data_2COC # _entry.id 2COC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2COC pdb_00002coc 10.2210/pdb2coc/pdb RCSB RCSB024444 ? ? WWPDB D_1000024444 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002021744.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2COC _pdbx_database_status.recvd_initial_deposition_date 2005-05-17 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Li, H.' 1 'Tomizawa, T.' 2 'Tochio, N.' 3 'Muto, Y.' 4 'Koshiba, S.' 5 'Inoue, M.' 6 'Kigawa, T.' 7 'Yokoyama, S.' 8 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 9 # _citation.id primary _citation.title 'Solution structure of the C-terminal PH domain of FYVE, RhoGEF and PH domain containing protein 3 (FGD3) from human' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Li, H.' 1 ? primary 'Tomizawa, T.' 2 ? primary 'Tochio, N.' 3 ? primary 'Muto, Y.' 4 ? primary 'Koshiba, S.' 5 ? primary 'Inoue, M.' 6 ? primary 'Kigawa, T.' 7 ? primary 'Yokoyama, S.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'FYVE, RhoGEF and PH domain containing protein 3' _entity.formula_weight 12008.257 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'PH domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Zinc finger FYVE domain containing protein 5' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGSLLCGPLRLSESGETWSEVWAAIPMSDPQVLHLQGGSQDGRLPRTIPLPSCKLSVPDPEERLDSGHVWKLQWA KQSWYLSASSAELQQQWLETLSTAAHSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGSLLCGPLRLSESGETWSEVWAAIPMSDPQVLHLQGGSQDGRLPRTIPLPSCKLSVPDPEERLDSGHVWKLQWA KQSWYLSASSAELQQQWLETLSTAAHSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002021744.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 SER n 1 9 LEU n 1 10 LEU n 1 11 CYS n 1 12 GLY n 1 13 PRO n 1 14 LEU n 1 15 ARG n 1 16 LEU n 1 17 SER n 1 18 GLU n 1 19 SER n 1 20 GLY n 1 21 GLU n 1 22 THR n 1 23 TRP n 1 24 SER n 1 25 GLU n 1 26 VAL n 1 27 TRP n 1 28 ALA n 1 29 ALA n 1 30 ILE n 1 31 PRO n 1 32 MET n 1 33 SER n 1 34 ASP n 1 35 PRO n 1 36 GLN n 1 37 VAL n 1 38 LEU n 1 39 HIS n 1 40 LEU n 1 41 GLN n 1 42 GLY n 1 43 GLY n 1 44 SER n 1 45 GLN n 1 46 ASP n 1 47 GLY n 1 48 ARG n 1 49 LEU n 1 50 PRO n 1 51 ARG n 1 52 THR n 1 53 ILE n 1 54 PRO n 1 55 LEU n 1 56 PRO n 1 57 SER n 1 58 CYS n 1 59 LYS n 1 60 LEU n 1 61 SER n 1 62 VAL n 1 63 PRO n 1 64 ASP n 1 65 PRO n 1 66 GLU n 1 67 GLU n 1 68 ARG n 1 69 LEU n 1 70 ASP n 1 71 SER n 1 72 GLY n 1 73 HIS n 1 74 VAL n 1 75 TRP n 1 76 LYS n 1 77 LEU n 1 78 GLN n 1 79 TRP n 1 80 ALA n 1 81 LYS n 1 82 GLN n 1 83 SER n 1 84 TRP n 1 85 TYR n 1 86 LEU n 1 87 SER n 1 88 ALA n 1 89 SER n 1 90 SER n 1 91 ALA n 1 92 GLU n 1 93 LEU n 1 94 GLN n 1 95 GLN n 1 96 GLN n 1 97 TRP n 1 98 LEU n 1 99 GLU n 1 100 THR n 1 101 LEU n 1 102 SER n 1 103 THR n 1 104 ALA n 1 105 ALA n 1 106 HIS n 1 107 SER n 1 108 GLY n 1 109 PRO n 1 110 SER n 1 111 SER n 1 112 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene FGD3 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050125-03 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FGD3_HUMAN _struct_ref.pdbx_db_accession Q5JSP0 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SLLCGPLRLSESGETWSEVWAAIPMSDPQVLHLQGGSQDGRLPRTIPLPSCKLSVPDPEERLDSGHVWKLQWAKQSWYLS ASSAELQQQWLETLSTAAH ; _struct_ref.pdbx_align_begin 605 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2COC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 106 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5JSP0 _struct_ref_seq.db_align_beg 605 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 703 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 106 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2COC GLY A 1 ? UNP Q5JSP0 ? ? 'cloning artifact' 1 1 1 2COC SER A 2 ? UNP Q5JSP0 ? ? 'cloning artifact' 2 2 1 2COC SER A 3 ? UNP Q5JSP0 ? ? 'cloning artifact' 3 3 1 2COC GLY A 4 ? UNP Q5JSP0 ? ? 'cloning artifact' 4 4 1 2COC SER A 5 ? UNP Q5JSP0 ? ? 'cloning artifact' 5 5 1 2COC SER A 6 ? UNP Q5JSP0 ? ? 'cloning artifact' 6 6 1 2COC GLY A 7 ? UNP Q5JSP0 ? ? 'cloning artifact' 7 7 1 2COC SER A 107 ? UNP Q5JSP0 ? ? 'cloning artifact' 107 8 1 2COC GLY A 108 ? UNP Q5JSP0 ? ? 'cloning artifact' 108 9 1 2COC PRO A 109 ? UNP Q5JSP0 ? ? 'cloning artifact' 109 10 1 2COC SER A 110 ? UNP Q5JSP0 ? ? 'cloning artifact' 110 11 1 2COC SER A 111 ? UNP Q5JSP0 ? ? 'cloning artifact' 111 12 1 2COC GLY A 112 ? UNP Q5JSP0 ? ? 'cloning artifact' 112 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.20mM PH domain U-13C, 15N; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2COC _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2COC _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function,structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2COC _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 2.6 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B. A.' 3 'data analysis' KUJIRA 0.9295 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2COC _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2COC _struct.title 'Solution structure of the C-terminal PH domain of FYVE, RhoGEF and PH domain containing protein 3 (FGD3) from human' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2COC _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text ;FYVE, RhoGEF and PH domain containing protein 3, PH domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ALA _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 91 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ALA _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 105 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ALA _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 91 _struct_conf.end_auth_comp_id ALA _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 105 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 51 ? ILE A 53 ? ARG A 51 ILE A 53 A 2 VAL A 37 ? GLN A 41 ? VAL A 37 GLN A 41 A 3 TRP A 23 ? PRO A 31 ? TRP A 23 PRO A 31 A 4 CYS A 11 ? SER A 17 ? CYS A 11 SER A 17 A 5 GLN A 82 ? ALA A 88 ? GLN A 82 ALA A 88 A 6 HIS A 73 ? TRP A 79 ? HIS A 73 TRP A 79 A 7 LYS A 59 ? SER A 61 ? LYS A 59 SER A 61 # _database_PDB_matrix.entry_id 2COC _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2COC _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 TRP 23 23 23 TRP TRP A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 TRP 27 27 27 TRP TRP A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 MET 32 32 32 MET MET A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 CYS 58 58 58 CYS CYS A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 TRP 75 75 75 TRP TRP A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 TRP 79 79 79 TRP TRP A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 TRP 84 84 84 TRP TRP A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 GLN 94 94 94 GLN GLN A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 TRP 97 97 97 TRP TRP A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 HIS 106 106 106 HIS HIS A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 PRO 109 109 109 PRO PRO A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 GLY 112 112 112 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-17 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_database_remark.id _pdbx_database_remark.text 650 ;HELIX DETERMINATION METHOD: AUTHOR DETERMINED ; 700 ;SHEET DETERMINATION METHOD: AUTHOR DETERMINED ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 8 ? ? -38.73 139.28 2 1 GLU A 21 ? ? -121.84 -56.45 3 1 LEU A 49 ? ? -35.73 145.45 4 1 GLU A 67 ? ? -46.27 166.64 5 1 ARG A 68 ? ? -102.87 44.06 6 1 SER A 110 ? ? -67.90 92.40 7 2 SER A 5 ? ? -103.43 42.81 8 2 GLU A 21 ? ? -128.20 -53.91 9 2 LEU A 49 ? ? -43.21 103.34 10 2 PRO A 56 ? ? -48.00 -17.11 11 2 LEU A 69 ? ? -58.89 -179.85 12 2 SER A 83 ? ? -162.46 112.02 13 3 SER A 5 ? ? -84.33 45.98 14 3 GLU A 21 ? ? -97.48 -68.03 15 3 PRO A 63 ? ? -48.13 174.61 16 3 HIS A 106 ? ? -34.55 109.10 17 4 GLU A 21 ? ? -131.54 -44.67 18 4 LEU A 49 ? ? -33.67 96.98 19 4 PRO A 56 ? ? -47.99 -18.61 20 4 LEU A 69 ? ? -48.59 175.79 21 4 SER A 83 ? ? -160.81 118.37 22 4 SER A 110 ? ? -126.48 -50.77 23 5 SER A 6 ? ? -92.71 39.06 24 5 PRO A 56 ? ? -47.94 -17.33 25 6 SER A 44 ? ? -122.32 -61.91 26 6 LEU A 69 ? ? -43.67 166.65 27 6 SER A 111 ? ? -52.94 85.56 28 7 SER A 2 ? ? -86.07 49.26 29 7 SER A 5 ? ? -65.03 83.42 30 7 GLU A 21 ? ? -122.60 -63.75 31 7 LEU A 69 ? ? -58.26 173.91 32 7 PRO A 109 ? ? -45.58 162.66 33 8 SER A 44 ? ? -90.55 42.12 34 8 LEU A 49 ? ? -37.95 99.80 35 8 GLU A 67 ? ? -43.86 166.01 36 8 ASP A 70 ? ? -104.85 -61.91 37 8 SER A 71 ? ? -63.10 -175.08 38 8 SER A 89 ? ? -39.84 -38.27 39 8 PRO A 109 ? ? -74.91 47.22 40 9 SER A 2 ? ? -86.65 46.96 41 9 LEU A 49 ? ? -55.84 109.42 42 9 PRO A 56 ? ? -47.95 -17.26 43 9 LEU A 69 ? ? -49.05 176.47 44 9 PRO A 109 ? ? -47.02 172.42 45 10 GLU A 21 ? ? -128.22 -56.17 46 10 PRO A 56 ? ? -47.95 -17.91 47 10 PRO A 63 ? ? -48.29 173.34 48 10 SER A 83 ? ? -161.62 113.46 49 10 SER A 111 ? ? -131.72 -44.29 50 11 SER A 2 ? ? -133.15 -51.73 51 11 SER A 5 ? ? 35.54 43.99 52 11 GLU A 21 ? ? -102.86 -60.11 53 11 SER A 44 ? ? -131.41 -55.27 54 11 ARG A 68 ? ? -119.39 73.61 55 11 ASP A 70 ? ? -34.15 -74.96 56 11 SER A 71 ? ? -102.65 -75.06 57 11 SER A 83 ? ? -162.44 118.16 58 12 SER A 19 ? ? 37.99 35.21 59 12 GLU A 21 ? ? -126.38 -55.80 60 12 PRO A 54 ? ? -44.52 99.71 61 12 SER A 107 ? ? -61.33 80.95 62 12 SER A 111 ? ? 34.54 42.36 63 13 SER A 3 ? ? -55.56 106.25 64 13 PRO A 50 ? ? -48.11 90.16 65 13 GLU A 67 ? ? -54.12 171.43 66 13 HIS A 106 ? ? -102.66 77.27 67 14 SER A 8 ? ? -166.36 107.73 68 14 LEU A 10 ? ? -175.87 121.77 69 14 GLU A 21 ? ? -126.49 -52.93 70 14 SER A 44 ? ? -97.29 -60.42 71 14 ARG A 48 ? ? -91.76 47.17 72 14 SER A 83 ? ? -164.57 117.68 73 14 SER A 107 ? ? -166.71 115.28 74 14 PRO A 109 ? ? -45.55 96.58 75 15 PRO A 50 ? ? -48.90 101.31 76 15 PRO A 56 ? ? -48.01 -17.79 77 15 GLU A 67 ? ? -46.96 164.81 78 15 LEU A 69 ? ? -58.25 -175.35 79 15 ALA A 105 ? ? -90.91 32.32 80 15 SER A 107 ? ? -34.43 132.98 81 16 SER A 5 ? ? -37.96 128.90 82 16 LEU A 9 ? ? -36.24 -29.90 83 16 LEU A 10 ? ? -175.37 122.59 84 16 LEU A 49 ? ? -55.34 109.14 85 16 PRO A 50 ? ? -45.61 96.95 86 16 GLU A 67 ? ? -53.75 176.06 87 16 ASP A 70 ? ? -105.38 -61.80 88 16 SER A 71 ? ? -67.14 -175.12 89 16 SER A 83 ? ? -160.14 113.56 90 17 GLU A 21 ? ? -120.99 -61.20 91 17 ARG A 48 ? ? -111.84 52.15 92 17 PRO A 56 ? ? -47.96 -17.17 93 17 LEU A 69 ? ? -64.13 -177.02 94 17 SER A 83 ? ? -167.19 119.71 95 18 PRO A 50 ? ? -49.51 105.26 96 18 PRO A 54 ? ? -46.18 98.09 97 18 PRO A 63 ? ? -48.23 164.83 98 18 LEU A 69 ? ? -48.86 170.11 99 18 SER A 111 ? ? -64.86 88.68 100 19 SER A 3 ? ? -39.46 133.33 101 19 GLU A 21 ? ? -109.28 -64.75 102 19 SER A 44 ? ? -95.24 44.85 103 19 LEU A 49 ? ? -36.77 128.89 104 19 PRO A 56 ? ? -47.95 -19.77 105 19 GLU A 67 ? ? -59.37 175.83 106 19 ASP A 70 ? ? -104.81 -66.70 107 19 PRO A 109 ? ? -79.52 38.60 108 19 SER A 110 ? ? -35.00 112.71 109 20 SER A 8 ? ? -46.55 155.98 110 20 SER A 44 ? ? 35.75 44.06 111 20 ASP A 46 ? ? -129.02 -51.94 112 20 ARG A 48 ? ? -35.61 -38.97 113 20 GLU A 67 ? ? -49.98 171.52 #