data_2COO # _entry.id 2COO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2COO pdb_00002coo 10.2210/pdb2coo/pdb RCSB RCSB024456 ? ? WWPDB D_1000024456 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hss001000683.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2COO _pdbx_database_status.recvd_initial_deposition_date 2005-05-18 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhang, H.P.' 1 'Hayashi, F.' 2 'Yokoyama, S.' 3 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 # _citation.id primary _citation.title 'Solution structure of the e3_binding domain of dihydrolipoamide branched chaintransacylase' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, H.P.' 1 ? primary 'Hayashi, F.' 2 ? primary 'Yokoyama, S.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial' _entity.formula_weight 7314.278 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.3.1.168 _entity.pdbx_mutation ? _entity.pdbx_fragment 'e3_binding domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Dihydrolipoyllysine-residue 2-methylpropanoyl, transferase, E2, Dihydrolipoamide branched chain transacylase, BCKAD E2 subunit' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTGAILPPSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTGAILPPSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hss001000683.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 HIS n 1 9 GLN n 1 10 GLU n 1 11 ILE n 1 12 LYS n 1 13 GLY n 1 14 ARG n 1 15 LYS n 1 16 THR n 1 17 LEU n 1 18 ALA n 1 19 THR n 1 20 PRO n 1 21 ALA n 1 22 VAL n 1 23 ARG n 1 24 ARG n 1 25 LEU n 1 26 ALA n 1 27 MET n 1 28 GLU n 1 29 ASN n 1 30 ASN n 1 31 ILE n 1 32 LYS n 1 33 LEU n 1 34 SER n 1 35 GLU n 1 36 VAL n 1 37 VAL n 1 38 GLY n 1 39 SER n 1 40 GLY n 1 41 LYS n 1 42 ASP n 1 43 GLY n 1 44 ARG n 1 45 ILE n 1 46 LEU n 1 47 LYS n 1 48 GLU n 1 49 ASP n 1 50 ILE n 1 51 LEU n 1 52 ASN n 1 53 TYR n 1 54 LEU n 1 55 GLU n 1 56 LYS n 1 57 GLN n 1 58 THR n 1 59 GLY n 1 60 ALA n 1 61 ILE n 1 62 LEU n 1 63 PRO n 1 64 PRO n 1 65 SER n 1 66 GLY n 1 67 PRO n 1 68 SER n 1 69 SER n 1 70 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'DBT, BCATE2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P040510-10 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ODB2_HUMAN _struct_ref.pdbx_db_accession P11182 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code HQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTGAILPPS _struct_ref.pdbx_align_begin 163 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2COO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 65 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P11182 _struct_ref_seq.db_align_beg 163 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 220 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 65 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2COO GLY A 1 ? UNP P11182 ? ? 'cloning artifact' 1 1 1 2COO SER A 2 ? UNP P11182 ? ? 'cloning artifact' 2 2 1 2COO SER A 3 ? UNP P11182 ? ? 'cloning artifact' 3 3 1 2COO GLY A 4 ? UNP P11182 ? ? 'cloning artifact' 4 4 1 2COO SER A 5 ? UNP P11182 ? ? 'cloning artifact' 5 5 1 2COO SER A 6 ? UNP P11182 ? ? 'cloning artifact' 6 6 1 2COO GLY A 7 ? UNP P11182 ? ? 'cloning artifact' 7 7 1 2COO GLY A 66 ? UNP P11182 ? ? 'cloning artifact' 66 8 1 2COO PRO A 67 ? UNP P11182 ? ? 'cloning artifact' 67 9 1 2COO SER A 68 ? UNP P11182 ? ? 'cloning artifact' 68 10 1 2COO SER A 69 ? UNP P11182 ? ? 'cloning artifact' 69 11 1 2COO GLY A 70 ? UNP P11182 ? ? 'cloning artifact' 70 12 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.11mM 13C, 15N-labeled protein; 20mM d-Tris-HCl (pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2COO _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2COO _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function,structures with the lowest energy,structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2COO _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.04 Johnson,B.A. 3 'data analysis' KUJIRA 0.9296 Kobayashi,N. 4 'structure solution' CYANA 2.0.17 Guntert,P. 5 refinement CYANA 2.0.17 Guntert,P. 6 # _exptl.entry_id 2COO _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2COO _struct.title 'Solution structure of the e3_binding domain of dihydrolipoamide branched chaintransacylase' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2COO _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text ;e3_binding domain, Lipoamide acyltransferase component of branched-chain alpha-keto acid, Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 20 ? ASN A 29 ? PRO A 20 ASN A 29 1 ? 10 HELX_P HELX_P2 2 LEU A 33 ? GLU A 35 ? LEU A 33 GLU A 35 5 ? 3 HELX_P HELX_P3 3 LYS A 47 ? LEU A 54 ? LYS A 47 LEU A 54 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2COO _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2COO _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 MET 27 27 27 MET MET A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 GLY 70 70 70 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-18 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX DETERMINATION METHOD: AUTHOR DETERMINED ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 12 ? ? -41.63 161.17 2 1 VAL A 37 ? ? -58.21 101.58 3 1 SER A 65 ? ? 37.02 39.59 4 2 ALA A 18 ? ? -175.04 149.32 5 2 ASP A 42 ? ? -86.73 31.71 6 2 ILE A 61 ? ? -82.41 38.42 7 2 SER A 68 ? ? -34.63 -70.92 8 3 ALA A 18 ? ? -170.83 144.86 9 3 SER A 65 ? ? -47.50 151.43 10 4 HIS A 8 ? ? -85.28 40.27 11 4 ALA A 18 ? ? -174.57 136.84 12 4 THR A 19 ? ? -47.27 160.63 13 4 ASP A 42 ? ? -80.30 47.03 14 4 SER A 65 ? ? -60.22 89.12 15 5 LEU A 25 ? ? -48.61 -19.06 16 5 VAL A 37 ? ? -66.84 98.30 17 5 THR A 58 ? ? -34.20 113.39 18 5 ALA A 60 ? ? -49.41 97.46 19 5 ILE A 61 ? ? 36.98 49.09 20 5 PRO A 67 ? ? -69.79 90.37 21 6 ILE A 11 ? ? -37.18 149.96 22 6 VAL A 37 ? ? -54.77 96.95 23 6 ALA A 60 ? ? -50.87 96.97 24 6 PRO A 64 ? ? -69.76 -175.28 25 7 VAL A 37 ? ? -61.20 97.83 26 7 ASP A 42 ? ? -84.68 31.95 27 7 ARG A 44 ? ? -53.12 108.22 28 7 THR A 58 ? ? -34.56 128.05 29 7 ILE A 61 ? ? -105.65 40.45 30 7 SER A 69 ? ? -169.52 106.44 31 8 ALA A 18 ? ? -175.04 149.92 32 8 LEU A 25 ? ? -49.14 -19.14 33 8 THR A 58 ? ? -35.29 -31.49 34 8 PRO A 64 ? ? -69.78 0.75 35 8 SER A 65 ? ? -38.71 -39.80 36 9 SER A 5 ? ? -163.02 117.88 37 9 THR A 19 ? ? -44.81 160.77 38 9 LYS A 41 ? ? -36.52 -70.56 39 9 SER A 65 ? ? -38.87 118.43 40 10 SER A 3 ? ? -129.28 -53.26 41 10 HIS A 8 ? ? -170.93 148.23 42 10 GLN A 9 ? ? -167.06 106.24 43 10 ALA A 60 ? ? -56.94 -176.25 44 11 SER A 5 ? ? -170.64 107.13 45 11 LEU A 25 ? ? -36.22 -30.08 46 11 VAL A 36 ? ? -69.66 97.54 47 11 VAL A 37 ? ? -54.80 104.29 48 11 ASP A 42 ? ? -80.88 47.74 49 11 PRO A 64 ? ? -69.76 95.53 50 11 SER A 65 ? ? -35.05 104.33 51 12 SER A 2 ? ? 38.87 43.60 52 12 SER A 5 ? ? -44.60 158.46 53 12 LYS A 12 ? ? -99.37 41.72 54 12 ALA A 18 ? ? -173.53 138.99 55 12 THR A 19 ? ? -42.13 160.64 56 12 LYS A 41 ? ? -36.15 148.80 57 12 LYS A 47 ? ? -35.65 -39.02 58 12 LEU A 62 ? ? -48.06 152.03 59 13 SER A 39 ? ? -132.92 -38.88 60 13 ASP A 42 ? ? -84.62 32.49 61 13 THR A 58 ? ? 33.98 34.07 62 13 ALA A 60 ? ? -47.69 165.90 63 13 ILE A 61 ? ? -61.96 74.91 64 14 VAL A 37 ? ? -54.66 102.61 65 14 ASP A 42 ? ? -78.94 45.83 66 14 ALA A 60 ? ? -44.46 154.81 67 14 PRO A 64 ? ? -69.74 82.43 68 14 PRO A 67 ? ? -69.83 92.88 69 15 ALA A 18 ? ? -174.84 123.10 70 15 THR A 19 ? ? -39.71 160.87 71 15 ILE A 61 ? ? -91.10 52.75 72 15 PRO A 67 ? ? -69.73 2.78 73 15 SER A 68 ? ? 38.95 50.82 74 16 GLN A 9 ? ? -116.51 68.67 75 16 ALA A 18 ? ? -175.15 143.04 76 16 THR A 58 ? ? 34.08 38.91 77 16 ALA A 60 ? ? -38.80 153.52 78 17 GLU A 10 ? ? -173.85 123.11 79 17 LYS A 15 ? ? -69.06 95.37 80 17 VAL A 37 ? ? -69.14 96.96 81 17 ASP A 42 ? ? -83.88 37.43 82 17 ILE A 61 ? ? 32.54 43.03 83 18 LEU A 25 ? ? -47.79 -19.41 84 18 ALA A 60 ? ? -69.45 -176.31 85 18 ILE A 61 ? ? -81.79 40.60 86 18 LEU A 62 ? ? -41.46 157.93 87 18 SER A 65 ? ? -68.58 78.35 88 19 GLN A 9 ? ? -83.96 41.85 89 19 LYS A 12 ? ? -122.87 -51.12 90 19 LEU A 25 ? ? -39.20 -25.59 91 19 ASP A 42 ? ? -84.36 36.75 92 19 THR A 58 ? ? 33.98 52.41 93 19 ALA A 60 ? ? -51.49 179.65 94 20 LYS A 15 ? ? -171.22 125.68 95 20 THR A 19 ? ? -44.37 161.03 96 20 LYS A 41 ? ? -46.14 154.56 97 20 THR A 58 ? ? 33.96 41.03 98 20 ALA A 60 ? ? -50.84 -176.49 99 20 ILE A 61 ? ? -91.12 38.57 100 20 LEU A 62 ? ? -37.42 144.23 101 20 PRO A 64 ? ? -69.65 85.58 102 20 PRO A 67 ? ? -69.74 1.28 #