data_2CNR # _entry.id 2CNR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2CNR PDBE EBI-28843 WWPDB D_1290028843 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2CNR _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2006-05-23 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Pottage, K.' 1 'Williams, C.' 2 'Crump, M.P.' 3 # _citation.id primary _citation.title 'Structure and Malonyl Coa-Acp Transacylase Binding of Streptomyces Coelicolor Fatty Acid Synthase Acyl Carrier Protein.' _citation.journal_abbrev 'Acs Chem.Biol.' _citation.journal_volume 4 _citation.page_first 625 _citation.page_last ? _citation.year 2009 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1554-8929 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19555075 _citation.pdbx_database_id_DOI 10.1021/CB900099E # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Arthur, C.J.' 1 primary 'Williams, C.' 2 primary 'Pottage, K.' 3 primary 'Ploskon, E.' 4 primary 'Findlow, S.C.' 5 primary 'Burston, S.G.' 6 primary 'Simpson, T.J.' 7 primary 'Crump, M.P.' 8 primary 'Crosby, J.' 9 # _cell.entry_id 2CNR _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2CNR _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'ACYL CARRIER PROTEIN' _entity.formula_weight 8924.971 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'FAS, ACP' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAATQEEIVAGLAEIVNEIAGIPVEDVKLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPDDDVKNLKTVGDATKYILDH QA ; _entity_poly.pdbx_seq_one_letter_code_can ;MAATQEEIVAGLAEIVNEIAGIPVEDVKLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPDDDVKNLKTVGDATKYILDH QA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ALA n 1 4 THR n 1 5 GLN n 1 6 GLU n 1 7 GLU n 1 8 ILE n 1 9 VAL n 1 10 ALA n 1 11 GLY n 1 12 LEU n 1 13 ALA n 1 14 GLU n 1 15 ILE n 1 16 VAL n 1 17 ASN n 1 18 GLU n 1 19 ILE n 1 20 ALA n 1 21 GLY n 1 22 ILE n 1 23 PRO n 1 24 VAL n 1 25 GLU n 1 26 ASP n 1 27 VAL n 1 28 LYS n 1 29 LEU n 1 30 ASP n 1 31 LYS n 1 32 SER n 1 33 PHE n 1 34 THR n 1 35 ASP n 1 36 ASP n 1 37 LEU n 1 38 ASP n 1 39 VAL n 1 40 ASP n 1 41 SER n 1 42 LEU n 1 43 SER n 1 44 MET n 1 45 VAL n 1 46 GLU n 1 47 VAL n 1 48 VAL n 1 49 VAL n 1 50 ALA n 1 51 ALA n 1 52 GLU n 1 53 GLU n 1 54 ARG n 1 55 PHE n 1 56 ASP n 1 57 VAL n 1 58 LYS n 1 59 ILE n 1 60 PRO n 1 61 ASP n 1 62 ASP n 1 63 ASP n 1 64 VAL n 1 65 LYS n 1 66 ASN n 1 67 LEU n 1 68 LYS n 1 69 THR n 1 70 VAL n 1 71 GLY n 1 72 ASP n 1 73 ALA n 1 74 THR n 1 75 LYS n 1 76 TYR n 1 77 ILE n 1 78 LEU n 1 79 ASP n 1 80 HIS n 1 81 GLN n 1 82 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'A3(2)' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'STREPTOMYCES COELICOLOR' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 100226 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code P72393_STRCO _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P72393 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2CNR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 82 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P72393 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 82 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 82 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 NOESY 1 2 1 HNHA 1 3 1 CBCACONH 1 4 1 HNCA 1 5 1 HNCACB 1 6 1 HNCO 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298.0 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1.0 _pdbx_nmr_exptl_sample_conditions.pH 5.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '95% WATER/5% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 2CNR _pdbx_nmr_refine.method ARIA _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2CNR _pdbx_nmr_details.text 'THE STRUCTURE WAS DETERMINED USING TRIPLE-RESONANCE NMR SPECTROSCOPY ON UNLABELLED, 15N-LABELLED AND 13C, 15N- LABELLED SCFAS ACP.' # _pdbx_nmr_ensemble.entry_id 2CNR _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'LOWEST ENERGY, LEAST VIOLATION' # _pdbx_nmr_representative.entry_id 2CNR _pdbx_nmr_representative.conformer_id 17 _pdbx_nmr_representative.selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement ARIA1.2 ? 'BRUNGER,ADAMS,CLORE,DELANO,GROS, GROSSE- KUNSTLEVE,JIANG,KUSZEWSKI,NILGES, PANNU,READ, RICE,SIMONSON,WARREN' 1 'structure solution' NMRPIPE ? ? 2 'structure solution' SPARKY ? ? 3 # _exptl.entry_id 2CNR _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2CNR _struct.title 'Structural studies on the interaction of ScFAS ACP with ACPS' _struct.pdbx_descriptor 'ACYL CARRIER PROTEIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2CNR _struct_keywords.pdbx_keywords 'LIPID TRANSPORT' _struct_keywords.text 'ACP, FAS, POLYKDETIDE, PHOSPHOPANTETHEINE, LIPID TRANSPORT' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 4 ? ALA A 20 ? THR A 4 ALA A 20 1 ? 17 HELX_P HELX_P2 2 ASP A 40 ? GLU A 53 ? ASP A 40 GLU A 53 1 ? 14 HELX_P HELX_P3 3 ARG A 54 ? ASP A 56 ? ARG A 54 ASP A 56 5 ? 3 HELX_P HELX_P4 4 PRO A 60 ? ASN A 66 ? PRO A 60 ASN A 66 5 ? 7 HELX_P HELX_P5 5 THR A 69 ? HIS A 80 ? THR A 69 HIS A 80 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2CNR _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2CNR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 ALA 82 82 82 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-06-05 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HD12 A LEU 67 ? ? HB2 A ALA 73 ? ? 1.34 2 1 H3 A MET 1 ? ? O A ALA 82 ? ? 1.58 3 2 HD12 A LEU 67 ? ? HB2 A ALA 73 ? ? 1.27 4 2 OE1 A GLU 52 ? ? H A ILE 59 ? ? 1.55 5 3 OE2 A GLU 52 ? ? HZ3 A LYS 58 ? ? 1.60 6 4 O A VAL 70 ? ? HG1 A THR 74 ? ? 1.59 7 5 HE1 A MET 44 ? ? HA A LYS 65 ? ? 1.28 8 6 OE1 A GLU 53 ? ? HZ1 A LYS 58 ? ? 1.59 9 6 HG1 A THR 69 ? ? OD2 A ASP 72 ? ? 1.60 10 7 HG22 A ILE 15 ? ? HB1 A ALA 51 ? ? 1.34 11 11 OD2 A ASP 26 ? ? HZ2 A LYS 31 ? ? 1.55 12 11 OE1 A GLU 52 ? ? H A ILE 59 ? ? 1.58 13 13 HE2 A MET 44 ? ? HA A LYS 65 ? ? 1.16 14 13 HA A ASP 62 ? ? HE3 A LYS 65 ? ? 1.26 15 14 HE2 A MET 44 ? ? HA A LYS 65 ? ? 1.31 16 15 HE1 A MET 44 ? ? HA A LYS 65 ? ? 1.32 17 15 O A VAL 70 ? ? HG1 A THR 74 ? ? 1.58 18 15 H3 A MET 1 ? ? OD1 A ASP 56 ? ? 1.58 19 16 HA3 A GLY 11 ? ? HZ A PHE 55 ? ? 1.34 20 17 HG23 A ILE 15 ? ? HB1 A ALA 51 ? ? 1.34 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 20 ? ? -125.22 -87.17 2 1 ASP A 35 ? ? -93.88 -68.85 3 1 ASP A 56 ? ? 65.23 67.92 4 2 ALA A 20 ? ? -129.86 -86.18 5 2 ASP A 35 ? ? -92.22 -66.23 6 3 ALA A 20 ? ? -126.99 -84.48 7 4 ALA A 20 ? ? -127.75 -76.40 8 4 ASP A 35 ? ? -92.76 -69.84 9 5 ALA A 20 ? ? -125.83 -77.75 10 5 ASP A 35 ? ? -92.18 -68.10 11 6 ALA A 20 ? ? -133.41 -78.05 12 6 ASP A 35 ? ? -92.75 -65.18 13 7 ALA A 20 ? ? -130.74 -88.26 14 8 ALA A 20 ? ? -129.13 -91.64 15 8 ASP A 35 ? ? -91.73 -68.06 16 8 ASP A 56 ? ? 57.45 70.54 17 9 ALA A 20 ? ? -126.89 -84.93 18 10 ALA A 20 ? ? -130.51 -77.75 19 11 THR A 4 ? ? -77.11 -165.29 20 11 ALA A 20 ? ? -123.81 -82.03 21 11 ASP A 35 ? ? -91.50 -69.01 22 12 ALA A 20 ? ? -131.06 -93.70 23 12 ASP A 56 ? ? 54.71 70.74 24 13 THR A 4 ? ? -89.33 -158.89 25 13 ALA A 20 ? ? -124.47 -93.12 26 13 ASP A 35 ? ? -92.42 -69.25 27 13 ASP A 56 ? ? 57.04 70.93 28 14 THR A 4 ? ? -73.05 -168.49 29 14 ALA A 20 ? ? -127.87 -84.70 30 14 ASP A 35 ? ? -91.59 -68.68 31 15 ALA A 20 ? ? -132.34 -86.81 32 15 ASP A 35 ? ? -92.13 -65.53 33 16 ALA A 20 ? ? -132.24 -86.14 34 16 ASP A 35 ? ? -91.67 -65.89 35 16 ASP A 56 ? ? 60.38 68.36 36 17 ALA A 20 ? ? -123.13 -89.34 37 17 ASP A 35 ? ? -92.68 -68.73 38 18 ALA A 20 ? ? -131.46 -75.14 39 18 ASP A 35 ? ? -94.14 -68.35 40 19 ALA A 20 ? ? -122.78 -84.90 41 19 ASP A 35 ? ? -92.01 -60.65 42 19 ASP A 38 ? ? 60.12 67.92 43 20 ALA A 20 ? ? -127.34 -88.58 44 20 ASP A 35 ? ? -91.99 -69.51 #