data_2COT # _entry.id 2COT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2COT pdb_00002cot 10.2210/pdb2cot/pdb RCSB RCSB024461 ? ? WWPDB D_1000024461 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hss001001726 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2COT _pdbx_database_status.recvd_initial_deposition_date 2005-05-18 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Qin, X.R.' 1 'Nagashima, T.' 2 'Hayashi, F.' 3 'Yokoyama, S.' 4 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 # _citation.id primary _citation.title 'Solution structure of the first and second zf-C2H2 domain of Zinc finger protein 435' _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Qin, X.R.' 1 ? primary 'Nagashima, T.' 2 ? primary 'Hayashi, F.' 3 ? primary 'Yokoyama, S.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Zinc finger protein 435' 8679.549 1 ? ? 'ADK_lid domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Zinc finger and SCAN domain containing protein 16' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGRSEWQQRERRRYKCDECGKSFSHSSDLSKHRRTHTGEKPYKCDECGKAFIQRSHLIGHHRVHTGSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGRSEWQQRERRRYKCDECGKSFSHSSDLSKHRRTHTGEKPYKCDECGKAFIQRSHLIGHHRVHTGSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hss001001726 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 ARG n 1 9 SER n 1 10 GLU n 1 11 TRP n 1 12 GLN n 1 13 GLN n 1 14 ARG n 1 15 GLU n 1 16 ARG n 1 17 ARG n 1 18 ARG n 1 19 TYR n 1 20 LYS n 1 21 CYS n 1 22 ASP n 1 23 GLU n 1 24 CYS n 1 25 GLY n 1 26 LYS n 1 27 SER n 1 28 PHE n 1 29 SER n 1 30 HIS n 1 31 SER n 1 32 SER n 1 33 ASP n 1 34 LEU n 1 35 SER n 1 36 LYS n 1 37 HIS n 1 38 ARG n 1 39 ARG n 1 40 THR n 1 41 HIS n 1 42 THR n 1 43 GLY n 1 44 GLU n 1 45 LYS n 1 46 PRO n 1 47 TYR n 1 48 LYS n 1 49 CYS n 1 50 ASP n 1 51 GLU n 1 52 CYS n 1 53 GLY n 1 54 LYS n 1 55 ALA n 1 56 PHE n 1 57 ILE n 1 58 GLN n 1 59 ARG n 1 60 SER n 1 61 HIS n 1 62 LEU n 1 63 ILE n 1 64 GLY n 1 65 HIS n 1 66 HIS n 1 67 ARG n 1 68 VAL n 1 69 HIS n 1 70 THR n 1 71 GLY n 1 72 SER n 1 73 GLY n 1 74 PRO n 1 75 SER n 1 76 SER n 1 77 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'ZNF435, ZSCAN16' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P040628-11 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZN435_HUMAN _struct_ref.pdbx_db_accession Q9H4T2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code RSEWQQRERRRYKCDECGKSFSHSSDLSKHRRTHTGEKPYKCDECGKAFIQRSHLIGHHRVHTG _struct_ref.pdbx_align_begin 225 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2COT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 71 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9H4T2 _struct_ref_seq.db_align_beg 225 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 288 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 71 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2COT GLY A 1 ? UNP Q9H4T2 ? ? 'cloning artifact' 1 1 1 2COT SER A 2 ? UNP Q9H4T2 ? ? 'cloning artifact' 2 2 1 2COT SER A 3 ? UNP Q9H4T2 ? ? 'cloning artifact' 3 3 1 2COT GLY A 4 ? UNP Q9H4T2 ? ? 'cloning artifact' 4 4 1 2COT SER A 5 ? UNP Q9H4T2 ? ? 'cloning artifact' 5 5 1 2COT SER A 6 ? UNP Q9H4T2 ? ? 'cloning artifact' 6 6 1 2COT GLY A 7 ? UNP Q9H4T2 ? ? 'cloning artifact' 7 7 1 2COT SER A 72 ? UNP Q9H4T2 ? ? 'cloning artifact' 72 8 1 2COT GLY A 73 ? UNP Q9H4T2 ? ? 