data_2CSF # _entry.id 2CSF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2CSF pdb_00002csf 10.2210/pdb2csf/pdb RCSB RCSB024571 ? ? WWPDB D_1000024571 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk002001010.3 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2CSF _pdbx_database_status.recvd_initial_deposition_date 2005-05-21 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Inoue, K.' 1 'Hayashi, F.' 2 'Yokoyama, S.' 3 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 # _citation.id primary _citation.title 'Solution structure of the second CUT domain of human SATB2' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Inoue, K.' 1 ? primary 'Hayashi, F.' 2 ? primary 'Yokoyama, S.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'DNA-binding protein SATB2' _entity.formula_weight 11275.589 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'CUT domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Special AT-rich sequence-binding protein 2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGPIKVDGANINITAAIYDEIQQEMKRAKVSQALFAKVAANKSQGWLCELLRWKENPSPENRTLWENLCTIRRFL NLPQHERDVIYEEESSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGPIKVDGANINITAAIYDEIQQEMKRAKVSQALFAKVAANKSQGWLCELLRWKENPSPENRTLWENLCTIRRFL NLPQHERDVIYEEESSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk002001010.3 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 PRO n 1 9 ILE n 1 10 LYS n 1 11 VAL n 1 12 ASP n 1 13 GLY n 1 14 ALA n 1 15 ASN n 1 16 ILE n 1 17 ASN n 1 18 ILE n 1 19 THR n 1 20 ALA n 1 21 ALA n 1 22 ILE n 1 23 TYR n 1 24 ASP n 1 25 GLU n 1 26 ILE n 1 27 GLN n 1 28 GLN n 1 29 GLU n 1 30 MET n 1 31 LYS n 1 32 ARG n 1 33 ALA n 1 34 LYS n 1 35 VAL n 1 36 SER n 1 37 GLN n 1 38 ALA n 1 39 LEU n 1 40 PHE n 1 41 ALA n 1 42 LYS n 1 43 VAL n 1 44 ALA n 1 45 ALA n 1 46 ASN n 1 47 LYS n 1 48 SER n 1 49 GLN n 1 50 GLY n 1 51 TRP n 1 52 LEU n 1 53 CYS n 1 54 GLU n 1 55 LEU n 1 56 LEU n 1 57 ARG n 1 58 TRP n 1 59 LYS n 1 60 GLU n 1 61 ASN n 1 62 PRO n 1 63 SER n 1 64 PRO n 1 65 GLU n 1 66 ASN n 1 67 ARG n 1 68 THR n 1 69 LEU n 1 70 TRP n 1 71 GLU n 1 72 ASN n 1 73 LEU n 1 74 CYS n 1 75 THR n 1 76 ILE n 1 77 ARG n 1 78 ARG n 1 79 PHE n 1 80 LEU n 1 81 ASN n 1 82 LEU n 1 83 PRO n 1 84 GLN n 1 85 HIS n 1 86 GLU n 1 87 ARG n 1 88 ASP n 1 89 VAL n 1 90 ILE n 1 91 TYR n 1 92 GLU n 1 93 GLU n 1 94 GLU n 1 95 SER n 1 96 SER n 1 97 GLY n 1 98 PRO n 1 99 SER n 1 100 SER n 1 101 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'KAZUSA cDNA fh00753' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P040705-12 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SATB2_HUMAN _struct_ref.pdbx_db_accession Q9UPW6 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PIKVDGANINITAAIYDEIQQEMKRAKVSQALFAKVAANKSQGWLCELLRWKENPSPENRTLWENLCTIRRFLNLPQHER DVIYEEES ; _struct_ref.pdbx_align_begin 473 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2CSF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 95 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9UPW6 _struct_ref_seq.db_align_beg 473 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 560 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 95 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2CSF GLY A 1 ? UNP Q9UPW6 ? ? 'cloning artifact' 1 1 1 2CSF SER A 2 ? UNP Q9UPW6 ? ? 'cloning artifact' 2 2 1 2CSF SER A 3 ? UNP Q9UPW6 ? ? 'cloning artifact' 3 3 1 2CSF GLY A 4 ? UNP Q9UPW6 ? ? 'cloning artifact' 4 4 1 2CSF SER A 5 ? UNP Q9UPW6 ? ? 'cloning artifact' 5 5 1 2CSF SER A 6 ? UNP Q9UPW6 ? ? 'cloning artifact' 6 6 1 2CSF GLY A 7 ? UNP Q9UPW6 ? ? 'cloning artifact' 7 7 1 2CSF SER A 96 ? UNP Q9UPW6 ? ? 'cloning artifact' 96 8 1 2CSF GLY A 97 ? UNP Q9UPW6 ? ? 'cloning artifact' 97 9 1 2CSF PRO A 98 ? UNP Q9UPW6 ? ? 'cloning artifact' 98 10 1 2CSF SER A 99 ? UNP Q9UPW6 ? ? 'cloning artifact' 99 11 1 2CSF SER A 100 ? UNP Q9UPW6 ? ? 'cloning artifact' 100 12 1 2CSF GLY A 101 ? UNP Q9UPW6 ? ? 'cloning artifact' 101 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.23mM U-15N, 13C-labeled protein; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2CSF _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2CSF _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2CSF _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9296 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2CSF _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2CSF _struct.title 'Solution structure of the second CUT domain of human SATB2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2CSF _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text ;CUT domain, DNA-binding protein SATB2, Special AT-rich sequence-binding protein 2, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 20 ? LYS A 34 ? ALA A 20 LYS A 34 1 ? 15 HELX_P HELX_P2 2 SER A 36 ? ALA A 44 ? SER A 36 ALA A 44 1 ? 9 HELX_P HELX_P3 3 SER A 48 ? LYS A 59 ? SER A 48 LYS A 59 1 ? 12 HELX_P HELX_P4 4 ASN A 66 ? ASN A 81 ? ASN A 66 ASN A 81 1 ? 16 HELX_P HELX_P5 5 PRO A 83 ? SER A 95 ? PRO A 83 SER A 95 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2CSF _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2CSF _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 TRP 51 51 51 TRP TRP A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 TRP 58 58 58 TRP TRP A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 TRP 70 70 70 TRP TRP A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 CYS 74 74 74 CYS CYS A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 HIS 85 85 85 HIS HIS A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 PRO 98 98 98 PRO PRO A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 GLY 101 101 101 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-21 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 9 ? ? -53.51 109.88 2 1 LYS A 10 ? ? -44.10 151.29 3 1 ALA A 44 ? ? -90.94 -64.93 4 1 SER A 99 ? ? -50.56 108.41 5 1 SER A 100 ? ? -170.59 138.63 6 2 SER A 6 ? ? -171.70 122.52 7 2 ALA A 44 ? ? -102.27 -61.00 8 2 SER A 100 ? ? -52.48 176.41 9 3 SER A 3 ? ? -39.60 116.51 10 3 ILE A 22 ? ? -39.54 -38.21 11 3 GLU A 94 ? ? -62.64 -70.28 12 4 ASP A 12 ? ? -172.29 124.18 13 4 ALA A 14 ? ? -67.05 82.35 14 4 LYS A 34 ? ? 70.68 44.39 15 4 ALA A 44 ? ? -91.58 -64.95 16 4 GLU A 60 ? ? -50.46 173.01 17 4 PRO A 64 ? ? -69.80 1.02 18 4 GLU A 94 ? ? -70.82 -70.31 19 4 PRO A 98 ? ? -69.72 -174.41 20 5 ILE A 16 ? ? -34.35 131.17 21 5 ILE A 22 ? ? -39.48 -38.27 22 5 SER A 99 ? ? -175.01 149.50 23 6 SER A 3 ? ? -52.64 95.51 24 6 ALA A 14 ? ? -46.31 159.56 25 6 LYS A 34 ? ? 70.59 49.18 26 6 ALA A 44 ? ? -97.94 -63.37 27 6 PRO A 64 ? ? -69.81 0.27 28 7 VAL A 11 ? ? -172.02 125.98 29 7 ILE A 22 ? ? -39.45 -38.80 30 7 LYS A 34 ? ? 70.97 46.19 31 7 ALA A 44 ? ? -94.78 -60.93 32 8 ILE A 16 ? ? -34.30 127.67 33 8 ALA A 44 ? ? -102.54 -60.61 34 8 GLU A 60 ? ? -44.77 170.38 35 8 PRO A 64 ? ? -69.80 0.22 36 8 GLU A 94 ? ? -62.81 -71.02 37 8 SER A 96 ? ? -86.74 42.02 38 8 SER A 99 ? ? -47.31 155.32 39 9 ILE A 9 ? ? -68.94 87.53 40 9 LYS A 34 ? ? 70.26 51.91 41 9 GLN A 37 ? ? -39.99 -33.11 42 9 ALA A 44 ? ? -92.60 -63.62 43 9 GLU A 60 ? ? -51.58 -174.68 44 9 PRO A 64 ? ? -69.73 0.28 45 9 ARG A 67 ? ? -70.73 -70.17 46 10 ILE A 16 ? ? -37.27 128.47 47 10 PRO A 64 ? ? -69.74 0.18 48 10 GLU A 94 ? ? -66.58 -70.66 49 11 SER A 3 ? ? -36.77 111.51 50 11 SER A 5 ? ? -69.43 92.13 51 11 LYS A 10 ? ? -168.34 112.51 52 11 ALA A 44 ? ? -95.73 -63.94 53 11 SER A 96 ? ? -106.22 43.44 54 12 VAL A 11 ? ? -172.33 141.90 55 12 ASP A 12 ? ? -174.40 149.83 56 12 ALA A 14 ? ? -92.30 -60.57 57 12 GLN A 37 ? ? -39.48 -36.13 58 12 ALA A 44 ? ? -99.80 -63.00 59 13 SER A 6 ? ? -87.60 43.50 60 13 ILE A 9 ? ? -64.62 89.74 61 13 ALA A 44 ? ? -96.07 -60.20 62 13 GLU A 60 ? ? -51.20 -175.68 63 13 PRO A 64 ? ? -69.71 0.36 64 13 LEU A 69 ? ? -90.17 -67.06 65 13 GLU A 71 ? ? -48.53 -70.18 66 13 GLU A 94 ? ? -61.76 -72.36 67 14 ALA A 14 ? ? -101.59 40.78 68 14 ALA A 44 ? ? -100.80 -61.72 69 14 SER A 99 ? ? -55.42 171.62 70 15 ALA A 44 ? ? -93.97 -63.20 71 15 GLU A 60 ? ? -50.82 170.65 72 15 PRO A 64 ? ? -69.81 0.45 73 16 SER A 2 ? ? -92.92 42.02 74 16 SER A 6 ? ? -43.09 154.51 75 16 ALA A 14 ? ? -85.55 42.13 76 16 ALA A 44 ? ? -99.75 -60.47 77 16 GLU A 60 ? ? -50.87 -176.45 78 16 PRO A 64 ? ? -69.84 0.43 79 16 LEU A 69 ? ? -90.21 -67.13 80 16 PRO A 98 ? ? -69.82 -177.13 81 17 LYS A 34 ? ? 71.82 40.21 82 17 ALA A 44 ? ? -100.35 -61.64 83 17 GLU A 60 ? ? -50.52 -178.57 84 17 PRO A 64 ? ? -69.79 0.10 85 17 GLU A 71 ? ? -49.21 -70.02 86 18 SER A 6 ? ? -57.96 98.07 87 18 ILE A 9 ? ? 28.11 53.34 88 18 ILE A 22 ? ? -39.20 -38.77 89 18 LYS A 34 ? ? 71.94 42.28 90 18 ALA A 44 ? ? -92.98 -63.51 91 18 GLU A 60 ? ? -51.13 175.06 92 18 SER A 99 ? ? -63.72 90.02 93 19 ASP A 12 ? ? -170.76 113.03 94 19 ILE A 22 ? ? -39.38 -39.05 95 19 PRO A 64 ? ? -69.81 0.05 96 19 GLU A 94 ? ? -61.01 -71.10 97 20 ALA A 14 ? ? -172.72 143.76 98 20 ASN A 15 ? ? -35.70 141.56 99 20 ALA A 44 ? ? -95.11 -62.27 100 20 GLU A 60 ? ? -51.67 171.49 101 20 SER A 99 ? ? -130.86 -43.69 #