data_2CT2 # _entry.id 2CT2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2CT2 pdb_00002ct2 10.2210/pdb2ct2/pdb RCSB RCSB024591 ? ? WWPDB D_1000024591 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-23 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site 9 5 'Structure model' chem_comp_atom 10 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.pdbx_dist_value' 6 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 7 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 10 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 11 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 12 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 13 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 16 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 17 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 18 4 'Structure model' '_struct_ref_seq_dif.details' 19 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 20 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 21 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2CT2 _pdbx_database_status.recvd_initial_deposition_date 2005-05-23 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002005098.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Miyamoto, K.' 1 'Tochio, N.' 2 'Sato, M.' 3 'Koshiba, S.' 4 'Inoue, M.' 5 'Kigawa, T.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution Structure of the RING domain of the Tripartite motif protein 32' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Miyamoto, K.' 1 ? primary 'Tochio, N.' 2 ? primary 'Sato, M.' 3 ? primary 'Koshiba, S.' 4 ? primary 'Inoue, M.' 5 ? primary 'Kigawa, T.' 6 ? primary 'Yokoyama, S.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tripartite motif protein 32' 9492.962 1 6.3.2.- ? 'RING domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Zinc-finger protein HT2A, 72 kDa Tat-interacting protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASSINGVRCPFCSKITRITSLTQLTDNLTV LKSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASSINGVRCPFCSKITRITSLTQLTDNLTV LKSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002005098.1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 ASN n 1 9 LEU n 1 10 ASP n 1 11 ALA n 1 12 LEU n 1 13 ARG n 1 14 GLU n 1 15 VAL n 1 16 LEU n 1 17 GLU n 1 18 CYS n 1 19 PRO n 1 20 ILE n 1 21 CYS n 1 22 MET n 1 23 GLU n 1 24 SER n 1 25 PHE n 1 26 THR n 1 27 GLU n 1 28 GLU n 1 29 GLN n 1 30 LEU n 1 31 ARG n 1 32 PRO n 1 33 LYS n 1 34 LEU n 1 35 LEU n 1 36 HIS n 1 37 CYS n 1 38 GLY n 1 39 HIS n 1 40 THR n 1 41 ILE n 1 42 CYS n 1 43 ARG n 1 44 GLN n 1 45 CYS n 1 46 LEU n 1 47 GLU n 1 48 LYS n 1 49 LEU n 1 50 LEU n 1 51 ALA n 1 52 SER n 1 53 SER n 1 54 ILE n 1 55 ASN n 1 56 GLY n 1 57 VAL n 1 58 ARG n 1 59 CYS n 1 60 PRO n 1 61 PHE n 1 62 CYS n 1 63 SER n 1 64 LYS n 1 65 ILE n 1 66 THR n 1 67 ARG n 1 68 ILE n 1 69 THR n 1 70 SER n 1 71 LEU n 1 72 THR n 1 73 GLN n 1 74 LEU n 1 75 THR n 1 76 ASP n 1 77 ASN n 1 78 LEU n 1 79 THR n 1 80 VAL n 1 81 LEU n 1 82 LYS n 1 83 SER n 1 84 GLY n 1 85 PRO n 1 86 SER n 1 87 SER n 1 88 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene TRIM32 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P041101-17 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 HIS 36 36 36 HIS HIS A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 CYS 62 62 62 CYS CYS A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 GLY 88 88 88 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _exptl.entry_id 2CT2 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2CT2 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2CT2 _struct.title 'Solution Structure of the RING domain of the Tripartite motif protein 32' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2CT2 _struct_keywords.pdbx_keywords LIGASE _struct_keywords.text ;Tripartite motif protein 32, Zinc-finger protein HT2A, Tat-interacting protein, RING domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIGASE ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRI32_HUMAN _struct_ref.pdbx_db_accession Q13049 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code NLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASSINGVRCPFCSKITRITSLTQLTDNLTVLK _struct_ref.pdbx_align_begin 10 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2CT2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 82 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q13049 _struct_ref_seq.db_align_beg 10 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 84 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 82 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2CT2 GLY A 1 ? UNP Q13049 ? ? 'cloning artifact' 1 1 1 2CT2 SER A 2 ? UNP Q13049 ? ? 'cloning artifact' 2 2 1 2CT2 SER A 3 ? UNP Q13049 ? ? 'cloning artifact' 3 3 1 2CT2 GLY A 4 ? UNP Q13049 ? ? 'cloning artifact' 4 4 1 2CT2 SER A 5 ? UNP Q13049 ? ? 'cloning artifact' 5 5 1 2CT2 SER A 6 ? UNP Q13049 ? ? 'cloning artifact' 6 6 1 2CT2 GLY A 7 ? UNP Q13049 ? ? 'cloning artifact' 7 7 1 2CT2 SER A 83 ? UNP Q13049 ? ? 'cloning artifact' 83 8 1 2CT2 GLY A 84 ? UNP Q13049 ? ? 'cloning artifact' 84 9 1 2CT2 PRO A 85 ? UNP Q13049 ? ? 'cloning artifact' 85 10 1 2CT2 SER A 86 ? UNP Q13049 ? ? 'cloning artifact' 86 11 1 2CT2 SER A 87 ? UNP Q13049 ? ? 'cloning artifact' 87 12 1 2CT2 GLY A 88 ? UNP Q13049 ? ? 'cloning artifact' 88 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ARG _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 43 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id SER _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 52 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ARG _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 43 _struct_conf.end_auth_comp_id SER _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 52 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 18 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 18 A ZN 201 1_555 ? ? ? ? ? ? ? 2.321 ? ? metalc2 metalc ? ? A CYS 21 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 21 A ZN 201 1_555 ? ? ? ? ? ? ? 2.326 ? ? metalc3 metalc ? ? A CYS 37 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 37 A ZN 401 1_555 ? ? ? ? ? ? ? 2.330 ? ? metalc4 metalc ? ? A HIS 39 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 39 A ZN 401 1_555 ? ? ? ? ? ? ? 2.328 ? ? metalc5 metalc ? ? A CYS 42 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 42 A ZN 201 1_555 ? ? ? ? ? ? ? 2.282 ? ? metalc6 metalc ? ? A CYS 45 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 45 A ZN 201 1_555 ? ? ? ? ? ? ? 2.306 ? ? metalc7 metalc ? ? A CYS 59 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 59 A ZN 401 1_555 ? ? ? ? ? ? ? 2.363 ? ? metalc8 metalc ? ? A CYS 62 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 62 A ZN 401 1_555 ? ? ? ? ? ? ? 2.329 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 21 ? A CYS 21 ? 1_555 101.9 ? 2 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 114.2 ? 3 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 91.9 ? 4 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 45 ? A CYS 45 ? 1_555 121.3 ? 5 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 45 ? A CYS 45 ? 1_555 119.0 ? 6 SG ? A CYS 42 ? A CYS 42 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 45 ? A CYS 45 ? 1_555 105.1 ? 7 SG ? A CYS 37 ? A CYS 37 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 39 ? A HIS 39 ? 1_555 111.9 ? 8 SG ? A CYS 37 ? A CYS 37 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 59 ? A CYS 59 ? 1_555 115.9 ? 9 ND1 ? A HIS 39 ? A HIS 39 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 59 ? A CYS 59 ? 1_555 106.5 ? 10 SG ? A CYS 37 ? A CYS 37 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 62 ? A CYS 62 ? 1_555 92.8 ? 11 ND1 ? A HIS 39 ? A HIS 39 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 62 ? A CYS 62 ? 1_555 118.6 ? 12 SG ? A CYS 59 ? A CYS 59 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 62 ? A CYS 62 ? 1_555 111.3 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 40 ? CYS A 42 ? THR A 40 CYS A 42 A 2 PRO A 32 ? LEU A 34 ? PRO A 32 LEU A 34 A 3 THR A 75 ? ASP A 76 ? THR A 75 ASP A 76 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ILE A 41 ? O ILE A 41 N LYS A 33 ? N LYS A 33 A 2 3 N LEU A 34 ? N LEU A 34 O THR A 75 ? O THR A 75 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 18 ? CYS A 18 . ? 1_555 ? 2 AC1 4 CYS A 21 ? CYS A 21 . ? 1_555 ? 3 AC1 4 CYS A 42 ? CYS A 42 . ? 1_555 ? 4 AC1 4 CYS A 45 ? CYS A 45 . ? 1_555 ? 5 AC2 4 CYS A 37 ? CYS A 37 . ? 1_555 ? 6 AC2 4 HIS A 39 ? HIS A 39 . ? 1_555 ? 7 AC2 4 CYS A 59 ? CYS A 59 . ? 1_555 ? 8 AC2 4 CYS A 62 ? CYS A 62 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 8 ? ? 38.13 41.61 2 1 GLU A 14 ? ? -47.70 164.80 3 1 LEU A 16 ? ? -38.31 -28.23 4 1 ILE A 20 ? ? -109.60 -74.48 5 1 PHE A 25 ? ? -56.82 101.26 6 1 GLN A 29 ? ? -130.20 -72.04 7 1 ARG A 43 ? ? -38.88 -36.40 8 1 SER A 53 ? ? -42.89 157.65 9 1 ILE A 54 ? ? -134.63 -36.88 10 1 ASN A 55 ? ? -105.59 42.10 11 1 PRO A 60 ? ? -69.81 3.66 12 1 PHE A 61 ? ? -106.58 -62.32 13 1 SER A 63 ? ? 74.98 43.43 14 1 ARG A 67 ? ? -52.86 87.21 15 1 LEU A 74 ? ? -51.52 -175.10 16 2 SER A 6 ? ? -38.80 137.61 17 2 ASP A 10 ? ? -160.21 115.89 18 2 ARG A 13 ? ? -109.53 42.11 19 2 ILE A 20 ? ? -111.45 -75.42 20 2 SER A 24 ? ? -35.11 133.33 21 2 GLN A 29 ? ? -128.93 -76.38 22 2 LEU A 30 ? ? -65.42 75.60 23 2 SER A 52 ? ? -73.18 -70.60 24 2 PRO A 60 ? ? -69.71 4.38 25 2 LEU A 74 ? ? -52.45 179.16 26 3 VAL A 15 ? ? -99.12 43.48 27 3 PRO A 19 ? ? -69.77 0.50 28 3 ILE A 20 ? ? -115.12 -74.72 29 3 SER A 24 ? ? -41.79 105.09 30 3 PHE A 25 ? ? -41.99 100.43 31 3 GLN A 29 ? ? -116.67 -70.67 32 3 LEU A 30 ? ? -65.86 75.44 33 3 ARG A 43 ? ? -37.38 -34.57 34 3 ALA A 51 ? ? -50.31 -70.96 35 3 SER A 53 ? ? -51.76 -177.54 36 3 ASN A 55 ? ? 35.59 34.64 37 3 PRO A 60 ? ? -69.80 3.82 38 3 ARG A 67 ? ? -51.65 87.72 39 3 LEU A 74 ? ? -52.59 -174.50 40 3 PRO A 85 ? ? -69.79 94.85 41 4 GLU A 14 ? ? -45.75 167.16 42 4 PRO A 19 ? ? -69.74 1.18 43 4 ILE A 20 ? ? -111.95 -74.59 44 4 SER A 24 ? ? -38.11 125.71 45 4 PHE A 25 ? ? -59.96 100.08 46 4 GLN A 29 ? ? -118.28 -70.35 47 4 LEU A 30 ? ? -69.67 82.91 48 4 ASN A 55 ? ? -109.32 41.84 49 4 PRO A 60 ? ? -69.73 3.30 50 4 SER A 63 ? ? 71.13 48.74 51 4 THR A 69 ? ? -84.46 34.93 52 4 LEU A 74 ? ? -51.31 -175.14 53 4 LYS A 82 ? ? -92.43 40.09 54 4 SER A 83 ? ? 33.84 42.07 55 4 PRO A 85 ? ? -69.77 91.40 56 5 SER A 3 ? ? -35.01 145.23 57 5 SER A 5 ? ? -160.40 115.55 58 5 LEU A 9 ? ? -52.80 176.18 59 5 ARG A 13 ? ? -107.89 40.73 60 5 LEU A 16 ? ? -39.95 -25.59 61 5 PRO A 19 ? ? -69.75 0.22 62 5 ILE A 20 ? ? -114.71 -74.06 63 5 SER A 24 ? ? -39.85 121.19 64 5 PHE A 25 ? ? -59.84 106.69 65 5 GLU A 27 ? ? -96.40 -63.61 66 5 LEU A 30 ? ? 30.22 45.10 67 5 ASN A 55 ? ? -88.99 37.67 68 5 PRO A 60 ? ? -69.77 3.60 69 5 ILE A 65 ? ? -37.73 124.75 70 5 LEU A 74 ? ? -49.23 -179.53 71 6 ARG A 13 ? ? -98.64 36.00 72 6 PRO A 19 ? ? -69.80 0.45 73 6 ILE A 20 ? ? -113.81 -75.29 74 6 SER A 24 ? ? -36.28 129.75 75 6 GLN A 29 ? ? -126.63 -68.54 76 6 SER A 53 ? ? -52.76 -174.66 77 6 ASN A 55 ? ? -132.89 -38.77 78 6 PRO A 60 ? ? -69.76 3.97 79 6 ILE A 65 ? ? -30.93 129.77 80 6 LEU A 74 ? ? -53.69 -174.21 81 6 LYS A 82 ? ? -172.38 147.28 82 6 SER A 83 ? ? -36.51 104.89 83 7 LEU A 12 ? ? -36.72 146.32 84 7 GLU A 14 ? ? -47.18 172.96 85 7 PRO A 19 ? ? -69.73 0.18 86 7 ILE A 20 ? ? -113.41 -73.86 87 7 GLU A 27 ? ? -75.88 48.72 88 7 GLU A 28 ? ? -132.97 -44.04 89 7 GLN A 29 ? ? -132.55 -35.48 90 7 SER A 53 ? ? -46.16 152.82 91 7 ILE A 54 ? ? -131.10 -33.15 92 7 PRO A 60 ? ? -69.80 2.96 93 7 PHE A 61 ? ? -109.74 -67.13 94 7 ILE A 65 ? ? -32.52 125.68 95 7 ARG A 67 ? ? -51.52 90.07 96 7 LEU A 74 ? ? -53.78 -174.26 97 7 LYS A 82 ? ? -33.84 121.32 98 8 PRO A 19 ? ? -69.81 0.41 99 8 ILE A 20 ? ? -114.30 -74.35 100 8 SER A 24 ? ? -37.13 103.72 101 8 PHE A 25 ? ? -39.77 99.70 102 8 GLN A 29 ? ? -122.79 -70.62 103 8 LEU A 30 ? ? -68.78 70.91 104 8 PRO A 60 ? ? -69.73 3.25 105 8 ILE A 65 ? ? -32.15 123.95 106 8 SER A 70 ? ? -175.54 128.33 107 8 LEU A 74 ? ? -50.86 -175.35 108 9 PRO A 19 ? ? -69.81 0.67 109 9 ILE A 20 ? ? -112.10 -73.92 110 9 SER A 24 ? ? -39.66 105.19 111 9 PHE A 25 ? ? -35.79 98.11 112 9 GLU A 27 ? ? -37.11 -39.44 113 9 GLN A 29 ? ? -116.23 -73.01 114 9 LEU A 30 ? ? -66.35 83.60 115 9 ILE A 54 ? ? -132.81 -32.29 116 9 ASN A 55 ? ? -106.71 42.31 117 9 PRO A 60 ? ? -69.70 2.22 118 9 SER A 63 ? ? 72.57 44.67 119 9 ILE A 65 ? ? -36.70 121.94 120 9 ARG A 67 ? ? -59.88 83.62 121 9 ILE A 68 ? ? -130.51 -40.15 122 9 SER A 70 ? ? -172.84 125.74 123 9 LEU A 74 ? ? -50.99 179.24 124 9 ASN A 77 ? ? -117.57 67.28 125 10 PRO A 19 ? ? -69.70 1.06 126 10 ILE A 20 ? ? -112.48 -74.75 127 10 GLU A 27 ? ? -83.62 34.73 128 10 ASN A 55 ? ? -90.72 40.67 129 10 PRO A 60 ? ? -69.78 2.76 130 10 PHE A 61 ? ? -106.45 -62.52 131 10 ILE A 65 ? ? -31.81 120.15 132 10 ARG A 67 ? ? -57.32 92.96 133 10 LEU A 74 ? ? -56.76 -174.86 134 11 SER A 6 ? ? -64.85 96.10 135 11 ASN A 8 ? ? -167.28 111.71 136 11 LEU A 9 ? ? -49.70 150.18 137 11 PRO A 19 ? ? -69.77 1.30 138 11 ILE A 20 ? ? -114.94 -74.81 139 11 SER A 24 ? ? -43.35 109.58 140 11 GLU A 28 ? ? -130.94 -61.13 141 11 ASN A 55 ? ? 45.92 29.39 142 11 PRO A 60 ? ? -69.77 3.60 143 11 ILE A 65 ? ? -29.97 120.38 144 11 ARG A 67 ? ? -54.17 91.04 145 11 LEU A 74 ? ? -55.22 -174.25 146 11 SER A 83 ? ? -91.12 40.47 147 11 SER A 87 ? ? -130.67 -31.52 148 12 SER A 5 ? ? -172.77 111.05 149 12 SER A 6 ? ? -64.08 90.01 150 12 VAL A 15 ? ? -99.30 43.27 151 12 ILE A 20 ? ? -112.26 -74.51 152 12 SER A 24 ? ? -34.67 133.30 153 12 GLU A 27 ? ? -84.95 42.14 154 12 GLU A 28 ? ? -131.92 -43.26 155 12 GLN A 29 ? ? -130.83 -54.19 156 12 SER A 53 ? ? -58.01 -174.30 157 12 ASN A 55 ? ? -134.81 -37.03 158 12 PRO A 60 ? ? -69.82 4.14 159 12 SER A 70 ? ? -172.63 149.97 160 12 LEU A 74 ? ? -50.24 -176.55 161 12 SER A 87 ? ? -108.05 42.57 162 13 SER A 5 ? ? 39.63 42.17 163 13 SER A 6 ? ? -49.53 105.36 164 13 LEU A 12 ? ? -57.66 174.50 165 13 ILE A 20 ? ? -110.73 -74.56 166 13 MET A 22 ? ? 74.94 46.16 167 13 LEU A 30 ? ? 35.02 39.56 168 13 ILE A 54 ? ? -133.57 -35.49 169 13 ASN A 55 ? ? -100.95 43.88 170 13 PRO A 60 ? ? -69.79 4.01 171 13 PHE A 61 ? ? -107.93 -60.28 172 13 ILE A 65 ? ? -33.25 124.73 173 13 LEU A 74 ? ? -46.20 173.07 174 13 ASN A 77 ? ? -115.37 68.47 175 13 PRO A 85 ? ? -69.80 14.24 176 13 SER A 86 ? ? -28.24 -44.60 177 14 SER A 3 ? ? -129.14 -50.15 178 14 LEU A 9 ? ? -170.80 146.72 179 14 LEU A 12 ? ? -40.37 161.43 180 14 PRO A 19 ? ? -69.77 0.08 181 14 ILE A 20 ? ? -111.67 -74.79 182 14 MET A 22 ? ? 71.71 47.18 183 14 GLU A 27 ? ? -76.34 47.15 184 14 GLU A 28 ? ? -133.56 -39.63 185 14 GLN A 29 ? ? -134.36 -41.55 186 14 SER A 52 ? ? -61.79 -70.29 187 14 SER A 53 ? ? -49.84 164.08 188 14 ILE A 54 ? ? -132.87 -43.90 189 14 ASN A 55 ? ? -89.84 44.05 190 14 PRO A 60 ? ? -69.75 3.71 191 14 SER A 63 ? ? 74.86 43.09 192 14 LEU A 74 ? ? -52.42 173.03 193 14 ASN A 77 ? ? -117.26 70.34 194 14 SER A 87 ? ? -133.46 -44.38 195 15 LEU A 9 ? ? -174.60 128.83 196 15 ARG A 13 ? ? -101.10 40.32 197 15 VAL A 15 ? ? -94.91 42.34 198 15 ILE A 20 ? ? -112.82 -73.89 199 15 SER A 24 ? ? -34.71 122.52 200 15 PHE A 25 ? ? -59.87 106.13 201 15 GLN A 29 ? ? -125.74 -71.31 202 15 LEU A 30 ? ? -65.35 80.97 203 15 ARG A 43 ? ? -39.72 -37.22 204 15 SER A 53 ? ? -59.38 -175.54 205 15 ASN A 55 ? ? -134.91 -48.14 206 15 PRO A 60 ? ? -69.72 5.25 207 15 ARG A 67 ? ? -66.62 91.94 208 15 LEU A 74 ? ? -51.93 174.88 209 16 ILE A 20 ? ? -111.98 -74.65 210 16 GLU A 27 ? ? -85.80 43.03 211 16 GLU A 28 ? ? -132.70 -47.75 212 16 GLN A 29 ? ? -127.10 -59.77 213 16 SER A 53 ? ? -51.62 -174.96 214 16 PRO A 60 ? ? -69.79 3.68 215 16 PHE A 61 ? ? -106.66 -61.43 216 16 SER A 63 ? ? 74.95 47.49 217 16 ARG A 67 ? ? -55.02 89.58 218 16 LEU A 74 ? ? -54.02 -175.03 219 16 SER A 83 ? ? -58.05 109.75 220 16 PRO A 85 ? ? -69.75 -177.00 221 17 LEU A 12 ? ? -46.98 154.21 222 17 VAL A 15 ? ? -96.76 31.61 223 17 PRO A 19 ? ? -69.79 1.20 224 17 ILE A 20 ? ? -115.12 -74.47 225 17 SER A 24 ? ? -37.31 130.35 226 17 GLU A 27 ? ? -94.78 -64.50 227 17 GLU A 28 ? ? -84.89 32.75 228 17 LEU A 30 ? ? 32.84 42.33 229 17 ARG A 43 ? ? -38.24 -37.51 230 17 ILE A 54 ? ? -132.46 -40.79 231 17 ASN A 55 ? ? -100.19 47.70 232 17 PRO A 60 ? ? -69.78 4.36 233 17 ILE A 65 ? ? -33.67 125.49 234 17 LEU A 74 ? ? -53.06 -174.26 235 17 LYS A 82 ? ? 36.28 54.59 236 17 PRO A 85 ? ? -69.75 86.58 237 17 SER A 86 ? ? 34.84 41.97 238 18 SER A 3 ? ? -93.60 -61.03 239 18 ARG A 13 ? ? -105.47 44.28 240 18 VAL A 15 ? ? -97.82 41.32 241 18 ILE A 20 ? ? -111.61 -72.55 242 18 MET A 22 ? ? 71.65 49.89 243 18 GLU A 27 ? ? -79.74 45.59 244 18 GLU A 28 ? ? -134.27 -38.48 245 18 GLN A 29 ? ? -133.41 -37.95 246 18 ASN A 55 ? ? -45.25 -18.85 247 18 PRO A 60 ? ? -69.75 3.99 248 18 ILE A 65 ? ? -31.73 123.66 249 18 LEU A 74 ? ? -53.56 -174.86 250 18 ASN A 77 ? ? -117.14 67.73 251 19 ASP A 10 ? ? -162.33 112.06 252 19 VAL A 15 ? ? -100.49 44.12 253 19 PRO A 19 ? ? -69.76 1.79 254 19 GLU A 27 ? ? -80.27 43.92 255 19 GLU A 28 ? ? -131.13 -41.33 256 19 GLN A 29 ? ? -134.76 -34.00 257 19 ILE A 54 ? ? -78.98 -70.57 258 19 ASN A 55 ? ? -130.95 -31.35 259 19 PRO A 60 ? ? -69.79 5.19 260 19 LEU A 74 ? ? -52.58 -174.85 261 20 LEU A 12 ? ? -47.82 171.26 262 20 GLU A 14 ? ? -46.68 164.91 263 20 VAL A 15 ? ? -99.88 34.70 264 20 PRO A 19 ? ? -69.76 0.66 265 20 ILE A 20 ? ? -114.44 -73.33 266 20 SER A 24 ? ? -33.44 129.45 267 20 GLU A 27 ? ? -82.95 38.51 268 20 GLU A 28 ? ? -134.47 -48.51 269 20 PRO A 60 ? ? -69.80 3.24 270 20 ILE A 65 ? ? -35.68 125.90 271 20 ARG A 67 ? ? -51.64 86.34 272 20 LEU A 74 ? ? -52.65 -173.41 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX Determination method: author determined ; # _pdbx_nmr_ensemble.entry_id 2CT2 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2CT2 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.47mM RING domain U-13C, 15N; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 0.05mM ZNCl2; 0.1mM NTA; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120 _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_refine.entry_id 2CT2 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B. A.' 3 'data analysis' KUJIRA 0.925 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 VAL N N N N 318 VAL CA C N S 319 VAL C C N N 320 VAL O O N N 321 VAL CB C N N 322 VAL CG1 C N N 323 VAL CG2 C N N 324 VAL OXT O N N 325 VAL H H N N 326 VAL H2 H N N 327 VAL HA H N N 328 VAL HB H N N 329 VAL HG11 H N N 330 VAL HG12 H N N 331 VAL HG13 H N N 332 VAL HG21 H N N 333 VAL HG22 H N N 334 VAL HG23 H N N 335 VAL HXT H N N 336 ZN ZN ZN N N 337 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 VAL N CA sing N N 304 VAL N H sing N N 305 VAL N H2 sing N N 306 VAL CA C sing N N 307 VAL CA CB sing N N 308 VAL CA HA sing N N 309 VAL C O doub N N 310 VAL C OXT sing N N 311 VAL CB CG1 sing N N 312 VAL CB CG2 sing N N 313 VAL CB HB sing N N 314 VAL CG1 HG11 sing N N 315 VAL CG1 HG12 sing N N 316 VAL CG1 HG13 sing N N 317 VAL CG2 HG21 sing N N 318 VAL CG2 HG22 sing N N 319 VAL CG2 HG23 sing N N 320 VAL OXT HXT sing N N 321 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2CT2 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_