'cloning artifact' 73 9 1 2COT PRO A 74 ? UNP Q9H4T2 ? ? 'cloning artifact' 74 10 1 2COT SER A 75 ? UNP Q9H4T2 ? ? 'cloning artifact' 75 11 1 2COT SER A 76 ? UNP Q9H4T2 ? ? 'cloning artifact' 76 12 1 2COT GLY A 77 ? UNP Q9H4T2 ? ? 'cloning artifact' 77 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.27mM 13C, 15N-labeled protein; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 0.01mM ZnCl2' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2COT _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2COT _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2COT _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20020425 Delaglio,F. 2 'data analysis' NMRView 5.0.4 Johnson,B.A. 3 'data analysis' KUJIRA 0.9296 Kobayashi,N. 4 'structure solution' CYANA 2.0.17 Guntert,P. 5 refinement CYANA 2.0.17 Guntert,P. 6 # _exptl.entry_id 2COT _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2COT _struct.title 'Solution structure of the first and second zf-C2H2 domain of Zinc finger protein 435' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2COT _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text ;ADK_lid domain, Zinc finger protein 435, Zinc finger and SCAN domain containing protein 16, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Transcription ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 HIS A 30 ? ARG A 39 ? HIS A 30 ARG A 39 1 ? 10 HELX_P HELX_P2 2 GLN A 58 ? HIS A 66 ? GLN A 58 HIS A 66 1 ? 9 HELX_P HELX_P3 3 ARG A 67 ? HIS A 69 ? ARG A 67 HIS A 69 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 21 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 21 A ZN 201 1_555 ? ? ? ? ? ? ? 2.330 ? ? metalc2 metalc ? ? A CYS 24 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 24 A ZN 201 1_555 ? ? ? ? ? ? ? 2.348 ? ? metalc3 metalc ? ? A HIS 37 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 37 A ZN 201 1_555 ? ? ? ? ? ? ? 2.059 ? ? metalc4 metalc ? ? A HIS 41 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 41 A ZN 201 1_555 ? ? ? ? ? ? ? 2.065 ? ? metalc5 metalc ? ? A CYS 49 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 49 A ZN 401 1_555 ? ? ? ? ? ? ? 2.371 ? ? metalc6 metalc ? ? A CYS 52 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 52 A ZN 401 1_555 ? ? ? ? ? ? ? 2.365 ? ? metalc7 metalc ? ? A HIS 65 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 65 A ZN 401 1_555 ? ? ? ? ? ? ? 2.050 ? ? metalc8 metalc ? ? A HIS 69 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 69 A ZN 401 1_555 ? ? ? ? ? ? ? 2.070 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 47 ? LYS A 48 ? TYR A 47 LYS A 48 A 2 ALA A 55 ? PHE A 56 ? ALA A 55 PHE A 56 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id TYR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 47 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 47 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id PHE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 56 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 56 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 21 ? CYS A 21 . ? 1_555 ? 2 AC1 4 CYS A 24 ? CYS A 24 . ? 1_555 ? 3 AC1 4 HIS A 37 ? HIS A 37 . ? 1_555 ? 4 AC1 4 HIS A 41 ? HIS A 41 . ? 1_555 ? 5 AC2 4 CYS A 49 ? CYS A 49 . ? 1_555 ? 6 AC2 4 CYS A 52 ? CYS A 52 . ? 1_555 ? 7 AC2 4 HIS A 65 ? HIS A 65 . ? 