data_2CSY # _entry.id 2CSY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2CSY pdb_00002csy 10.2210/pdb2csy/pdb RCSB RCSB024587 ? ? WWPDB D_1000024587 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002010760.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2CSY _pdbx_database_status.recvd_initial_deposition_date 2005-05-23 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Miyamoto, K.' 1 'Sato, M.' 2 'Tomizawa, T.' 3 'Saito, K.' 4 'Koshiba, S.' 5 'Inoue, M.' 6 'Kigawa, T.' 7 'Yokoyama, S.' 8 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 9 # _citation.id primary _citation.title 'Solution structure of the RING domain of the Zinc finger protein 183-like 1' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Miyamoto, K.' 1 ? primary 'Sato, M.' 2 ? primary 'Tomizawa, T.' 3 ? primary 'Saito, K.' 4 ? primary 'Koshiba, S.' 5 ? primary 'Inoue, M.' 6 ? primary 'Kigawa, T.' 7 ? primary 'Yokoyama, S.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Zinc finger protein 183-like 1' 8891.057 1 ? ? 'RING domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RING finger protein 161' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGGSEEEEIPFRCFICRQAFQNPVVTKCRHYFCESCALEHFRATPRCYICDQPTGGIFNPAKELMAKLQKSGPSS G ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGGSEEEEIPFRCFICRQAFQNPVVTKCRHYFCESCALEHFRATPRCYICDQPTGGIFNPAKELMAKLQKSGPSS G ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002010760.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLY n 1 9 SER n 1 10 GLU n 1 11 GLU n 1 12 GLU n 1 13 GLU n 1 14 ILE n 1 15 PRO n 1 16 PHE n 1 17 ARG n 1 18 CYS n 1 19 PHE n 1 20 ILE n 1 21 CYS n 1 22 ARG n 1 23 GLN n 1 24 ALA n 1 25 PHE n 1 26 GLN n 1 27 ASN n 1 28 PRO n 1 29 VAL n 1 30 VAL n 1 31 THR n 1 32 LYS n 1 33 CYS n 1 34 ARG n 1 35 HIS n 1 36 TYR n 1 37 PHE n 1 38 CYS n 1 39 GLU n 1 40 SER n 1 41 CYS n 1 42 ALA n 1 43 LEU n 1 44 GLU n 1 45 HIS n 1 46 PHE n 1 47 ARG n 1 48 ALA n 1 49 THR n 1 50 PRO n 1 51 ARG n 1 52 CYS n 1 53 TYR n 1 54 ILE n 1 55 CYS n 1 56 ASP n 1 57 GLN n 1 58 PRO n 1 59 THR n 1 60 GLY n 1 61 GLY n 1 62 ILE n 1 63 PHE n 1 64 ASN n 1 65 PRO n 1 66 ALA n 1 67 LYS n 1 68 GLU n 1 69 LEU n 1 70 MET n 1 71 ALA n 1 72 LYS n 1 73 LEU n 1 74 GLN n 1 75 LYS n 1 76 SER n 1 77 GLY n 1 78 PRO n 1 79 SER n 1 80 SER n 1 81 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ZNF183L1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P041206-06 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code R113B_HUMAN _struct_ref.pdbx_db_accession Q8IZP6 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GSEEEEIPFRCFICRQAFQNPVVTKCRHYFCESCALEHFRATPRCYICDQPTGGIFNPAKELMAKLQK _struct_ref.pdbx_align_begin 246 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2CSY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 75 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8IZP6 _struct_ref_seq.db_align_beg 246 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 313 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 75 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2CSY GLY A 1 ? UNP Q8IZP6 ? ? 'cloning artifact' 1 1 1 2CSY SER A 2 ? UNP Q8IZP6 ? ? 'cloning artifact' 2 2 1 2CSY SER A 3 ? UNP Q8IZP6 ? ? 'cloning artifact' 3 3 1 2CSY GLY A 4 ? UNP Q8IZP6 ? ? 'cloning artifact' 4 4 1 2CSY SER A 5 ? UNP Q8IZP6 ? ? 'cloning artifact' 5 5 1 2CSY SER A 6 ? UNP Q8IZP6 ? ? 'cloning artifact' 6 6 1 2CSY GLY A 7 ? UNP Q8IZP6 ? ? 'cloning artifact' 7 7 1 2CSY SER A 76 ? UNP Q8IZP6 ? ? 'cloning artifact' 76 8 1 2CSY GLY A 77 ? UNP Q8IZP6 ? ? 'cloning artifact' 77 9 1 2CSY PRO A 78 ? UNP Q8IZP6 ? ? 'cloning artifact' 78 10 1 2CSY SER A 79 ? UNP Q8IZP6 ? ? 'cloning artifact' 79 11 1 2CSY SER A 80 ? UNP Q8IZP6 ? ? 'cloning artifact' 80 12 1 2CSY GLY A 81 ? UNP Q8IZP6 ? ? 'cloning artifact' 81 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120 _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1.47mM RING domain U-13C,15N; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 0.05mM ZNCl2; 0.05mM EDTA; 90% H2O, 10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2CSY _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2CSY _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function,structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2CSY _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B. A.' 3 'data analysis' KUJIRA 0.925 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2CSY _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2CSY _struct.title 'Solution structure of the RING domain of the Zinc finger protein 183-like 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2CSY _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;Zinc finger protein 183-like 1, RING finger protein 161, RING domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 39 ? ALA A 48 ? GLU A 39 ALA A 48 1 ? 10 HELX_P HELX_P2 2 LYS A 67 ? LEU A 73 ? LYS A 67 LEU A 73 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 18 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 18 A ZN 201 1_555 ? ? ? ? ? ? ? 2.324 ? ? metalc2 metalc ? ? A CYS 21 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 21 A ZN 201 1_555 ? ? ? ? ? ? ? 2.316 ? ? metalc3 metalc ? ? A CYS 33 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 33 A ZN 401 1_555 ? ? ? ? ? ? ? 2.372 ? ? metalc4 metalc ? ? A HIS 35 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 35 A ZN 401 1_555 ? ? ? ? ? ? ? 2.325 ? ? metalc5 metalc ? ? A CYS 38 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 38 A ZN 201 1_555 ? ? ? ? ? ? ? 2.363 ? ? metalc6 metalc ? ? A CYS 41 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 41 A ZN 201 1_555 ? ? ? ? ? ? ? 2.304 ? ? metalc7 metalc ? ? A CYS 52 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 52 A ZN 401 1_555 ? ? ? ? ? ? ? 2.321 ? ? metalc8 metalc ? ? A CYS 55 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 55 A ZN 401 1_555 ? ? ? ? ? ? ? 2.329 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 36 ? CYS A 38 ? TYR A 36 CYS A 38 A 2 PRO A 28 ? VAL A 30 ? PRO A 28 VAL A 30 A 3 ASN A 64 ? PRO A 65 ? ASN A 64 PRO A 65 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O PHE A 37 ? O PHE A 37 N VAL A 29 ? N VAL A 29 A 2 3 N VAL A 30 ? N VAL A 30 O ASN A 64 ? O ASN A 64 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 5 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 18 ? CYS A 18 . ? 1_555 ? 2 AC1 4 CYS A 21 ? CYS A 21 . ? 1_555 ? 3 AC1 4 CYS A 38 ? CYS A 38 . ? 1_555 ? 4 AC1 4 CYS A 41 ? CYS A 41 . ? 1_555 ? 5 AC2 5 CYS A 33 ? CYS A 33 . ? 1_555 ? 6 AC2 5 HIS A 35 ? HIS A 35 . ? 1_555 ? 7 AC2 5 PHE A 37 ? PHE A 37 . ? 1_555 ? 8 AC2 5 CYS A 52 ? CYS A 52 . ? 1_555 ? 9 AC2 5 CYS A 55 ? CYS A 55 . ? 1_555 ? # _database_PDB_matrix.entry_id 2CSY _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2CSY _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 CYS 52 52 52 CYS CYS A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 CYS 55 55 55 CYS CYS A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 MET 70 70 70 MET MET A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 GLY 81 81 81 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 21 ? A CYS 21 ? 1_555 92.0 ? 2 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 38 ? A CYS 38 ? 1_555 92.2 ? 3 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 38 ? A CYS 38 ? 1_555 108.5 ? 4 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 41 ? A CYS 41 ? 1_555 120.5 ? 5 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 41 ? A CYS 41 ? 1_555 119.9 ? 6 SG ? A CYS 38 ? A CYS 38 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 41 ? A CYS 41 ? 1_555 118.0 ? 7 SG ? A CYS 33 ? A CYS 33 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 35 ? A HIS 35 ? 1_555 105.0 ? 8 SG ? A CYS 33 ? A CYS 33 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 52 ? A CYS 52 ? 1_555 117.1 ? 9 ND1 ? A HIS 35 ? A HIS 35 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 52 ? A CYS 52 ? 1_555 119.0 ? 10 SG ? A CYS 33 ? A CYS 33 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 55 ? A CYS 55 ? 1_555 98.7 ? 11 ND1 ? A HIS 35 ? A HIS 35 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 55 ? A CYS 55 ? 1_555 115.3 ? 12 SG ? A CYS 52 ? A CYS 52 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 55 ? A CYS 55 ? 1_555 100.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-23 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.pdbx_dist_value' 6 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 7 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 10 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 11 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 12 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 13 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 16 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 17 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 18 4 'Structure model' '_struct_ref_seq_dif.details' 19 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 20 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 21 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX DETERMINATION METHOD: AUTHOR DETERMINED ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 11 ? ? -52.01 102.63 2 1 GLU A 13 ? ? -82.20 40.20 3 1 GLU A 39 ? ? -39.69 -31.53 4 1 PRO A 58 ? ? -69.79 84.82 5 1 ALA A 66 ? ? -88.70 36.59 6 1 GLN A 74 ? ? -48.22 159.34 7 1 SER A 76 ? ? -42.91 -70.96 8 2 GLU A 39 ? ? -39.88 -34.38 9 2 PRO A 50 ? ? -69.77 3.57 10 2 PRO A 58 ? ? -69.74 88.63 11 2 ALA A 66 ? ? -109.43 43.44 12 3 ILE A 14 ? ? -36.47 134.95 13 3 PHE A 25 ? ? -51.71 108.78 14 3 GLU A 39 ? ? -38.59 -35.33 15 3 PRO A 50 ? ? -69.73 3.74 16 3 PRO A 58 ? ? -69.75 89.40 17 3 ALA A 66 ? ? -92.38 41.33 18 3 PRO A 78 ? ? -69.75 90.10 19 4 SER A 5 ? ? -170.03 140.24 20 4 ILE A 14 ? ? -36.92 136.25 21 4 PHE A 25 ? ? -49.76 109.69 22 4 PRO A 50 ? ? -69.69 2.89 23 4 PRO A 58 ? ? -69.73 88.48 24 4 ALA A 66 ? ? -95.96 39.39 25 4 LYS A 75 ? ? -55.89 107.91 26 4 SER A 80 ? ? -171.64 140.91 27 5 SER A 2 ? ? -62.49 91.16 28 5 GLU A 13 ? ? -83.22 35.55 29 5 PRO A 50 ? ? -69.82 2.92 30 5 PRO A 58 ? ? -69.76 89.20 31 5 ALA A 66 ? ? -86.86 41.83 32 5 GLN A 74 ? ? -37.74 -71.58 33 5 LYS A 75 ? ? -175.23 141.70 34 6 SER A 2 ? ? 38.35 41.92 35 6 GLU A 13 ? ? -35.05 -34.07 36 6 ILE A 14 ? ? -37.44 135.91 37 6 GLU A 39 ? ? -39.13 -34.77 38 6 PRO A 50 ? ? -69.75 3.23 39 6 PRO A 58 ? ? -69.70 86.32 40 6 ALA A 66 ? ? -97.88 40.06 41 6 PRO A 78 ? ? -69.74 1.23 42 7 ILE A 14 ? ? -34.12 130.35 43 7 GLU A 39 ? ? -38.66 -34.71 44 7 PRO A 50 ? ? -69.80 3.50 45 7 PRO A 58 ? ? -69.79 89.42 46 7 ALA A 66 ? ? -86.43 42.18 47 8 ILE A 14 ? ? -34.57 137.36 48 8 GLU A 39 ? ? -38.88 -33.36 49 8 PRO A 50 ? ? -69.70 2.65 50 8 PRO A 58 ? ? -69.81 85.12 51 8 ALA A 66 ? ? -95.77 41.93 52 8 SER A 76 ? ? -104.20 -60.07 53 9 GLU A 11 ? ? 39.15 46.42 54 9 ILE A 14 ? ? -33.27 133.70 55 9 PHE A 25 ? ? -50.46 107.33 56 9 PRO A 50 ? ? -69.75 2.76 57 9 PRO A 58 ? ? -69.84 93.37 58 9 ALA A 66 ? ? -91.50 39.84 59 9 SER A 76 ? ? -105.29 -61.50 60 10 SER A 9 ? ? 73.68 53.67 61 10 GLU A 12 ? ? -103.93 76.76 62 10 GLU A 13 ? ? -104.36 42.38 63 10 PRO A 50 ? ? -69.73 2.88 64 10 PRO A 58 ? ? -69.78 90.97 65 10 ALA A 66 ? ? -102.59 40.16 66 11 SER A 2 ? ? 36.57 41.78 67 11 SER A 3 ? ? -95.85 42.31 68 11 SER A 9 ? ? -59.14 90.46 69 11 ILE A 14 ? ? -39.58 127.90 70 11 GLU A 39 ? ? -39.03 -34.50 71 11 PRO A 50 ? ? -69.76 3.61 72 11 PRO A 58 ? ? -69.75 92.26 73 11 ALA A 66 ? ? -105.33 40.29 74 12 ILE A 14 ? ? -36.35 135.60 75 12 PHE A 25 ? ? -48.06 107.54 76 12 GLU A 39 ? ? -39.07 -35.24 77 12 PRO A 50 ? ? -69.75 2.63 78 12 PRO A 58 ? ? -69.74 91.15 79 12 ALA A 66 ? ? -90.91 36.07 80 12 PRO A 78 ? ? -69.78 84.30 81 12 SER A 79 ? ? -171.29 126.44 82 13 SER A 5 ? ? -101.69 42.14 83 13 GLU A 12 ? ? -172.78 109.09 84 13 PRO A 50 ? ? -69.75 3.14 85 13 PRO A 58 ? ? -69.79 88.86 86 13 ALA A 66 ? ? -95.42 40.03 87 13 SER A 79 ? ? -37.70 145.71 88 14 ILE A 14 ? ? -35.35 133.69 89 14 GLU A 39 ? ? -39.26 -29.70 90 14 PRO A 50 ? ? -69.72 3.95 91 14 PRO A 58 ? ? -69.74 83.49 92 14 ALA A 66 ? ? -94.84 40.56 93 15 SER A 2 ? ? -64.48 93.09 94 15 ILE A 14 ? ? -39.90 132.74 95 15 GLU A 39 ? ? -39.35 -29.45 96 15 PRO A 50 ? ? -69.74 2.68 97 15 PRO A 58 ? ? -69.70 88.51 98 15 ALA A 66 ? ? -89.61 44.13 99 15 SER A 80 ? ? -36.99 137.29 100 16 SER A 2 ? ? -34.94 116.65 101 16 GLU A 12 ? ? -174.20 118.30 102 16 GLU A 39 ? ? -38.98 -32.06 103 16 PRO A 50 ? ? -69.72 3.64 104 16 PRO A 58 ? ? -69.73 92.68 105 16 ALA A 66 ? ? -94.19 38.42 106 16 LYS A 75 ? ? -56.00 103.94 107 17 ILE A 14 ? ? -35.37 137.15 108 17 PHE A 25 ? ? -53.87 109.29 109 17 GLU A 39 ? ? -37.22 -32.86 110 17 PRO A 50 ? ? -69.74 2.40 111 17 PRO A 58 ? ? -69.80 89.55 112 17 ALA A 66 ? ? -89.29 38.57 113 18 ILE A 14 ? ? -34.91 136.00 114 18 PHE A 25 ? ? -48.24 107.54 115 18 GLU A 39 ? ? -39.74 -32.89 116 18 PRO A 50 ? ? -69.73 3.36 117 18 ALA A 66 ? ? -94.62 42.49 118 19 GLU A 11 ? ? -102.96 48.02 119 19 ILE A 14 ? ? -33.76 129.20 120 19 GLU A 39 ? ? -38.85 -32.34 121 19 PRO A 50 ? ? -69.76 2.96 122 19 PRO A 58 ? ? -69.75 89.07 123 19 ALA A 66 ? ? -95.82 41.66 124 19 PRO A 78 ? ? -69.71 90.56 125 19 SER A 79 ? ? -57.61 90.55 126 20 ILE A 14 ? ? -37.42 129.21 127 20 PRO A 50 ? ? -69.72 2.15 128 20 PRO A 58 ? ? -69.72 83.39 129 20 ALA A 66 ? ? -87.40 40.24 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #