data_2CQR # _entry.id 2CQR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2CQR pdb_00002cqr 10.2210/pdb2cqr/pdb RCSB RCSB024518 ? ? WWPDB D_1000024518 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002023161.2 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2CQR _pdbx_database_status.recvd_initial_deposition_date 2005-05-20 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Doi-Katayama, Y.' 1 'Hirota, H.' 2 'Hayashi, F.' 3 'Yokoyama, S.' 4 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 # _citation.id primary _citation.title 'Solution structure of RSGI RUH-043, a myb DNA-binding domain in human cDNA' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Doi-Katayama, Y.' 1 ? primary 'Hirota, H.' 2 ? primary 'Hayashi, F.' 3 ? primary 'Yokoyama, S.' 4 ? # _cell.entry_id 2CQR _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2CQR _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'DnaJ homolog subfamily C member 1' _entity.formula_weight 8025.987 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'myb DNA-binding domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RSGI RUH-043' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGSLRKERARSAEEPWTQNQQKLLELALQQYPRGSSDCWDKIARCVPSKSKEDCIARYKLLVSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGSLRKERARSAEEPWTQNQQKLLELALQQYPRGSSDCWDKIARCVPSKSKEDCIARYKLLVSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002023161.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 SER n 1 9 LEU n 1 10 ARG n 1 11 LYS n 1 12 GLU n 1 13 ARG n 1 14 ALA n 1 15 ARG n 1 16 SER n 1 17 ALA n 1 18 GLU n 1 19 GLU n 1 20 PRO n 1 21 TRP n 1 22 THR n 1 23 GLN n 1 24 ASN n 1 25 GLN n 1 26 GLN n 1 27 LYS n 1 28 LEU n 1 29 LEU n 1 30 GLU n 1 31 LEU n 1 32 ALA n 1 33 LEU n 1 34 GLN n 1 35 GLN n 1 36 TYR n 1 37 PRO n 1 38 ARG n 1 39 GLY n 1 40 SER n 1 41 SER n 1 42 ASP n 1 43 CYS n 1 44 TRP n 1 45 ASP n 1 46 LYS n 1 47 ILE n 1 48 ALA n 1 49 ARG n 1 50 CYS n 1 51 VAL n 1 52 PRO n 1 53 SER n 1 54 LYS n 1 55 SER n 1 56 LYS n 1 57 GLU n 1 58 ASP n 1 59 CYS n 1 60 ILE n 1 61 ALA n 1 62 ARG n 1 63 TYR n 1 64 LYS n 1 65 LEU n 1 66 LEU n 1 67 VAL n 1 68 SER n 1 69 GLY n 1 70 PRO n 1 71 SER n 1 72 SER n 1 73 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene AY225122 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P041115-02 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DNJC1_HUMAN _struct_ref.pdbx_db_accession Q96KC8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SLRKERARSAEEPWTQNQQKLLELALQQYPRGSSDRWDKIARCVPSKSKEDCIARYKLLV _struct_ref.pdbx_align_begin 484 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2CQR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 67 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q96KC8 _struct_ref_seq.db_align_beg 484 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 543 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 67 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2CQR GLY A 1 ? UNP Q96KC8 ? ? 'cloning artifact' 1 1 1 2CQR SER A 2 ? UNP Q96KC8 ? ? 'cloning artifact' 2 2 1 2CQR SER A 3 ? UNP Q96KC8 ? ? 'cloning artifact' 3 3 1 2CQR GLY A 4 ? UNP Q96KC8 ? ? 'cloning artifact' 4 4 1 2CQR SER A 5 ? UNP Q96KC8 ? ? 'cloning artifact' 5 5 1 2CQR SER A 6 ? UNP Q96KC8 ? ? 'cloning artifact' 6 6 1 2CQR GLY A 7 ? UNP Q96KC8 ? ? 'cloning artifact' 7 7 1 2CQR CYS A 43 ? UNP Q96KC8 ARG 519 'SEE REMARK 999' 43 8 1 2CQR SER A 68 ? UNP Q96KC8 ? ? 'cloning artifact' 68 9 1 2CQR GLY A 69 ? UNP Q96KC8 ? ? 'cloning artifact' 69 10 1 2CQR PRO A 70 ? UNP Q96KC8 ? ? 'cloning artifact' 70 11 1 2CQR SER A 71 ? UNP Q96KC8 ? ? 'cloning artifact' 71 12 1 2CQR SER A 72 ? UNP Q96KC8 ? ? 'cloning artifact' 72 13 1 2CQR GLY A 73 ? UNP Q96KC8 ? ? 'cloning artifact' 73 14 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '120mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.57mM myb DNA-binding domain U-15N, 13C; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2CQR _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2CQR _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2CQR _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20020425 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9295 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2CQR _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2CQR _struct.title 'Solution structure of RSGI RUH-043, a myb DNA-binding domain in human cDNA' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2CQR _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text ;MEMBRANE PROTEIN, STRUCTURAL GENOMICS, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 23 ? GLN A 35 ? GLN A 23 GLN A 35 1 ? 13 HELX_P HELX_P2 2 CYS A 43 ? ARG A 49 ? CYS A 43 ARG A 49 1 ? 7 HELX_P HELX_P3 3 LYS A 56 ? SER A 68 ? LYS A 56 SER A 68 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2CQR _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2CQR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 TRP 21 21 21 TRP TRP A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 TRP 44 44 44 TRP TRP A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 CYS 50 50 50 CYS CYS A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 GLY 73 73 73 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-20 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 3 ? ? -57.75 98.23 2 1 GLU A 12 ? ? -173.73 115.12 3 1 GLN A 23 ? ? -38.64 -33.14 4 1 PRO A 52 ? ? -69.77 3.13 5 1 SER A 68 ? ? -96.83 41.54 6 2 GLU A 12 ? ? -131.19 -44.42 7 2 GLU A 19 ? ? -38.45 158.30 8 2 PRO A 37 ? ? -69.77 -165.88 9 2 SER A 41 ? ? -85.11 31.39 10 2 PRO A 52 ? ? -69.78 3.24 11 3 SER A 8 ? ? -36.04 149.21 12 3 SER A 16 ? ? -38.12 112.22 13 3 PRO A 37 ? ? -69.77 -177.98 14 3 ARG A 38 ? ? -43.78 -73.05 15 3 SER A 40 ? ? -92.78 47.64 16 3 SER A 41 ? ? 39.95 25.30 17 3 PRO A 52 ? ? -69.76 3.26 18 3 SER A 68 ? ? -85.37 41.23 19 3 SER A 71 ? ? -59.15 87.92 20 3 SER A 72 ? ? -47.51 109.44 21 4 GLU A 12 ? ? -174.81 142.30 22 4 ARG A 38 ? ? -60.82 -175.99 23 4 SER A 40 ? ? 36.54 37.22 24 4 PRO A 52 ? ? -69.74 3.14 25 4 SER A 68 ? ? -93.84 43.60 26 5 GLU A 12 ? ? -175.03 138.52 27 5 SER A 16 ? ? -83.77 35.56 28 5 SER A 40 ? ? -78.63 45.73 29 5 PRO A 52 ? ? -69.80 3.22 30 6 SER A 16 ? ? -39.98 126.89 31 6 PRO A 37 ? ? -69.77 -163.62 32 6 SER A 41 ? ? -85.42 32.02 33 6 PRO A 52 ? ? -69.74 3.16 34 6 SER A 68 ? ? -82.53 46.35 35 7 GLU A 12 ? ? -103.78 -77.39 36 7 ARG A 13 ? ? -102.17 -65.15 37 7 ALA A 14 ? ? -102.28 -71.37 38 7 LEU A 33 ? ? -36.12 -31.37 39 7 ASP A 45 ? ? -35.62 -39.36 40 7 PRO A 52 ? ? -69.81 3.16 41 7 SER A 68 ? ? -90.06 44.49 42 7 SER A 71 ? ? -173.54 123.20 43 8 SER A 3 ? ? -38.30 119.61 44 8 ARG A 10 ? ? -173.85 148.20 45 8 GLU A 18 ? ? -108.34 44.90 46 8 GLU A 19 ? ? -34.56 150.51 47 8 PRO A 20 ? ? -69.76 -176.52 48 8 ARG A 38 ? ? -59.31 -179.76 49 8 SER A 40 ? ? -90.68 46.01 50 8 PRO A 52 ? ? -69.73 3.10 51 9 SER A 5 ? ? -47.59 105.97 52 9 SER A 8 ? ? -63.34 90.01 53 9 LYS A 11 ? ? -70.00 85.38 54 9 GLU A 12 ? ? -162.11 116.83 55 9 THR A 22 ? ? -61.50 -176.60 56 9 ARG A 38 ? ? -64.15 -176.26 57 9 PRO A 52 ? ? -69.73 3.19 58 10 GLU A 12 ? ? -175.64 123.69 59 10 THR A 22 ? ? -66.17 -177.53 60 10 LEU A 33 ? ? -36.99 -36.04 61 10 PRO A 37 ? ? -69.73 -176.10 62 10 PRO A 52 ? ? -69.75 3.15 63 10 SER A 68 ? ? -86.88 40.63 64 11 LEU A 9 ? ? -46.14 163.63 65 11 ARG A 10 ? ? -59.13 98.58 66 11 GLU A 12 ? ? -84.45 41.63 67 11 TYR A 36 ? ? -110.83 75.12 68 11 ARG A 38 ? ? -55.41 -176.02 69 11 PRO A 52 ? ? -69.75 3.09 70 12 SER A 2 ? ? -44.80 150.41 71 12 GLU A 12 ? ? -174.99 132.00 72 12 SER A 16 ? ? -35.38 114.93 73 12 PRO A 20 ? ? -69.80 -179.95 74 12 ASP A 45 ? ? -38.06 -31.30 75 12 PRO A 52 ? ? -69.76 3.15 76 12 PRO A 70 ? ? -69.77 -178.09 77 13 ARG A 10 ? ? -173.03 121.16 78 13 GLU A 12 ? ? -86.05 39.29 79 13 THR A 22 ? ? -56.20 174.95 80 13 PRO A 37 ? ? -69.76 -168.16 81 13 PRO A 52 ? ? -69.84 0.69 82 14 SER A 5 ? ? -62.63 99.50 83 14 GLU A 12 ? ? -160.93 113.90 84 14 SER A 16 ? ? -83.53 48.63 85 14 THR A 22 ? ? -49.45 176.83 86 14 LEU A 33 ? ? -38.32 -26.95 87 14 PRO A 37 ? ? -69.70 -169.94 88 14 SER A 40 ? ? -90.19 38.49 89 14 SER A 41 ? ? 48.00 24.99 90 14 PRO A 52 ? ? -69.83 3.37 91 15 SER A 16 ? ? 39.81 43.26 92 15 GLN A 23 ? ? -39.19 -31.92 93 15 PRO A 37 ? ? -69.78 -163.64 94 15 SER A 40 ? ? -104.78 54.71 95 15 SER A 41 ? ? 40.50 25.06 96 15 TRP A 44 ? ? -37.98 -36.89 97 15 PRO A 52 ? ? -69.78 3.18 98 16 SER A 2 ? ? -88.60 41.87 99 16 LYS A 11 ? ? -98.55 42.07 100 16 PRO A 37 ? ? -69.75 -177.44 101 16 PRO A 52 ? ? -69.80 3.23 102 17 SER A 16 ? ? -35.88 140.69 103 17 LEU A 31 ? ? -38.60 -38.98 104 17 PRO A 37 ? ? -69.77 -179.77 105 17 SER A 71 ? ? -162.23 109.31 106 18 GLN A 23 ? ? -39.47 -28.89 107 18 LEU A 28 ? ? -38.90 -36.09 108 18 ARG A 38 ? ? -36.17 154.04 109 18 SER A 41 ? ? 34.44 33.31 110 18 SER A 71 ? ? -125.03 -50.99 111 19 SER A 3 ? ? -130.99 -53.88 112 19 LEU A 9 ? ? -58.88 77.98 113 19 GLU A 18 ? ? -113.13 77.56 114 19 ARG A 38 ? ? -34.29 150.76 115 20 SER A 2 ? ? -46.85 167.82 116 20 SER A 8 ? ? 38.54 42.03 117 20 SER A 16 ? ? -34.50 105.57 118 20 PRO A 37 ? ? -69.80 -173.75 119 20 ARG A 38 ? ? -33.81 -70.38 120 20 SER A 40 ? ? -93.59 -75.14 121 20 SER A 41 ? ? -134.97 -51.13 122 20 PRO A 52 ? ? -69.77 4.09 #