1_555 ? 8 AC2 4 HIS A 69 ? HIS A 69 . ? 1_555 ? # _database_PDB_matrix.entry_id 2COT _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2COT _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 TRP 11 11 11 TRP TRP A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 HIS 37 37 37 HIS HIS A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 CYS 52 52 52 CYS CYS A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 HIS 65 65 65 HIS HIS A . n A 1 66 HIS 66 66 66 HIS HIS A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 GLY 77 77 77 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 24 ? A CYS 24 ? 1_555 116.5 ? 2 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 37 ? A HIS 37 ? 1_555 98.4 ? 3 SG ? A CYS 24 ? A CYS 24 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 37 ? A HIS 37 ? 1_555 93.4 ? 4 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 41 ? A HIS 41 ? 1_555 130.1 ? 5 SG ? A CYS 24 ? A CYS 24 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 41 ? A HIS 41 ? 1_555 107.1 ? 6 NE2 ? A HIS 37 ? A HIS 37 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 41 ? A HIS 41 ? 1_555 102.1 ? 7 SG ? A CYS 49 ? A CYS 49 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 52 ? A CYS 52 ? 1_555 105.6 ? 8 SG ? A CYS 49 ? A CYS 49 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 65 ? A HIS 65 ? 1_555 99.5 ? 9 SG ? A CYS 52 ? A CYS 52 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 65 ? A HIS 65 ? 1_555 98.0 ? 10 SG ? A CYS 49 ? A CYS 49 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 69 ? A HIS 69 ? 1_555 106.5 ? 11 SG ? A CYS 52 ? A CYS 52 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 69 ? A HIS 69 ? 1_555 126.2 ? 12 NE2 ? A HIS 65 ? A HIS 65 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 69 ? A HIS 69 ? 1_555 117.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-18 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif 7 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 5 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 6 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 10 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 12 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 16 4 'Structure model' '_struct_ref_seq_dif.details' 17 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 18 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 19 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 6 ? ? -127.17 -54.47 2 1 SER A 9 ? ? -94.44 41.08 3 1 ARG A 16 ? ? -46.64 163.46 4 1 THR A 42 ? ? -172.76 143.65 5 1 LYS A 45 ? ? -34.64 136.85 6 1 HIS A 66 ? ? -36.82 -33.42 7 1 VAL A 68 ? ? -37.68 -34.15 8 2 SER A 2 ? ? -130.81 -50.42 9 2 SER A 3 ? ? 37.50 41.94 10 2 SER A 5 ? ? -38.81 106.37 11 2 ARG A 16 ? ? 36.01 50.83 12 2 CYS A 21 ? ? -113.58 76.75 13 2 ASP A 22 ? ? -37.20 -34.61 14 2 GLU A 44 ? ? -48.77 165.40 15 2 LYS A 45 ? ? -34.42 133.18 16 2 PRO A 46 ? ? -69.73 0.04 17 2 HIS A 66 ? ? -34.36 -33.85 18 2 VAL A 68 ? ? -36.85 -37.65 19 2 PRO A 74 ? ? -69.76 1.06 20 3 ARG A 8 ? ? -92.40 41.10 21 3 CYS A 21 ? ? -102.66 78.94 22 3 ASP A 22 ? ? -37.98 -32.32 23 3 THR A 42 ? ? -39.11 97.83 24 3 LYS A 45 ? ? -32.56 95.93 25 4 GLN A 13 ? ? 36.82 45.77 26 4 GLU A 15 ? ? -59.44 87.79 27 4 LYS A 45 ? ? 35.06 54.98 28 4 PRO A 46 ? ? -69.73 1.13 29 4 ILE A 57 ? ? -93.41 -71.44 30 4 VAL A 68 ? ? -39.26 -31.72 31 4 HIS A 69 ? ? -101.71 -70.44 32 4 THR A 70 ? ? -128.36 -61.59 33 4 PRO A 74 ? ? -69.84 86.65 34 5 GLN A 12 ? ? -134.49 -59.64 35 5 ASP A 22 ? ? -36.58 -36.50 36 5 LEU A 34 ? ? -38.09 -37.13 37 5 GLU A 44 ? ? -98.48 36.92 38 5 LYS A 48 ? ? -172.26 149.90 39 6 SER A 6 ? ? -83.48 42.47 40 6 CYS A 21 ? ? -69.58 74.75 41 6 ASP A 22 ? ? -34.59 -33.63 42 6 ARG A 38 ? ? -34.93 -38.31 43 6 THR A 40 ? ? -37.30 -33.03 44 6 THR A 42 ? ? 37.36 38.46 45 6 GLU A 44 ? ? -99.95 38.60 46 6 PRO A 46 ? ? -69.78 0.44 47 6 LYS A 48 ? ? -173.29 108.41 48 6 HIS A 66 ? ? -36.33 -34.80 49 7 PRO A 46 ? ? -69.73 1.97 50 7 SER A 75 ? ? -94.21 43.39 51 8 GLN A 12 ? ? -35.95 142.63 52 8 ARG A 14 ? ? -54.85 106.37 53 8 ASP A 22 ? ? -38.75 -28.57 54 8 HIS A 41 ? ? -69.84 89.02 55 8 LYS A 45 ? ? -116.38 73.00 56 8 PRO A 46 ? ? -69.78 3.03 57 9 SER A 2 ? ? -163.88 115.85 58 9 ARG A 14 ? ? -49.63 95.44 59 9 CYS A 21 ? ? -115.16 77.01 60 9 ASP A 22 ? ? -39.54 -30.21 61 10 SER A 3 ? ? -48.55 153.23 62 10 ARG A 18 ? ? -123.88 -54.78 63 10 ASP A 22 ? ? -35.90 -32.60 64 10 THR A 42 ? ? -62.34 84.36 65 10 GLU A 44 ? ? -60.64 -177.47 66 10 LYS A 48 ? ? -170.88 118.28 67 10 PRO A 74 ? ? -69.74 3.10 68 10 SER A 75 ? ? 74.37 46.24 69 10 SER A 76 ? ? 39.05 43.65 70 11 GLU A 15 ? ? -82.07 -75.59 71 11 ARG A 18 ? ? -132.42 -60.00 72 11 GLU A 44 ? ? -134.13 -52.58 73 12 THR A 40 ? ? -37.26 -35.35 74 12 LYS A 45 ? ? -35.47 98.17 75 12 ASP A 50 ? ? -107.48 -64.67 76 13 GLN A 12 ? ? 72.55 42.28 77 13 CYS A 21 ? ? -116.99 74.96 78 13 ASP A 22 ? ? -37.32 -34.34 79 13 LEU A 34 ? ? -38.14 -36.18 80 13 HIS A 66 ? ? -38.97 -31.75 81 13 SER A 72 ? ? -122.70 -58.83 82 14 GLN A 13 ? ? -127.83 -50.06 83 14 GLU A 15 ? ? -37.72 139.23 84 14 CYS A 21 ? ? -109.95 76.43 85 14 ASP A 22 ? ? -39.00 -31.02 86 14 ARG A 38 ? ? -35.95 -36.27 87 14 LYS A 45 ? ? -33.41 96.85 88 14 PRO A 46 ? ? -69.84 2.29 89 14 LYS A 48 ? ? -170.10 117.31 90 15 SER A 5 ? ? -170.39 148.27 91 15 ASP A 22 ? ? -82.48 41.74 92 15 ARG A 38 ? ? -36.25 -31.82 93 15 LYS A 48 ? ? -171.09 147.83 94 15 HIS A 69 ? ? -58.49 92.16 95 15 PRO A 74 ? ? -69.81 96.06 96 16 SER A 2 ? ? -171.10 137.75 97 16 GLU A 10 ? ? -34.47 112.73 98 16 HIS A 41 ? ? -91.36 54.49 99 16 THR A 42 ? ? -133.46 -54.17 100 16 HIS A 61 ? ? -34.48 -34.02 101 16 HIS A 66 ? ? -38.15 -35.63 102 16 PRO A 74 ? ? -69.78 89.06 103 17 SER A 2 ? ? -92.20 42.17 104 17 GLU A 15 ? ? -49.91 168.19 105 17 CYS A 21 ? ? -102.46 77.90 106 17 ASP A 22 ? ? -39.06 -30.17 107 17 ARG A 38 ? ? -36.70 -27.60 108 17 PRO A 46 ? ? -69.77 1.02 109 17 HIS A 66 ? ? -38.82 -37.62 110 18 SER A 5 ? ? -44.16 151.80 111 18 SER A 9 ? ? -34.62 145.32 112 18 ARG A 18 ? ? -124.22 -61.14 113 18 ASP A 22 ? ? -36.39 -32.82 114 18 ARG A 38 ? ? -39.11 -28.86 115 18 THR A 42 ? ? -171.79 127.98 116 18 GLU A 44 ? ? -99.95 44.64 117 18 LYS A 45 ? ? -110.29 79.11 118 19 SER A 9 ? ? -92.20 41.96 119 19 ASP A 22 ? ? -34.54 -36.42 120 19 ARG A 38 ? ? -37.03 -33.47 121 19 LYS A 45 ? ? -35.36 128.79 122 19 PRO A 46 ? ? -69.74 1.77 123 19 HIS A 66 ? ? -38.92 -37.13 124 19 VAL A 68 ? ? -38.92 -28.06 125 20 GLN A 12 ? ? 34.43 40.53 126 20 LEU A 34 ? ? -34.20 -39.10 127 20 PRO A 46 ? ? -69.80 3.43 128 20 HIS A 61 ? ? -38.24 -35.41 129 20 HIS A 66 ? ? -39.15 -29.00 130 20 ARG A 67 ? ? -86.38 30.41 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #