ? ? ? A . n A 1 4 HIS 4 -22 ? ? ? A . n A 1 5 HIS 5 -21 ? ? ? A . n A 1 6 HIS 6 -20 ? ? ? A . n A 1 7 HIS 7 -19 ? ? ? A . n A 1 8 HIS 8 -18 ? ? ? A . n A 1 9 PRO 9 -17 ? ? ? A . n A 1 10 MET 10 -16 ? ? ? A . n A 1 11 SER 11 -15 ? ? ? A . n A 1 12 ASP 12 -14 ? ? ? A . n A 1 13 TYR 13 -13 ? ? ? A . n A 1 14 ASP 14 -12 ? ? ? A . n A 1 15 ILE 15 -11 ? ? ? A . n A 1 16 PRO 16 -10 ? ? ? A . n A 1 17 THR 17 -9 ? ? ? A . n A 1 18 THR 18 -8 ? ? ? A . n A 1 19 GLU 19 -7 ? ? ? A . n A 1 20 ASN 20 -6 ? ? ? A . n A 1 21 LEU 21 -5 ? ? ? A . n A 1 22 TYR 22 -4 ? ? ? A . n A 1 23 PHE 23 -3 ? ? ? A . n A 1 24 GLN 24 -2 ? ? ? A . n A 1 25 GLY 25 -1 ? ? ? A . n A 1 26 ALA 26 0 0 ALA ALA A . n A 1 27 MET 27 1 1 MET MET A . n A 1 28 GLU 28 2 2 GLU GLU A . n A 1 29 GLU 29 3 3 GLU GLU A . n A 1 30 ALA 30 4 4 ALA ALA A . n A 1 31 ILE 31 5 5 ILE ILE A . n A 1 32 ASN 32 6 6 ASN ASN A . n A 1 33 ALA 33 7 7 ALA ALA A . n A 1 34 THR 34 8 8 THR THR A . n A 1 35 ILE 35 9 9 ILE ILE A . n A 1 36 GLN 36 10 10 GLN GLN A . n A 1 37 ARG 37 11 11 ARG ARG A . n A 1 38 ILE 38 12 12 ILE ILE A . n A 1 39 LEU 39 13 13 LEU LEU A . n A 1 40 ARG 40 14 14 ARG ARG A . n A 1 41 THR 41 15 15 THR THR A . n A 1 42 ASP 42 16 16 ASP ASP A . n A 1 43 ARG 43 17 17 ARG ARG A . n A 1 44 GLY 44 18 18 GLY GLY A . n A 1 45 ILE 45 19 19 ILE ILE A . n A 1 46 THR 46 20 20 THR THR A . n A 1 47 ALA 47 21 21 ALA ALA A . n A 1 48 ASN 48 22 22 ASN ASN A . n A 1 49 GLN 49 23 23 GLN GLN A . n A 1 50 VAL 50 24 24 VAL VAL A . n A 1 51 LEU 51 25 25 LEU LEU A . n A 1 52 VAL 52 26 26 VAL VAL A . n A 1 53 ASP 53 27 27 ASP ASP A . n A 1 54 ASP 54 28 28 ASP ASP A . n A 1 55 LEU 55 29 29 LEU LEU A . n A 1 56 GLY 56 30 30 GLY GLY A . n A 1 57 PHE 57 31 31 PHE PHE A . n A 1 58 ASP 58 32 32 ASP ASP A . n A 1 59 SER 59 33 33 SER SER A . n A 1 60 LEU 60 34 34 LEU LEU A . n A 1 61 LYS 61 35 35 LYS LYS A . n A 1 62 LEU 62 36 36 LEU LEU A . n A 1 63 PHE 63 37 37 PHE PHE A . n A 1 64 GLN 64 38 38 GLN GLN A . n A 1 65 LEU 65 39 39 LEU LEU A . n A 1 66 ILE 66 40 40 ILE ILE A . n A 1 67 THR 67 41 41 THR THR A . n A 1 68 GLU 68 42 42 GLU GLU A . n A 1 69 LEU 69 43 43 LEU LEU A . n A 1 70 GLU 70 44 44 GLU GLU A . n A 1 71 ASP 71 45 45 ASP ASP A . n A 1 72 GLU 72 46 46 GLU GLU A . n A 1 73 PHE 73 47 47 PHE PHE A . n A 1 74 ASP 74 48 48 ASP ASP A . n A 1 75 ILE 75 49 49 ILE ILE A . n A 1 76 ALA 76 50 50 ALA ALA A . n A 1 77 ILE 77 51 51 ILE ILE A . n A 1 78 SER 78 52 52 SER SER A . n A 1 79 PHE 79 53 53 PHE PHE A . n A 1 80 ARG 80 54 54 ARG ARG A . n A 1 81 ASP 81 55 55 ASP ASP A . n A 1 82 ALA 82 56 56 ALA ALA A . n A 1 83 GLN 83 57 57 GLN GLN A . n A 1 84 ASN 84 58 58 ASN ASN A . n A 1 85 ILE 85 59 59 ILE ILE A . n A 1 86 LYS 86 60 60 LYS LYS A . n A 1 87 THR 87 61 61 THR THR A . n A 1 88 VAL 88 62 62 VAL VAL A . n A 1 89 GLY 89 63 63 GLY GLY A . n A 1 90 ASP 90 64 64 ASP ASP A . n A 1 91 VAL 91 65 65 VAL VAL A . n A 1 92 TYR 92 66 66 TYR TYR A . n A 1 93 THR 93 67 67 THR THR A . n A 1 94 SER 94 68 68 SER SER A . n A 1 95 VAL 95 69 69 VAL VAL A . n A 1 96 ALA 96 70 70 ALA ALA A . n A 1 97 VAL 97 71 71 VAL VAL A . n A 1 98 TRP 98 72 72 TRP TRP A . n A 1 99 PHE 99 73 73 PHE PHE A . n A 1 100 PRO 100 74 ? ? ? A . n A 1 101 GLU 101 75 ? ? ? A . n A 1 102 THR 102 76 ? ? ? A . n A 1 103 ALA 103 77 ? ? ? A . n A 1 104 LYS 104 78 ? ? ? A . n A 1 105 PRO 105 79 ? ? ? A . n A 1 106 ALA 106 80 ? ? ? A . n A 1 107 PRO 107 81 ? ? ? A . n A 1 108 LEU 108 82 ? ? ? A . n A 1 109 GLY 109 83 ? ? ? A . n A 1 110 LYS 110 84 ? ? ? A . n A 1 111 GLY 111 85 ? ? ? A . n A 1 112 THR 112 86 ? ? ? A . n A 1 113 ALA 113 87 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 2001 2001 HOH HOH A . B 2 HOH 2 2002 2002 HOH HOH A . B 2 HOH 3 2003 2003 HOH HOH A . B 2 HOH 4 2004 2004 HOH HOH A . B 2 HOH 5 2005 2005 HOH HOH A . B 2 HOH 6 2006 2006 HOH HOH A . B 2 HOH 7 2007 2007 HOH HOH A . B 2 HOH 8 2008 2008 HOH HOH A . B 2 HOH 9 2009 2009 HOH HOH A . B 2 HOH 10 2010 2010 HOH HOH A . B 2 HOH 11 2011 2011 HOH HOH A . B 2 HOH 12 2012 2012 HOH HOH A . B 2 HOH 13 2013 2013 HOH HOH A . B 2 HOH 14 2014 2014 HOH HOH A . B 2 HOH 15 2015 2015 HOH HOH A . B 2 HOH 16 2016 2016 HOH HOH A . B 2 HOH 17 2017 2017 HOH HOH A . B 2 HOH 18 2018 2018 HOH HOH A . B 2 HOH 19 2019 2019 HOH HOH A . B 2 HOH 20 2020 2020 HOH HOH A . B 2 HOH 21 2021 2021 HOH HOH A . B 2 HOH 22 2022 2022 HOH HOH A . B 2 HOH 23 2023 2023 HOH HOH A . B 2 HOH 24 2024 2024 HOH HOH A . B 2 HOH 25 2025 2025 HOH HOH A . B 2 HOH 26 2026 2026 HOH HOH A . B 2 HOH 27 2027 2027 HOH HOH A . B 2 HOH 28 2028 2028 HOH HOH A . B 2 HOH 29 2029 2029 HOH HOH A . B 2 HOH 30 2030 2030 HOH HOH A . B 2 HOH 31 2031 2031 HOH HOH A . B 2 HOH 32 2032 2032 HOH HOH A . B 2 HOH 33 2033 2033 HOH HOH A . B 2 HOH 34 2034 2034 HOH HOH A . B 2 HOH 35 2035 2035 HOH HOH A . B 2 HOH 36 2036 2036 HOH HOH A . B 2 HOH 37 2037 2037 HOH HOH A . B 2 HOH 38 2038 2038 HOH HOH A . B 2 HOH 39 2039 2039 HOH HOH A . B 2 HOH 40 2040 2040 HOH HOH A . B 2 HOH 41 2041 2041 HOH HOH A . B 2 HOH 42 2042 2042 HOH HOH A . B 2 HOH 43 2043 2043 HOH HOH A . B 2 HOH 44 2044 2044 HOH HOH A . B 2 HOH 45 2045 2045 HOH HOH A . B 2 HOH 46 2046 2046 HOH HOH A . B 2 HOH 47 2047 2047 HOH HOH A . B 2 HOH 48 2048 2048 HOH HOH A . B 2 HOH 49 2049 2049 HOH HOH A . B 2 HOH 50 2050 2050 HOH HOH A . B 2 HOH 51 2051 2051 HOH HOH A . B 2 HOH 52 2052 2052 HOH HOH A . B 2 HOH 53 2053 2053 HOH HOH A . B 2 HOH 54 2054 2054 HOH HOH A . B 2 HOH 55 2055 2055 HOH HOH A . B 2 HOH 56 2056 2056 HOH HOH A . B 2 HOH 57 2057 2057 HOH HOH A . B 2 HOH 58 2058 2058 HOH HOH A . B 2 HOH 59 2059 2059 HOH HOH A . B 2 HOH 60 2060 2060 HOH HOH A . B 2 HOH 61 2061 2061 HOH HOH A . B 2 HOH 62 2062 2062 HOH HOH A . B 2 HOH 63 2063 2063 HOH HOH A . B 2 HOH 64 2064 2064 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-05-01 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-07-12 4 'Structure model' 1 3 2018-03-07 5 'Structure model' 1 4 2019-07-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Version format compliance' 3 3 'Structure model' 'Refinement description' 4 4 'Structure model' 'Source and taxonomy' 5 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 4 'Structure model' entity_src_gen 3 5 'Structure model' diffrn_source # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_software.name' 2 4 'Structure model' '_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id' 3 4 'Structure model' '_entity_src_gen.pdbx_host_org_scientific_name' 4 4 'Structure model' '_entity_src_gen.pdbx_host_org_strain' 5 4 'Structure model' '_entity_src_gen.pdbx_host_org_variant' 6 5 'Structure model' '_diffrn_source.pdbx_synchrotron_site' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 12.2581 _pdbx_refine_tls.origin_y 14.4889 _pdbx_refine_tls.origin_z 26.1412 _pdbx_refine_tls.T[1][1] -0.0127 _pdbx_refine_tls.T[2][2] -0.0731 _pdbx_refine_tls.T[3][3] -0.0554 _pdbx_refine_tls.T[1][2] 0.0173 _pdbx_refine_tls.T[1][3] -0.0222 _pdbx_refine_tls.T[2][3] -0.0124 _pdbx_refine_tls.L[1][1] 2.1444 _pdbx_refine_tls.L[2][2] 1.7451 _pdbx_refine_tls.L[3][3] 2.3848 _pdbx_refine_tls.L[1][2] -0.8039 _pdbx_refine_tls.L[1][3] -0.8057 _pdbx_refine_tls.L[2][3] 0.6713 _pdbx_refine_tls.S[1][1] 0.1575 _pdbx_refine_tls.S[1][2] 0.0886 _pdbx_refine_tls.S[1][3] -0.0983 _pdbx_refine_tls.S[2][1] -0.2522 _pdbx_refine_tls.S[2][2] -0.0360 _pdbx_refine_tls.S[2][3] -0.0379 _pdbx_refine_tls.S[3][1] 0.0606 _pdbx_refine_tls.S[3][2] -0.0892 _pdbx_refine_tls.S[3][3] -0.1215 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 0 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 73 _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0005 ? 1 DENZO 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 CaspR phasing . ? 4 # _pdbx_entry_details.entry_id 2CGQ _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;OWING TO GENE CONSTRUCTION METHOD, SOME FOREIGN RESIDUES ARE INTRODUCED INTO THE N-TERMINAL. RESIDUES WITH POOR ELECTRON DENSITY ARE NOT BUILT INTO THE MODEL. ; # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 A GLU 42 ? B O A HOH 2036 ? ? 1.91 2 1 O A HOH 2039 ? ? O A HOH 2048 ? ? 1.98 3 1 O A HOH 2001 ? ? O A HOH 2017 ? ? 2.19 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 2048 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 2048 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 4_556 _pdbx_validate_symm_contact.dist 2.17 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 2004 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 5.98 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -25 ? A MET 1 2 1 Y 1 A LYS -24 ? A LYS 2 3 1 Y 1 A HIS -23 ? A HIS 3 4 1 Y 1 A HIS -22 ? A HIS 4 5 1 Y 1 A HIS -21 ? A HIS 5 6 1 Y 1 A HIS -20 ? A HIS 6 7 1 Y 1 A HIS -19 ? A HIS 7 8 1 Y 1 A HIS -18 ? A HIS 8 9 1 Y 1 A PRO -17 ? A PRO 9 10 1 Y 1 A MET -16 ? A MET 10 11 1 Y 1 A SER -15 ? A SER 11 12 1 Y 1 A ASP -14 ? A ASP 12 13 1 Y 1 A TYR -13 ? A TYR 13 14 1 Y 1 A ASP -12 ? A ASP 14 15 1 Y 1 A ILE -11 ? A ILE 15 16 1 Y 1 A PRO -10 ? A PRO 16 17 1 Y 1 A THR -9 ? A THR 17 18 1 Y 1 A THR -8 ? A THR 18 19 1 Y 1 A GLU -7 ? A GLU 19 20 1 Y 1 A ASN -6 ? A ASN 20 21 1 Y 1 A LEU -5 ? A LEU 21 22 1 Y 1 A TYR -4 ? A TYR 22 23 1 Y 1 A PHE -3 ? A PHE 23 24 1 Y 1 A GLN -2 ? A GLN 24 25 1 Y 1 A GLY -1 ? A GLY 25 26 1 Y 1 A PRO 74 ? A PRO 100 27 1 Y 1 A GLU 75 ? A GLU 101 28 1 Y 1 A THR 76 ? A THR 102 29 1 Y 1 A ALA 77 ? A ALA 103 30 1 Y 1 A LYS 78 ? A LYS 104 31 1 Y 1 A PRO 79 ? A PRO 105 32 1 Y 1 A ALA 80 ? A ALA 106 33 1 Y 1 A PRO 81 ? A PRO 107 34 1 Y 1 A LEU 82 ? A LEU 108 35 1 Y 1 A GLY 83 ? A GLY 109 36 1 Y 1 A LYS 84 ? A LYS 110 37 1 Y 1 A GLY 85 ? A GLY 111 38 1 Y 1 A THR 86 ? A THR 112 39 1 Y 1 A ALA 87 ? A ALA 113 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #